Automatic blacklist update

author Travis CI User <travis@example.org>

Mon, 16 Nov 2020 03:21:45 +0000 (03:21 +0000)

committer Travis CI User <travis@example.org>

Mon, 16 Nov 2020 03:21:45 +0000 (03:21 +0000)
author Travis CI User <travis@example.org>
Mon, 16 Nov 2020 03:21:45 +0000 (03:21 +0000)
committer Travis CI User <travis@example.org>
Mon, 16 Nov 2020 03:21:45 +0000 (03:21 +0000)
diff --git a/README.md b/README.md

index bd36dc695adf0b1ecb6250628cbe141948c1ac82..59978905ea7c125c7195f5edfde7bfb57342b9bb 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 2531698 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 2531703 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 380 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -38,7 +38,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2881 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 327515 | Any website which deliver malware |
+| [malware](blacklists/malware) | 320985 | Any website which deliver malware |
  | [manga](blacklists/manga) | 755 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 152 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index a23949e3830df00a268ed7ec1d28630cc1cd7825..2b92669bac4dd1bbdec18622361cfc816f08a06c 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Saturday 14 November 2020 with 2463974 domains and 67752 urls : 11016 Kb.
+Last version Sunday 15 November 2020 with 2463984 domains and 67750 urls : 11016 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index 67f8703d286c8a2417f6aad7af465c78b78f8d7a..af0efe60e29e59d7b9c9f765b1fcb3be81c8d385 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -1790789,6 +1790789,7 @@ porntracker.ru
  porntrade.com
  porntrade.fsn.net
  porntrade.info
+porntrade.xyz
  porntrader.net
  porntraderclub.com
  porntrading.com
@@ -1937846,6 +1937847,7 @@ sex-teenie.com
  sex-teens-girls.com
  sex-teens-girls.de
  sex-teens-live.de.vu
+sex-teens-pornhub.blogspot.com
  sex-teens-porno.com
  sex-teens-portal.de
  sex-teens-sex-teens.com
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index 0d0024ac63466101c7135b0eb75291a6cc8dc0c9..67821a4816c1fa5b7a7ccecbc3c46920c9b02ed0 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -8447,6 +8447,7 @@ bn23.com/portal/Adult
  bnatural.com/hot
  bnc265.tumblr.com/post/90886531060/realswingers-real-amateur-gangbang-with-xxx
  bnhabhaddie.tumblr.com/post/179916477989/dabi-headcannons-huh-your-blog-descriptions-says
+bnhabhaddie.tumblr.com/post/181584641535/bnha-bdsm-a-z-dec-31-jan-3
  bnsmart.info/codimilo
  boadicea.net/buffy/
  board.alruvil.com/lizzy3796
@@ -28138,6 +28139,7 @@ gorgeoushentai.com/adult-game-cg-slave-hard-love-life-gif-animated
  goriya.com/adult
  gospelbody.blogspot.com/2019
  gospelbody.blogspot.com/2020/01
+gospelbody.blogspot.com/2020/05
  gossamer-threads.com/lists/python/python/94229
  gossamer-threads.com/scripts/resources/DBMan/Sites_In_Action/XXX_Adult
  gossamer-threads.com/scripts/resources/Links/Sites_In_Action/Version_2_x/XXX_Adult
@@ -53029,7 +53031,6 @@ sex-health-review.com/fix-premature-ejaculation-help
  sex-health-review.com/how-to-avoid-premature-ejaculation-with-smart-tricks
  sex-health-review.com/men-need-attention-for-premature-ejaculation
  sex-health-review.com/prevent-premature-ejaculation-help
-sex-teens-pornhub.blogspot.com/2016/10
  sex-tron.com/media
  sex.2-3.ru/?partner=discoveros
  sex.comedy.com/2009/12/09/are-women-as-horny-as-men
@@ -66961,6 +66962,7 @@ xpaja.blogspot.com/p
  xpcarrock.blogi.mondialtravel.si/2008/01/06/nude-nonie-reynolds-pics-minke-van-der-westhuizen-nudes-jayden-faber
  xpcheapde.peen.net/2008/01/03/group-sex-yvonne-craig-free-nude-aria-giovanni-movie
  xpfamilysupport.org/vulnerability-big-boobies-their-on-crime-or
+xpornnakedvl.blogspot.com/2019/04
  xposedzone.tumblr.com/post/133477278892/follow-xposedzone-for-more-girls-naked-in-public
  xposewife-deactivated20160711.tumblr.com/post/138219950223/next-door-sluts-punk-rock-girl-fucking
  xprimevideos.com/09blonde
@@ -67690,6 +67692,7 @@ zootoday.com/girls
  zoozle.net/emule-bittorrent-news-deutsch
  zoozoosexporn.com/fr/cartoon/best/1
  zoozoosexporn.com/fr/search/beastiality
+zoozoosexporn.com/fr/search/matures
  zope.wiwi.hu-berlin.de/portal_memberdata/portraits/dfoth
  zorro82wlf.tumblr.com/post/115561653621/cheating-slut-wives-some-nice-selfies
  zorro82wlf.tumblr.com/post/115562351321/cheating-slut-wives-summer-at-matts-models
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index 676c1f378215353e77df27fe6a07ff1b5884482c..542b813193454257b891e5ad7100ea72de9f7733 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -1,5 +1,6 @@
  0-24bpautomentes.hu
  0-800-email.com
+0-assist-protect.ga
  0-secure-paypal.com
  0.15.0.1
  0.15.6.5
@@ -128,6 +129,7 @@
  02-update.billing912.com
  02-update.billing95.com
  02.bill.ref-117.com
+02.my-payments.org
  02.service-unpaid-bill.com
  02.smsinformativo.com
  02.update.billing20.co.uk
@@ -166,7 +168,6 @@
  02info-billing.com
  02paymentresolution.com
  02paymentreview.com
-02secure-billing.com
  0300ssm0300.xyz
  030architects.com
  030c.com
@@ -211,6 +212,7 @@
  05132020.blob.core.windows.net
  052-365.net
  0531wl.com
+053255555599.com
  0538ly.cn
  054-235-2465.com
  054-365.net
@@ -288,6 +290,7 @@
  0931tangfc.com
  094-365.net
  095-365.net
+095267195954465-dot-crafty-shade-294422.uk.r.appspot.com
  096-365.net
  097-365.net
  09783621.weebly.com
@@ -337,6 +340,7 @@
  0e6f933c1e3279227.temporary.link
  0e746de02b2989646.temporary.link
  0eb1c.weblium.site
+0ee77308da3582117.temporary.link
  0erfjd.s3.ap-south-1.amazonaws.com
  0et-alldue0retn.com
  0et-billsqlssued.com
@@ -442,8 +446,10 @@
  1.0.133.100
  1.0.133.84
  1.0.133.89
+1.0.134.130
  1.0.134.168
  1.0.134.3
+1.0.134.6
  1.0.136.138
  1.0.136.16
  1.0.142.39
@@ -458,36 +464,29 @@
  1.0.163.199
  1.0.163.21
  1.0.167.68
-1.0.167.86
  1.0.170.50
-1.0.171.134
  1.0.180.246
  1.0.180.37
-1.0.180.93
  1.0.181.1
  1.0.185.255
  1.0.185.85
  1.0.188.242
-1.0.209.182
+1.0.208.79
  1.0.209.230
  1.0.213.40
  1.0.214.230
-1.0.215.116
-1.0.215.7
  1.0.225.40
  1.0.230.134
  1.0.234.17
  1.0.238.18
  1.0.239.223
  1.0.248.159
-1.0.255.190
  1.1.139.28
  1.1.154.64
+1.1.156.48
  1.1.157.88
  1.1.162.210
-1.1.167.132
  1.1.169.249
-1.1.174.192
  1.1.193.169
  1.1.197.172
  1.1.201.215
@@ -495,33 +494,30 @@
  1.1.204.30
  1.1.204.75
  1.1.208.33
-1.1.210.161
  1.1.211.178
  1.1.217.61
  1.1.230.164
  1.1.230.5
  1.1.230.89
  1.1.231.142
+1.1.231.195
  1.1.233.215
  1.1.241.206
  1.1.242.17
-1.1.242.227
  1.1.242.242
  1.1.243.168
  1.1.244.54
  1.1.247.34
  1.10.131.79
  1.10.131.84
-1.10.132.249
  1.10.140.43
-1.10.146.148
  1.10.146.29
  1.10.146.30
  1.10.146.31
-1.10.146.32
-1.10.147.106
  1.10.152.54
  1.10.167.147
+1.10.172.200
+1.10.172.236
  1.10.184.119
  1.10.184.139
  1.10.186.114
@@ -532,9 +528,10 @@
  1.10.187.92
  1.10.188.140
  1.10.188.202
+1.10.188.203
+1.10.188.52
  1.10.188.93
  1.10.189.107
-1.10.189.126
  1.10.189.133
  1.10.189.84
  1.10.236.77
@@ -556,19 +553,17 @@
  1.119.55.61
  1.122.234.70
  1.122.64.110
-1.136.107.240
  1.143.120.148
-1.143.120.36
-1.143.121.106
  1.143.57.202
-1.144.110.11
  1.156.232.27
  1.156.249.201
  1.158.107.159
  1.158.218.123
+1.160.121.182
  1.160.13.29
  1.160.135.84
  1.160.184.225
+1.160.195.62
  1.160.20.55
  1.160.205.46
  1.160.69.162
@@ -602,6 +597,7 @@
  1.165.149.88
  1.165.162.97
  1.165.173.112
+1.165.181.241
  1.165.181.69
  1.165.182.50
  1.165.48.210
@@ -616,6 +612,7 @@
  1.168.202.141
  1.168.219.11
  1.168.220.77
+1.168.227.14
  1.168.238.139
  1.168.239.98
  1.168.3.249
@@ -635,9 +632,7 @@
  1.170.157.106
  1.170.183.146
  1.170.226.128
-1.170.39.132
  1.171.104.231
-1.171.153.40
  1.171.155.78
  1.171.166.61
  1.171.173.20
@@ -650,15 +645,16 @@
  1.171.79.63
  1.17110.com
  1.172.105.154
+1.172.109.117
  1.172.110.191
  1.172.172.206
  1.172.95.22
  1.173.111.65
  1.173.118.189
  1.173.165.117
+1.173.170.172
  1.173.37.104
  1.173.68.80
-1.173.76.153
  1.173.81.169
  1.173.82.118
  1.173.99.78
@@ -667,6 +663,7 @@
  1.174.10.57
  1.174.10.62
  1.174.13.200
+1.174.133.96
  1.174.140.58
  1.174.198.18
  1.174.204.63
@@ -677,7 +674,6 @@
  1.174.97.109
  1.175.108.10
  1.175.126.107
-1.175.130.90
  1.175.139.9
  1.175.145.196
  1.175.149.24
@@ -721,6 +717,7 @@
  1.179.196.65
  1.179.198.226
  1.179.201.153
+1.179.234.123
  1.179.236.131
  1.179.236.195
  1.179.246.244
@@ -736,7 +733,6 @@
  1.186.40.177
  1.186.40.2
  1.186.40.9
-1.186.45.140
  1.186.57.146
  1.186.57.150
  1.186.63.133
@@ -747,6 +743,7 @@
  1.188.87.94
  1.189.12.220
  1.189.206.64
+1.189.89.109
  1.190.17.18
  1.190.18.83
  1.190.194.13
@@ -761,7 +758,6 @@
  1.192.145.246
  1.192.147.48
  1.192.159.87
-1.192.215.27
  1.192.218.156
  1.192.218.179
  1.192.94.61
@@ -769,32 +765,22 @@
  1.193.160.164
  1.193.162.214
  1.193.39.196
-1.193.76.18
  1.194.229.82
-1.194.236.104
  1.194.238.187
  1.194.238.226
-1.194.49.158
-1.194.50.194
-1.194.52.69
-1.194.54.55
-1.195.126.43
  1.196.152.217
-1.196.223.50
  1.196.238.52
  1.197.121.137
-1.197.121.220
  1.197.79.3
  1.198.72.233
  1.199.132.62
  1.199.135.110
+1.199.136.74
  1.199.138.253
  1.199.155.51
  1.2.132.146
  1.2.132.38
-1.2.133.202
  1.2.139.118
-1.2.139.178
  1.2.142.84
  1.2.142.95
  1.2.145.161
@@ -806,17 +792,17 @@
  1.2.169.49
  1.2.169.8
  1.2.169.81
+1.2.180.254
  1.2.180.38
  1.2.182.90
-1.2.192.96
  1.2.194.201
-1.2.197.52
  1.2.199.155
  1.2.202.178
  1.2.202.4
  1.2.203.213
  1.2.204.253
  1.2.205.155
+1.2.205.7
  1.2.206.51
  1.2.207.151
  1.2.207.45
@@ -826,12 +812,12 @@
  1.2.219.33
  1.2.223.192
  1.2.224.8
-1.2.226.113
  1.2.227.214
  1.2.227.218
  1.2.227.242
  1.2.228.129
  1.2.231.14
+1.2.242.108
  1.2.242.199
  1.2.244.103
  1.2.247.247
@@ -841,10 +827,8 @@
  1.20.100.133
  1.20.100.227
  1.20.100.45
-1.20.101.149
  1.20.101.221
  1.20.101.62
-1.20.102.102
  1.20.102.228
  1.20.102.68
  1.20.102.73
@@ -853,6 +837,7 @@
  1.20.137.191
  1.20.137.82
  1.20.152.193
+1.20.154.166
  1.20.160.82
  1.20.161.108
  1.20.161.206
@@ -861,16 +846,22 @@
  1.20.169.233
  1.20.179.190
  1.20.180.173
+1.20.180.58
  1.20.180.95
  1.20.184.238
  1.20.202.13
  1.20.203.175
+1.20.203.246
+1.20.207.159
+1.20.207.191
+1.20.207.224
  1.20.207.28
  1.20.217.52
  1.20.217.78
  1.20.220.79
  1.20.221.115
  1.20.221.138
+1.20.221.221
  1.20.224.107
  1.20.227.220
  1.20.227.66
@@ -894,24 +885,15 @@
  1.201.151.54
  1.201.151.8
  1.202.114.194
-1.202.118.111
  1.202.128.68
  1.202.183.178
-1.202.185.76
  1.202.187.82
  1.202.240.163
-1.202.76.226
  1.202.77.210
-1.202.91.252
-1.203.115.141
-1.203.115.64
  1.203.80.2
  1.203.93.254
-1.204.207.141
  1.204.37.99
-1.204.60.204
-1.204.61.133
-1.204.69.231
+1.204.56.231
  1.205.104.98
  1.205.224.54
  1.205.230.29
@@ -924,8 +906,6 @@
  1.212.181.131
  1.213.177.227
  1.214.144.166
-1.214.156.163
-1.214.156.164
  1.214.220.227
  1.214.224.154
  1.214.245.27
@@ -933,7 +913,6 @@
  1.215.122.108
  1.215.138.43
  1.215.162.195
-1.215.199.250
  1.215.226.220
  1.215.33.229
  1.217.24.139
@@ -943,7 +922,6 @@
  1.22.249.238
  1.22.54.211
  1.220.145.45
-1.220.65.85
  1.220.89.178
  1.220.9.68
  1.220.90.53
@@ -957,7 +935,6 @@
  1.222.140.14
  1.222.141.38
  1.222.142.219
-1.222.163.170
  1.222.166.69
  1.222.170.43
  1.222.176.232
@@ -965,14 +942,12 @@
  1.222.178.143
  1.222.178.27
  1.222.178.30
-1.222.180.107
  1.222.180.9
  1.222.184.86
  1.222.35.39
  1.222.38.196
  1.223.240.212
  1.223.248.99
-1.224.249.138
  1.225.40.156
  1.226.12.132
  1.226.163.21
@@ -986,30 +961,30 @@
  1.229.0.42
  1.229.165.34
  1.229.221.76
-1.229.79.46
  1.230.191.123
  1.231.158.170
  1.231.64.217
  1.232.247.3
  1.233.163.193
  1.233.166.127
+1.233.193.181
  1.233.207.9
  1.234.13.176
  1.234.178.127
  1.234.4.69
  1.234.58.157
  1.234.58.236
+1.234.85.79
  1.235.102.226
  1.235.102.234
  1.235.192.218
  1.235.72.111
  1.235.72.112
+1.239.254.79
  1.24.177.240
  1.24.210.102
  1.24.210.74
  1.24.229.246
-1.24.71.29
-1.242.111.105
  1.243.12.150
  1.244.33.66
  1.245.218.13
@@ -1100,6 +1075,7 @@
  1.247.221.141
  1.248.75.8
  1.248.75.9
+1.249.182.178
  1.249.251.115
  1.249.61.5
  1.25.0.78
@@ -1108,14 +1084,13 @@
  1.251.239.18
  1.253.221.152
  1.254.152.220
-1.254.154.42
  1.254.250.52
  1.254.47.75
  1.254.47.97
-1.255.153.167
  1.255.6.104
  1.26.131.219
  1.26.250.214
+1.26.251.253
  1.26.39.21
  1.27.162.136
  1.27.162.72
@@ -1125,6 +1100,7 @@
  1.28.80.121
  1.29.137.61
  1.29.138.142
+1.29.177.238
  1.29.179.229
  1.29.192.42
  1.29.58.17
@@ -1133,7 +1109,6 @@
  1.30.215.144
  1.30.218.67
  1.30.218.89
-1.30.236.219
  1.31.68.78
  1.31.7.211
  1.31.70.141
@@ -1142,7 +1117,6 @@
  1.32.35.220
  1.32.49.200
  1.32.59.217
-1.34.1.148
  1.34.10.75
  1.34.10.87
  1.34.103.6
@@ -1154,6 +1128,7 @@
  1.34.117.194
  1.34.118.246
  1.34.122.44
+1.34.123.155
  1.34.126.129
  1.34.126.202
  1.34.127.176
@@ -1176,7 +1151,6 @@
  1.34.142.63
  1.34.143.48
  1.34.143.51
-1.34.144.128
  1.34.144.176
  1.34.144.183
  1.34.145.22
@@ -1209,7 +1183,6 @@
  1.34.183.32
  1.34.183.5
  1.34.184.209
-1.34.185.183
  1.34.186.241
  1.34.19.58
  1.34.190.118
@@ -1222,6 +1195,7 @@
  1.34.194.96
  1.34.195.131
  1.34.196.211
+1.34.197.232
  1.34.197.29
  1.34.197.93
  1.34.198.216
@@ -1231,12 +1205,15 @@
  1.34.216.84
  1.34.217.244
  1.34.217.249
+1.34.218.185
  1.34.220.179
+1.34.222.144
  1.34.223.70
  1.34.229.11
  1.34.232.137
  1.34.232.196
  1.34.238.26
+1.34.239.226
  1.34.252.247
  1.34.254.153
  1.34.254.164
@@ -1244,6 +1221,7 @@
  1.34.254.24
  1.34.29.30
  1.34.30.76
+1.34.31.155
  1.34.31.19
  1.34.34.38
  1.34.36.153
@@ -1254,7 +1232,6 @@
  1.34.49.49
  1.34.54.246
  1.34.55.104
-1.34.55.95
  1.34.63.252
  1.34.64.32
  1.34.64.43
@@ -1272,6 +1249,8 @@
  1.34.91.61
  1.34.98.198
  1.34.99.228
+1.35.177.150
+1.36.114.211
  1.36.123.199
  1.36.13.136
  1.36.177.218
@@ -1292,22 +1271,20 @@
  1.4.141.229
  1.4.141.241
  1.4.147.217
+1.4.154.15
  1.4.155.114
  1.4.157.35
  1.4.159.170
-1.4.159.75
  1.4.161.128
  1.4.163.201
  1.4.177.23
  1.4.185.191
  1.4.187.207
  1.4.187.224
-1.4.196.229
  1.4.198.117
  1.4.198.52
  1.4.200.89
  1.4.225.192
-1.4.226.181
  1.4.228.193
  1.4.231.43
  1.4.247.185
@@ -1320,7 +1297,6 @@
  1.48.227.216
  1.48.234.138
  1.48.248.11
-1.48.248.53
  1.48.249.18
  1.48.250.183
  1.48.251.83
@@ -1337,12 +1313,10 @@
  1.52.182.115
  1.52.184.188
  1.52.185.106
-1.52.185.69
  1.52.192.197
  1.52.192.231
  1.52.193.140
  1.52.194.59
-1.52.195.255
  1.52.196.132
  1.52.196.33
  1.52.197.1
@@ -1379,8 +1353,10 @@
  1.52.45.242
  1.52.50.179
  1.52.51.54
+1.52.55.144
  1.52.62.148
  1.52.84.241
+1.52.85.38
  1.52.97.148
  1.53.10.61
  1.53.11.113
@@ -1400,7 +1376,6 @@
  1.53.137.92
  1.53.144.186
  1.53.150.63
-1.53.154.137
  1.53.157.195
  1.53.159.227
  1.53.172.249
@@ -1418,7 +1393,6 @@
  1.53.238.21
  1.53.26.167
  1.53.3.219
-1.53.32.106
  1.53.34.190
  1.53.36.10
  1.53.37.166
@@ -1439,10 +1413,10 @@
  1.53.52.135
  1.53.52.230
  1.53.54.186
-1.53.55.132
  1.53.55.211
  1.53.56.167
  1.53.6.242
+1.53.67.245
  1.53.67.62
  1.53.68.82
  1.53.7.187
@@ -1460,7 +1434,6 @@
  1.54.128.166
  1.54.130.142
  1.54.130.249
-1.54.133.10
  1.54.134.115
  1.54.134.210
  1.54.134.56
@@ -1474,10 +1447,8 @@
  1.54.18.181
  1.54.191.54
  1.54.20.116
-1.54.210.82
  1.54.212.112
  1.54.215.136
-1.54.215.201
  1.54.22.224
  1.54.243.61
  1.54.26.12
@@ -1488,7 +1459,6 @@
  1.54.5.87
  1.54.7.247
  1.54.7.42
-1.54.7.52
  1.54.70.42
  1.54.8.2
  1.54.8.212
@@ -1507,7 +1477,6 @@
  1.55.142.230
  1.55.144.112
  1.55.144.234
-1.55.144.34
  1.55.15.84
  1.55.150.89
  1.55.151.223
@@ -1516,9 +1485,7 @@
  1.55.170.130
  1.55.170.80
  1.55.175.124
-1.55.181.114
  1.55.205.17
-1.55.206.207
  1.55.206.214
  1.55.207.155
  1.55.215.30
@@ -1544,21 +1511,23 @@
  1.55.81.209
  1.55.86.223
  1.55.86.78
-1.56.153.232
+1.56.147.37
  1.56.154.205
  1.56.155.227
  1.56.207.130
  1.56.84.130
  1.56.84.228
  1.57.22.21
+1.58.106.208
  1.58.126.190
  1.58.158.22
  1.58.171.40
+1.58.178.187
  1.58.206.157
  1.58.41.45
  1.59.120.74
+1.59.200.69
  1.6.10.90
-1.6.103.18
  1.6.135.164
  1.6.182.218
  1.6.30.57
@@ -1569,12 +1538,12 @@
  1.60.76.152
  1.61.225.29
  1.61.226.59
+1.62.106.149
  1.62.139.227
  1.62.148.209
  1.62.154.165
  1.62.208.37
  1.62.66.140
-1.63.226.147
  1.63.226.82
  1.63.251.30
  1.64.125.247
@@ -1585,20 +1554,16 @@
  1.64.233.202
  1.64.241.31
  1.64.47.242
+1.64.59.208
  1.64.8.153
  1.65.185.167
  1.65.188.221
  1.65.218.14
  1.65.218.174
-1.68.255.96
  1.69.243.225
  1.69.243.225bin.sh
  1.7.142.58
-1.70.64.169
-1.71.129.108
-1.71.129.49
  1.71.140.222
-1.71.140.71
  1.71.188.37
  1.71.191.178
  1.80.136.54
@@ -1606,7 +1571,9 @@
  1.80.138.149
  1.80.138.223
  1.80.187.189
+1.80.246.120
  1.80.246.185
+1.80.246.229
  1.80.247.238
  1.80.247.26
  1.80.247.50
@@ -1646,7 +1613,6 @@
  1.9.46.59
  1.9.7.197
  1.9.71.2
-1.9.78.242
  1.93.47.149
  1.93.47.208
  1.9us.me
@@ -1665,6 +1631,7 @@
  100-diamond.000webhostapp.com
  100.0.41.228
  100.1.12.92
+100.1.160.202
  100.1.218.108
  100.1.221.131
  100.11.101.157
@@ -1687,7 +1654,7 @@
  100.2.62.15
  100.25.185.145
  100.25.217.29
-100.25.35.121
+100.25.218.155
  100.25.60.57
  100.26.143.89
  100.26.180.70
@@ -1708,13 +1675,11 @@
  100.38.120.249
  100.38.234.159
  100.40.58.187
-100.40.88.125
  100.42.229.74
  100.42.30.34
  100.42.48.198
  100.42.60.179
  100.42.65.207
-100.42.65.208
  100.43.81.108
  100.43.81.135
  100.43.81.151
@@ -1726,7 +1691,6 @@
  100.6.119.127
  100.6.23.40
  100.6.48.151
-100.7.201.184
  100.7.3.44
  100.7.3.45
  100.8.21.205
@@ -1822,7 +1786,6 @@
  101.0.32.254
  101.0.32.255
  101.0.32.39
-101.0.32.44
  101.0.32.49
  101.0.32.50
  101.0.32.51
@@ -1831,7 +1794,6 @@
  101.0.32.62
  101.0.32.64
  101.0.32.67
-101.0.32.69
  101.0.32.7
  101.0.32.77
  101.0.32.79
@@ -1855,6 +1817,7 @@
  101.0.49.231
  101.0.81.153
  101.100.174.24
+101.100.177.165
  101.100.182.12
  101.100.185.235
  101.100.201.67
@@ -1875,6 +1838,7 @@
  101.108.118.181
  101.108.119.21
  101.108.119.39
+101.108.121.128
  101.108.122.24
  101.108.122.3
  101.108.123.142
@@ -1884,11 +1848,13 @@
  101.108.126.159
  101.108.127.10
  101.108.127.222
-101.108.140.69
-101.108.143.36
+101.108.133.25
  101.108.145.106
  101.108.155.115
  101.108.155.122
+101.108.155.24
+101.108.155.4
+101.108.16.248
  101.108.17.255
  101.108.175.36
  101.108.176.146
@@ -1901,14 +1867,15 @@
  101.108.192.238
  101.108.193.158
  101.108.193.49
+101.108.194.121
  101.108.194.133
  101.108.194.249
  101.108.194.250
+101.108.195.49
  101.108.196.61
  101.108.197.129
  101.108.197.9
  101.108.198.126
-101.108.198.13
  101.108.198.6
  101.108.198.72
  101.108.199.171
@@ -1921,41 +1888,36 @@
  101.108.215.187
  101.108.215.47
  101.108.226.252
-101.108.23.111
+101.108.234.134
  101.108.32.208
  101.108.40.116
  101.108.5.200
-101.108.51.98
  101.108.57.59
-101.108.69.226
  101.108.78.223
+101.108.79.90
  101.108.90.129
  101.108.91.197
-101.108.93.110
  101.108.93.151
  101.108.93.159
  101.108.93.242
  101.108.93.42
  101.108.93.44
  101.109.119.106
-101.109.124.164
  101.109.126.38
  101.109.131.117
  101.109.14.23
  101.109.143.71
  101.109.164.80
  101.109.165.105
-101.109.165.199
  101.109.166.151
  101.109.167.185
+101.109.179.43
  101.109.184.193
  101.109.199.6
  101.109.21.125
-101.109.210.51
  101.109.211.252
  101.109.217.92
  101.109.221.75
-101.109.233.118
  101.109.245.200
  101.109.247.136
  101.109.248.118
@@ -1968,23 +1930,19 @@
  101.109.255.17
  101.109.255.18
  101.109.255.48
-101.109.26.133
  101.109.35.209
-101.109.35.9
-101.109.42.209
  101.109.46.111
+101.109.60.255
  101.109.78.14
  101.109.80.148
+101.109.80.150
  101.109.80.233
  101.109.84.181
  101.109.95.37
  101.113.224.180
  101.113.231.154
-101.116.140.89
  101.116.156.63
-101.116.49.38
  101.118.39.232
-101.124.70.81
  101.127.108.224
  101.127.155.33
  101.127.168.234
@@ -2000,17 +1958,16 @@
  101.127.75.205
  101.127.78.178
  101.127.94.108
-101.128.65.182
  101.128.66.54
  101.128.72.157
  101.128.74.51
  101.128.80.118
  101.132.121.66
-101.132.131.236
  101.132.149.193
  101.132.153.114
  101.132.177.245
  101.132.182.76
+101.132.194.66
  101.132.33.79
  101.132.39.115
  101.132.39.85
@@ -2021,16 +1978,12 @@
  101.16.147.120
  101.16.59.23
  101.16.84.55
-101.161.68.53
  101.162.85.60
  101.165.169.151
-101.166.99.1
  101.167.175.224
  101.17.73.251
  101.173.24.210
-101.175.153.127
  101.176.10.98
-101.176.91.176
  101.178.60.17
  101.178.90.141
  101.179.14.213
@@ -2039,24 +1992,22 @@
  101.187.81.254
  101.190.18.181
  101.190.186.113
-101.190.200.151
  101.198.186.254
  101.20.136.171
  101.20.158.11
  101.20.161.112
  101.20.200.213
  101.20.35.78
-101.20.43.20
+101.20.49.136
  101.200.124.141
  101.200.127.75
+101.200.133.119
  101.200.137.78
  101.200.160.24
  101.200.177.198
-101.200.194.168
  101.200.56.138
-101.200.56.77
+101.200.57.240
  101.200.61.23
-101.200.77.111
  101.200.84.159
  101.201.237.252
  101.201.35.153
@@ -2064,23 +2015,26 @@
  101.201.62.45
  101.203.172.89
  101.203.173.119
+101.204.81.190
  101.205.48.238
  101.206.162.139
  101.206.162.156
+101.206.162.166
  101.206.162.170
  101.206.162.178
  101.206.162.180
  101.206.162.186
  101.206.162.208
  101.206.162.218
+101.206.162.222
  101.206.162.245
  101.206.162.249
  101.206.162.250
  101.206.81.229
-101.207.113.73
  101.207.227.41
  101.21.143.98
  101.224.166.13
+101.224.61.25
  101.224.93.114
  101.226.241.74
  101.226.253.162
@@ -2092,8 +2046,8 @@
  101.227.82.219
  101.227.82.60
  101.227.99.99
+101.228.208.82
  101.228.48.108
-101.229.165.249
  101.229.222.179
  101.23.239.150
  101.23.94.151
@@ -2107,13 +2061,10 @@
  101.230.248.166
  101.231.104.82
  101.231.124.6
-101.231.135.146
  101.231.137.70
  101.231.146.34
  101.231.146.36
-101.231.154.154
  101.231.213.242
-101.231.37.169
  101.231.91.196
  101.234.76.51
  101.234.76.77
@@ -2130,7 +2081,6 @@
  101.251.197.238
  101.251.206.90
  101.251.209.116
-101.251.209.118
  101.251.219.100
  101.251.222.158
  101.251.241.81
@@ -2142,7 +2092,6 @@
  101.254.192.54
  101.254.208.2
  101.254.208.9
-101.255.102.54
  101.255.115.122
  101.255.115.123
  101.255.116.61
@@ -2153,15 +2102,12 @@
  101.255.122.73
  101.255.122.9
  101.255.124.35
-101.255.124.93
  101.255.125.57
  101.255.125.59
-101.255.171.202
  101.255.40.18
  101.255.52.210
  101.255.55.10
  101.255.56.134
-101.255.56.42
  101.255.62.202
  101.255.63.10
  101.255.63.22
@@ -2176,8 +2122,9 @@
  101.255.86.78
  101.255.87.134
  101.255.94.130
-101.26.254.162
  101.27.23.116
+101.28.118.203
+101.28.207.13
  101.28.21.186
  101.28.21.251
  101.28.56.151
@@ -2200,7 +2147,6 @@
  101.31.192.88
  101.31.220.199
  101.32.11.31
-101.32.12.191
  101.32.12.91
  101.32.14.145
  101.32.161.189
@@ -2229,6 +2175,7 @@
  101.32.208.218
  101.32.213.171
  101.32.213.203
+101.32.23.2
  101.32.26.159
  101.32.3.166
  101.32.31.176
@@ -2249,7 +2196,6 @@
  101.36.118.82
  101.36.121.111
  101.36.124.151
-101.36.150.59
  101.36.151.139
  101.36.151.78
  101.36.160.91
@@ -2265,7 +2211,7 @@
  101.36.181.186
  101.36.73.148
  101.37.118.54
-101.37.13.169
+101.37.171.24
  101.37.33.19
  101.37.75.150
  101.39.226.100
@@ -2273,10 +2219,13 @@
  101.39.226.30
  101.39.228.55
  101.4.136.34
+101.50.0.201
  101.50.1.2
  101.50.57.47
+101.50.68.68
  101.50.71.139
  101.50.80.15
+101.50.80.26
  101.50.81.171
  101.50.81.192
  101.50.81.53
@@ -2292,11 +2241,12 @@
  101.51.102.118
  101.51.104.122
  101.51.104.127
+101.51.104.151
  101.51.104.159
-101.51.104.181
-101.51.104.239
+101.51.104.163
  101.51.104.245
  101.51.104.95
+101.51.105.108
  101.51.105.216
  101.51.106.70
  101.51.12.67
@@ -2306,7 +2256,6 @@
  101.51.136.232
  101.51.138.111
  101.51.138.136
-101.51.141.106
  101.51.141.11
  101.51.141.118
  101.51.141.122
@@ -2319,6 +2268,7 @@
  101.51.16.150
  101.51.160.72
  101.51.17.88
+101.51.175.130
  101.51.176.45
  101.51.177.128
  101.51.181.98
@@ -2335,6 +2285,7 @@
  101.51.218.109
  101.51.218.200
  101.51.223.251
+101.51.224.148
  101.51.224.62
  101.51.225.250
  101.51.228.222
@@ -2347,9 +2298,9 @@
  101.51.241.126
  101.51.246.238
  101.51.28.201
+101.51.29.112
  101.51.30.85
  101.51.32.227
-101.51.38.85
  101.51.39.174
  101.51.39.4
  101.51.41.78
@@ -2357,9 +2308,8 @@
  101.51.59.133
  101.51.59.15
  101.51.59.159
-101.51.59.169
-101.51.59.170
-101.51.59.172
+101.51.59.165
+101.51.59.177
  101.51.59.196
  101.51.59.202
  101.51.59.21
@@ -2382,15 +2332,10 @@
  101.51.70.79
  101.51.72.123
  101.51.72.198
-101.51.74.154
-101.51.75.64
-101.51.8.216
-101.51.80.172
  101.51.82.38
  101.51.83.109
  101.51.87.199
  101.51.9.18
-101.51.9.196
  101.51.9.244
  101.51.96.56
  101.53.100.115
@@ -2399,11 +2344,11 @@
  101.53.131.217
  101.53.248.70
  101.55.76.66
-101.6.133.27
  101.6.28.160
  101.6.64.76
  101.64.116.211
  101.64.117.49
+101.64.137.202
  101.64.140.28
  101.64.152.59
  101.64.156.58
@@ -2417,10 +2362,8 @@
  101.65.128.150
  101.65.160.13
  101.65.161.33
-101.65.162.181
  101.65.64.177
  101.65.65.178
-101.65.65.67
  101.66.108.8
  101.67.215.7
  101.67.226.50
@@ -2438,11 +2381,8 @@
  101.69.240.94
  101.69.63.163
  101.70.15.84
-101.71.129.48
-101.71.129.89
  101.71.249.170
  101.71.251.202
-101.71.251.204
  101.71.28.72
  101.71.3.53
  101.71.38.82
@@ -2459,23 +2399,18 @@
  101.73.239.249
  101.73.253.168
  101.74.59.140
-101.75.159.154
  101.75.177.107
-101.75.189.114
  101.78.105.3
  101.78.149.142
  101.78.16.170
  101.78.209.39
-101.78.229.4
  101.78.3.247
  101.78.3.29
  101.78.9.235
  101.78.9.237
  101.79.167.142
  101.79.167.161
-101.79.167.32
  101.79.5.58
-101.79.62.143
  101.80.137.164
  101.83.123.106
  101.83.253.146
@@ -2489,33 +2424,17 @@
  101.87.101.87
  101.89.110.204
  101.89.114.120
-101.89.115.211
  101.89.116.39
-101.89.117.55
-101.89.123.61
-101.89.135.53
  101.89.145.133
-101.89.147.85
  101.89.148.159
-101.89.149.80
  101.89.188.88
  101.89.192.64
-101.89.201.250
  101.89.219.59
  101.89.63.136
  101.89.68.114
-101.89.92.230
-101.89.95.77
-101.91.114.27
-101.91.119.132
  101.91.119.172
-101.91.160.243
  101.91.178.122
-101.91.198.130
  101.91.207.208
-101.91.208.117
-101.91.242.119
-101.93.102.45
  101.93.151.32
  101.93.185.199
  101.93.223.168
@@ -2530,14 +2449,12 @@
  101.96.128.182
  101.96.130.113
  101.96.134.166
-101.96.143.79
  101.96.89.172
  101.96.89.207
  101.98.11.146
-101.98.122.252
  101.98.149.170
-101.99.14.49
-101.99.15.91
+101.99.15.57
+101.99.15.75
  101.99.20.59
  101.99.77.62
  101.99.81.155
@@ -2565,39 +2482,34 @@
  102.101.156.87
  102.101.226.111
  102.114.2.115
-102.114.70.187
+102.114.4.175
+102.114.40.118
  102.118.196.32
  102.118.220.87
-102.119.193.92
  102.129.199.106
  102.129.199.107
  102.129.199.108
  102.129.199.119
  102.129.199.120
-102.129.199.124
+102.129.199.70
  102.129.199.74
  102.129.199.98
  102.129.224.102
  102.129.249.232
  102.130.119.99
  102.130.120.91
-102.130.123.182
-102.130.128.13
  102.130.24.92
  102.130.64.30
-102.131.244.113
  102.131.57.29
  102.132.231.84
  102.132.233.132
  102.132.245.16
-102.132.45.116
  102.133.163.122
  102.133.163.144
  102.133.163.188
  102.133.164.230
  102.133.166.186
  102.133.167.0
-102.134.147.63
  102.134.159.142
  102.134.176.1
  102.134.176.24
@@ -2605,16 +2517,16 @@
  102.135.182.72
  102.135.183.222
  102.137.241.7
+102.140.4.14
  102.141.197.17
-102.152.39.100
-102.152.63.60
-102.152.7.4
-102.160.119.176
+102.152.27.233
+102.152.52.69
  102.164.108.43
  102.164.194.209
  102.164.200.46
  102.164.222.42
  102.164.248.235
+102.164.5.177
  102.165.27.147
  102.165.27.156
  102.165.27.223
@@ -2640,14 +2552,18 @@
  102.165.30.61
  102.165.30.9
  102.165.52.117
+102.165.52.126
  102.165.52.146
  102.165.52.174
+102.165.52.20
  102.165.52.21
  102.165.52.230
  102.165.52.28
  102.165.52.63
+102.165.52.77
  102.165.53.218
-102.165.54.223
+102.165.54.227
+102.165.54.242
  102.165.55.113
  102.165.55.18
  102.165.55.182
@@ -2666,18 +2582,17 @@
  102.176.161.114
  102.176.189.7
  102.176.197.253
+102.176.7.67
  102.176.8.2
-102.176.8.83
  102.176.81.99
-102.176.94.178
  102.177.105.34
  102.177.106.107
  102.177.106.12
  102.177.106.91
  102.177.141.105
+102.177.141.201
  102.177.141.89
  102.177.141.97
-102.177.145.221
  102.177.192.15
  102.177.193.220
  102.177.193.222
@@ -2693,11 +2608,9 @@
  102.182.93.220
  102.185.203.142
  102.186.148.193
-102.222.182.111
  102.222.31.125
  102.223.209.38
  102.223.72.211
-102.23.111.140
  102.23.221.1
  102.23.242.15
  102.23.247.85
@@ -2710,7 +2623,6 @@
  102.35.85.39
  102.36.164.141
  102.37.10.155
-102.37.12.59
  102.37.40.61
  102.37.42.197
  102.37.96.186
@@ -2719,17 +2631,14 @@
  102.38.50.228
  102.38.50.62
  102.38.50.78
-102.38.56.118
  102.39.108.176
  102.39.111.112
  102.39.67.51
-102.40.27.254
  102.44.98.75
  102.45.138.94
  102.46.28.124
  102.53.4.195
  102.53.4.231
-102.53.4.42
  102.64.120.102
  102.64.120.163
  102.64.120.168
@@ -2737,6 +2646,7 @@
  102.64.120.187
  102.64.120.196
  102.64.120.227
+102.64.120.235
  102.64.120.241
  102.64.120.243
  102.64.120.254
@@ -2753,33 +2663,31 @@
  102.64.122.35
  102.64.122.48
  102.64.123.129
-102.64.123.146
  102.64.123.156
  102.64.123.167
  102.64.123.184
  102.64.123.188
  102.64.123.196
  102.64.123.225
+102.64.123.228
  102.64.123.35
+102.64.123.44
  102.64.123.80
  102.64.33.143
  102.65.17.60
  102.65.190.42
+102.65.48.22
  102.65.89.16
  102.66.98.26
  102.66.99.54
-102.67.139.5
  102.67.160.130
  102.67.19.132
-102.67.23.131
  102.67.27.173
  102.67.68.1
  102.67.73.1
  102.67.74.1
-102.68.137.139
  102.68.17.108
  102.68.17.156
-102.68.17.48
  102.68.17.8
  102.68.17.96
  102.68.74.47
@@ -2798,8 +2706,6 @@
  10293482595861768368.us-south.cf.appdomain.cloud
  102region.online
  103.1.12.194
-103.1.179.13
-103.1.179.156
  103.1.209.16
  103.1.93.59
  103.1.94.78
@@ -2808,7 +2714,6 @@
  103.10.157.9
  103.10.169.212
  103.10.171.132
-103.10.198.194
  103.10.210.17
  103.10.228.221
  103.10.23.161
@@ -2816,15 +2721,12 @@
  103.10.3.104
  103.10.4.216
  103.10.4.32
-103.10.44.31
  103.10.5.83
  103.10.55.163
  103.10.59.73
-103.10.60.98
  103.10.81.172
  103.10.84.60
  103.10.86.52
-103.10.87.20
  103.10.87.54
  103.100.159.194
  103.100.159.21
@@ -2832,12 +2734,10 @@
  103.100.188.51
  103.100.209.152
  103.100.209.24
-103.100.209.54
  103.100.211.107
-103.100.211.72
-103.100.211.8
  103.100.66.230
  103.100.83.253
+103.100.96.174
  103.101.104.223
  103.101.225.221
  103.101.228.175
@@ -2855,7 +2755,6 @@
  103.102.146.253
  103.102.195.178
  103.102.248.98
-103.102.250.254
  103.103.124.145
  103.103.124.169
  103.103.124.177
@@ -2864,10 +2763,9 @@
  103.103.124.230
  103.103.124.233
  103.103.125.98
+103.103.161.14
  103.103.175.253
  103.103.213.122
-103.103.213.231
-103.103.214.11
  103.103.40.162
  103.103.40.67
  103.103.40.68
@@ -2885,26 +2783,23 @@
  103.103.69.58
  103.103.71.8
  103.103.8.206
-103.104.117.81
-103.104.119.114
-103.104.119.47
-103.104.119.66
  103.104.121.231
  103.104.124.33
  103.104.127.160
  103.104.132.2
  103.104.133.178
  103.104.213.255
-103.104.214.30
  103.104.61.102
  103.104.61.167
  103.104.85.2
  103.104.85.88
+103.104.99.250
  103.105.128.50
  103.105.130.136
  103.105.142.132
  103.105.195.2
  103.105.195.230
+103.105.195.84
  103.105.201.155
  103.105.201.74
  103.105.209.26
@@ -2938,25 +2833,21 @@
  103.105.42.130
  103.105.42.23
  103.105.42.91
+103.105.45.183
  103.105.64.253
  103.105.70.148
  103.105.70.9
-103.105.77.11
  103.105.77.19
  103.106.112.11
  103.106.114.134
-103.106.115.18
  103.106.115.22
-103.106.148.209
  103.106.152.86
  103.106.154.132
  103.106.155.194
  103.106.155.220
  103.106.158.252
-103.106.159.86
  103.106.165.25
  103.106.192.245
-103.106.211.126
  103.106.237.182
  103.106.242.146
  103.106.250.248
@@ -2991,22 +2882,18 @@
  103.107.157.58
  103.107.160.169
  103.107.161.54
-103.107.17.134
-103.107.17.139
  103.107.17.205
-103.107.183.123
-103.107.187.252
  103.107.188.19
  103.107.188.195
  103.107.188.208
  103.107.188.27
  103.107.188.39
-103.107.188.40
  103.107.189.41
  103.107.190.83
  103.107.191.165
  103.107.191.166
  103.107.191.41
+103.107.191.79
  103.107.191.80
  103.107.245.45
  103.107.245.51
@@ -3054,6 +2941,7 @@
  103.107.94.141
  103.107.94.2
  103.107.94.33
+103.107.94.41
  103.107.94.57
  103.107.94.61
  103.107.94.85
@@ -3063,11 +2951,9 @@
  103.108.120.5
  103.108.128.178
  103.108.146.96
-103.108.187.109
  103.108.187.194
  103.108.187.195
  103.108.187.252
-103.108.187.98
  103.108.228.42
  103.108.58.212
  103.108.75.153
@@ -3098,9 +2984,7 @@
  103.109.56.249
  103.109.56.77
  103.109.56.97
-103.109.57.1
  103.109.57.13
-103.109.57.161
  103.109.57.17
  103.109.57.233
  103.109.57.237
@@ -3108,17 +2992,16 @@
  103.109.58.110
  103.109.58.149
  103.109.58.169
-103.109.58.176
  103.109.58.25
  103.109.58.45
  103.109.58.5
+103.109.58.54
  103.109.59.137
  103.109.59.242
  103.109.59.81
  103.109.95.81
  103.11.135.76
  103.11.244.234
-103.11.75.126
  103.11.83.52
  103.110.109.17
  103.110.109.2
@@ -3134,6 +3017,7 @@
  103.110.160.210
  103.110.160.218
  103.110.160.222
+103.110.22.47
  103.110.4.1
  103.110.49.104
  103.110.57.62
@@ -3144,11 +3028,11 @@
  103.110.88.218
  103.110.89.148
  103.111.103.254
+103.111.110.154
  103.111.128.8
  103.111.197.194
  103.111.199.18
  103.111.219.132
-103.111.219.133
  103.111.219.149
  103.111.219.245
  103.111.22.26
@@ -3157,10 +3041,8 @@
  103.111.31.230
  103.111.53.82
  103.111.55.210
-103.111.56.18
  103.111.82.154
  103.111.83.122
-103.111.83.26
  103.112.0.10
  103.112.0.12
  103.112.0.123
@@ -3168,14 +3050,12 @@
  103.112.0.53
  103.112.0.54
  103.112.163.207
-103.112.191.100
  103.112.204.190
  103.112.212.102
  103.112.212.133
  103.112.212.30
  103.112.244.249
  103.112.29.124
-103.112.4.102
  103.112.60.2
  103.112.61.13
  103.112.61.233
@@ -3187,7 +3067,6 @@
  103.112.84.10
  103.112.84.51
  103.112.85.246
-103.113.103.43
  103.113.104.176
  103.113.104.225
  103.113.104.49
@@ -3215,6 +3094,8 @@
  103.113.3.74
  103.113.35.93
  103.114.100.125
+103.114.104.130
+103.114.104.35
  103.114.104.68
  103.114.105.149
  103.114.105.180
@@ -3224,8 +3105,6 @@
  103.114.107.129
  103.114.107.156
  103.114.107.230
-103.114.107.249
-103.114.147.30
  103.114.161.131
  103.114.61.150
  103.114.64.22
@@ -3249,15 +3128,14 @@
  103.115.181.130
  103.115.181.138
  103.115.181.196
-103.115.181.199
  103.115.181.211
-103.115.181.215
  103.115.181.216
  103.115.181.219
+103.115.181.223
  103.115.181.225
  103.115.181.233
-103.115.181.249
  103.115.181.32
+103.115.188.46
  103.115.252.129
  103.115.252.26
  103.115.252.30
@@ -3298,6 +3176,7 @@
  103.117.221.5
  103.117.229.26
  103.117.229.46
+103.117.37.165
  103.117.48.5
  103.118.157.59
  103.118.165.28
@@ -3308,15 +3187,12 @@
  103.118.44.254
  103.118.44.4
  103.118.44.56
-103.118.47.198
-103.118.47.202
  103.118.47.210
  103.118.76.54
  103.119.144.206
  103.119.208.63
  103.119.229.130
  103.119.244.10
-103.119.30.193
  103.12.114.38
  103.12.114.50
  103.12.114.58
@@ -3336,7 +3212,7 @@
  103.12.161.196
  103.12.161.21
  103.12.177.34
-103.12.197.6
+103.12.197.246
  103.12.242.130
  103.12.246.10
  103.12.246.105
@@ -3357,7 +3233,6 @@
  103.12.246.81
  103.12.246.97
  103.120.168.3
-103.120.175.97
  103.120.188.1
  103.120.188.9
  103.120.200.233
@@ -3366,13 +3241,14 @@
  103.120.220.129
  103.120.220.130
  103.120.220.131
-103.120.220.132
-103.120.220.133
  103.120.220.134
  103.120.220.135
+103.120.221.66
+103.120.221.69
  103.120.223.42
  103.120.224.222
  103.120.238.85
+103.120.33.75
  103.121.185.2
  103.121.186.1
  103.121.214.50
@@ -3382,14 +3258,13 @@
  103.121.42.229
  103.122.104.114
  103.122.105.242
-103.122.168.130
+103.122.33.68
  103.122.66.184
-103.122.67.185
+103.122.67.184
  103.122.97.58
  103.122.98.195
  103.123.112.2
  103.123.114.1
-103.123.150.122
  103.123.16.126
  103.123.168.106
  103.123.168.74
@@ -3406,7 +3281,6 @@
  103.123.27.23
  103.123.38.165
  103.123.48.249
-103.123.51.138
  103.123.54.48
  103.123.64.19
  103.123.65.186
@@ -3414,23 +3288,21 @@
  103.123.8.75
  103.123.86.147
  103.123.86.176
+103.123.86.3
  103.123.86.81
  103.124.105.145
  103.124.12.10
  103.124.12.23
  103.124.136.77
-103.124.146.148
  103.124.147.22
  103.124.165.109
  103.124.172.54
  103.124.172.8
  103.124.175.139
-103.124.197.106
+103.124.196.89
  103.124.205.17
-103.124.83.247
  103.124.87.178
  103.124.87.216
-103.124.92.184
  103.124.92.84
  103.125.106.2
  103.125.117.202
@@ -3443,18 +3315,20 @@
  103.125.190.215
  103.125.191.106
  103.125.191.123
+103.125.191.14
  103.125.191.158
+103.125.191.180
  103.125.191.182
  103.125.191.229
  103.125.191.230
  103.125.191.233
  103.125.191.32
  103.125.191.54
+103.125.191.72
  103.125.191.78
  103.125.191.82
  103.125.218.107
  103.125.240.145
-103.125.43.29
  103.126.100.11
  103.126.100.13
  103.126.100.18
@@ -3472,10 +3346,8 @@
  103.127.124.27
  103.127.187.184
  103.127.187.252
-103.127.206.109
  103.127.207.30
  103.127.41.103
-103.127.50.100
  103.127.56.210
  103.127.56.42
  103.127.63.25
@@ -3484,21 +3356,21 @@
  103.129.194.1
  103.129.195.48
  103.129.216.79
-103.129.220.40
+103.129.221.149
+103.129.221.152
+103.129.221.154
+103.129.221.155
+103.129.221.157
  103.129.221.55
-103.129.223.101
  103.129.223.126
  103.129.223.136
  103.129.223.98
  103.129.64.135
  103.129.88.7
  103.13.224.53
+103.13.228.180
  103.13.229.170
-103.13.236.246
  103.13.240.38
-103.130.109.9
-103.130.141.72
-103.130.172.34
  103.130.173.110
  103.130.191.1
  103.130.191.18
@@ -3507,10 +3379,8 @@
  103.130.196.154
  103.130.201.19
  103.130.209.251
-103.130.212.169
  103.130.213.191
  103.130.213.21
-103.130.214.207
  103.130.214.215
  103.130.214.44
  103.130.214.48
@@ -3523,27 +3393,23 @@
  103.131.104.73
  103.131.11.105
  103.131.11.98
-103.131.145.97
-103.131.152.130
  103.131.16.76
  103.131.17.83
  103.131.213.242
  103.131.60.168
  103.131.80.2
-103.132.18.1
  103.132.183.201
  103.132.183.251
  103.132.244.43
  103.132.58.13
+103.133.104.207
  103.133.104.211
  103.133.104.215
  103.133.104.46
  103.133.104.62
  103.133.105.65
-103.133.105.71
  103.133.106.150
  103.133.106.188
-103.133.106.90
  103.133.107.234
  103.133.107.251
  103.133.107.7
@@ -3552,12 +3418,8 @@
  103.133.109.40
  103.133.111.226
  103.133.111.240
-103.133.111.7
-103.133.134.32
-103.133.217.131
  103.133.223.122
  103.133.248.20
-103.133.56.85
  103.134.1.134
  103.134.133.197
  103.134.133.29
@@ -3584,16 +3446,13 @@
  103.135.34.58
  103.135.38.115
  103.135.38.125
+103.135.38.137
  103.135.38.153
  103.135.38.180
  103.135.39.189
  103.135.39.85
  103.135.95.134
  103.136.18.233
-103.136.182.184
-103.136.26.163
-103.136.40.200
-103.136.40.31
  103.136.40.50
  103.136.40.88
  103.136.40.90
@@ -3604,6 +3463,7 @@
  103.137.124.16
  103.137.124.2
  103.137.124.20
+103.137.162.76
  103.137.250.46
  103.137.6.226
  103.137.66.1
@@ -3617,16 +3477,15 @@
  103.138.10.6
  103.138.109.101
  103.138.109.138
-103.138.109.55
  103.138.110.152
  103.138.110.163
  103.138.205.69
  103.138.22.196
  103.138.22.212
+103.138.4.107
  103.138.4.124
  103.138.4.198
  103.138.4.33
-103.138.41.74
  103.139.102.110
  103.139.102.113
  103.139.103.29
@@ -3636,16 +3495,23 @@
  103.139.212.18
  103.139.212.19
  103.139.212.20
+103.139.212.205
+103.139.212.208
+103.139.212.210
+103.139.212.211
+103.139.212.212
+103.139.212.213
  103.139.45.181
  103.139.45.87
+103.139.67.10
  103.14.198.18
+103.14.20.91
  103.14.235.26
  103.14.235.70
  103.14.244.190
  103.14.250.135
  103.14.27.174
  103.14.33.223
-103.14.33.229
  103.14.34.212
  103.14.35.159
  103.14.35.204
@@ -3665,9 +3531,6 @@
  103.14.38.186
  103.14.38.188
  103.14.45.98
-103.14.99.246
-103.140.126.223
-103.140.127.111
  103.140.127.227
  103.140.133.201
  103.140.182.134
@@ -3680,6 +3543,7 @@
  103.140.250.135
  103.140.250.154
  103.140.250.156
+103.140.250.242
  103.140.250.68
  103.140.250.98
  103.140.251.156
@@ -3692,13 +3556,9 @@
  103.140.83.12
  103.140.83.129
  103.140.83.17
-103.140.83.18
-103.140.83.20
-103.140.83.3
-103.140.83.4
  103.140.83.40
+103.140.83.42
  103.140.83.44
-103.140.83.8
  103.140.83.81
  103.140.83.85
  103.140.83.90
@@ -3708,7 +3568,6 @@
  103.141.108.142
  103.141.108.161
  103.141.108.185
-103.141.117.249
  103.141.136.224
  103.141.137.189
  103.141.137.214
@@ -3716,8 +3575,10 @@
  103.141.138.117
  103.141.138.119
  103.141.138.120
+103.141.138.121
  103.141.138.125
  103.141.138.128
+103.141.138.131
  103.141.138.133
  103.141.138.247
  103.141.138.250
@@ -3727,16 +3588,12 @@
  103.141.142.248
  103.141.142.47
  103.141.158.160
-103.141.165.34
  103.141.182.108
-103.141.188.216
  103.141.234.41
-103.141.30.34
  103.141.46.154
  103.141.99.170
  103.142.102.219
  103.142.111.146
-103.142.139.114
  103.142.164.37
  103.142.164.40
  103.142.165.177
@@ -3780,8 +3637,7 @@
  103.144.146.226
  103.144.166.234
  103.144.167.4
-103.144.180.20
-103.144.180.21
+103.144.180.22
  103.144.200.251
  103.144.213.13
  103.145.12.11
@@ -3799,7 +3655,6 @@
  103.145.13.117
  103.145.13.118
  103.145.13.12
-103.145.13.124
  103.145.13.129
  103.145.13.143
  103.145.13.145
@@ -3813,6 +3668,7 @@
  103.145.13.192
  103.145.13.195
  103.145.13.203
+103.145.13.228
  103.145.13.229
  103.145.13.230
  103.145.13.237
@@ -3830,7 +3686,7 @@
  103.145.253.149
  103.145.253.210
  103.145.253.87
-103.145.27.1
+103.145.255.217
  103.145.51.208
  103.145.62.255
  103.145.67.246
@@ -3843,15 +3699,12 @@
  103.146.110.37
  103.146.110.41
  103.146.111.1
-103.146.176.83
  103.146.177.39
  103.146.202.150
-103.146.203.247
+103.146.204.60
  103.146.204.80
-103.146.74.1
  103.147.10.222
  103.147.119.3
-103.147.174.140
  103.147.184.14
  103.147.185.166
  103.147.185.229
@@ -3867,16 +3720,15 @@
  103.148.195.45
  103.148.195.46
  103.148.76.24
-103.148.85.54
  103.149.142.3
  103.149.162.84
-103.149.203.1
  103.149.238.94
-103.149.240.227
+103.149.240.226
  103.149.241.18
  103.149.248.38
  103.149.26.221
  103.149.48.56
+103.149.91.163
  103.149.91.200
  103.15.140.140
  103.15.140.185
@@ -3899,7 +3751,6 @@
  103.15.245.238
  103.15.251.75
  103.15.251.76
-103.15.36.109
  103.15.40.122
  103.15.40.202
  103.15.60.6
@@ -3912,10 +3763,8 @@
  103.151.122.3
  103.151.140.11
  103.151.176.21
-103.151.182.6
-103.151.226.133
  103.151.226.57
-103.151.46.42
+103.152.100.2
  103.152.118.39
  103.152.119.198
  103.152.119.219
@@ -3934,20 +3783,15 @@
  103.152.242.19
  103.152.244.254
  103.152.43.38
-103.153.182.30
  103.153.182.87
  103.153.79.195
  103.153.79.223
  103.153.79.236
-103.154.241.29
  103.154.54.65
  103.154.54.67
-103.154.9.67
  103.155.75.41
  103.155.92.72
  103.156.93.244
-103.156.93.70
-103.157.161.235
  103.16.115.18
  103.16.128.63
  103.16.128.72
@@ -3956,11 +3800,11 @@
  103.16.132.195
  103.16.132.210
  103.16.14.216
+103.16.144.74
+103.16.144.81
  103.16.157.79
-103.16.198.91
  103.16.199.133
  103.16.199.165
-103.16.202.174
  103.16.228.20
  103.16.24.202
  103.16.24.205
@@ -3972,16 +3816,13 @@
  103.17.104.35
  103.17.106.239
  103.17.108.126
-103.17.110.36
  103.17.117.40
  103.17.117.43
  103.17.196.29
  103.17.196.72
  103.17.244.79
  103.17.253.177
-103.17.39.25
  103.17.39.26
-103.17.39.28
  103.17.49.2
  103.17.51.234
  103.17.96.25
@@ -3989,15 +3830,11 @@
  103.18.167.170
  103.18.179.196
  103.18.179.212
-103.18.242.137
-103.18.242.18
  103.18.245.174
  103.18.247.130
  103.18.71.130
  103.18.77.46
  103.18.78.54
-103.18.79.58
-103.19.110.38
  103.19.110.39
  103.19.133.218
  103.19.229.150
@@ -4052,20 +3889,18 @@
  103.194.90.171
  103.195.100.91
  103.195.141.61
-103.195.142.17
-103.195.4.117
  103.195.7.97
  103.195.90.115
  103.195.90.7
  103.196.127.210
  103.196.20.74
  103.196.202.38
-103.196.22.113
  103.196.233.199
-103.196.52.129
+103.196.235.122
  103.196.52.228
  103.196.52.230
  103.196.53.209
+103.197.134.135
  103.197.134.16
  103.197.134.18
  103.197.134.22
@@ -4074,18 +3909,20 @@
  103.197.222.114
  103.197.48.178
  103.197.48.98
+103.197.72.254
  103.197.93.2
  103.198.10.25
  103.198.10.27
  103.198.10.47
  103.198.10.52
  103.198.10.71
-103.198.11.165
  103.198.11.166
+103.198.11.179
  103.198.139.3
  103.198.19.7
  103.198.192.14
  103.198.80.34
+103.198.80.41
  103.198.80.98
  103.199.103.67
  103.199.110.42
@@ -4131,10 +3968,7 @@
  103.199.159.246
  103.199.16.37
  103.199.16.50
-103.199.162.153
-103.199.163.204
  103.199.17.107
-103.199.18.94
  103.199.84.41
  103.199.84.42
  103.199.84.54
@@ -4146,11 +3980,10 @@
  103.199.98.220
  103.2.132.166
  103.20.166.167
-103.20.188.18
  103.20.188.94
  103.20.189.126
+103.20.189.82
  103.20.191.242
-103.20.207.159
  103.20.215.187
  103.20.3.10
  103.20.3.159
@@ -4169,7 +4002,6 @@
  103.200.20.24
  103.200.209.210
  103.200.211.130
-103.200.23.81
  103.200.38.130
  103.200.39.102
  103.200.40.194
@@ -4178,7 +4010,6 @@
  103.201.140.246
  103.201.140.6
  103.201.141.10
-103.202.99.40
  103.203.208.48
  103.203.65.2
  103.204.109.143
@@ -4192,6 +4023,7 @@
  103.204.166.206
  103.204.79.174
  103.205.114.124
+103.205.128.7
  103.205.128.81
  103.205.130.11
  103.205.130.16
@@ -4225,14 +4057,16 @@
  103.205.130.232
  103.205.130.234
  103.205.130.236
+103.205.130.238
  103.205.130.240
-103.205.130.247
+103.205.130.246
  103.205.130.252
  103.205.130.254
  103.205.130.27
  103.205.130.30
  103.205.130.34
  103.205.130.37
+103.205.130.4
  103.205.130.40
  103.205.130.42
  103.205.130.46
@@ -4241,7 +4075,7 @@
  103.205.130.55
  103.205.130.57
  103.205.130.6
-103.205.130.61
+103.205.130.60
  103.205.130.62
  103.205.130.65
  103.205.130.66
@@ -4254,13 +4088,11 @@
  103.205.130.84
  103.205.130.86
  103.205.130.88
-103.205.130.91
  103.205.130.92
  103.205.130.94
  103.205.134.180
  103.205.134.218
  103.205.140.166
-103.205.143.149
  103.205.176.49
  103.205.177.227
  103.205.177.229
@@ -4270,7 +4102,6 @@
  103.205.243.67
  103.205.253.221
  103.205.4.206
-103.205.5.157
  103.205.5.158
  103.205.5.179
  103.205.66.169
@@ -4286,7 +4117,6 @@
  103.206.118.114
  103.206.118.126
  103.206.118.180
-103.206.118.189
  103.206.118.194
  103.206.118.226
  103.206.118.234
@@ -4311,9 +4141,10 @@
  103.207.0.134
  103.207.0.193
  103.207.0.60
+103.207.1.146
  103.207.11.10
  103.207.11.6
-103.207.156.207
+103.207.14.53
  103.207.165.9
  103.207.168.207
  103.207.168.229
@@ -4332,6 +4163,7 @@
  103.207.37.172
  103.207.37.184
  103.207.37.189
+103.207.37.59
  103.207.37.73
  103.207.38.103
  103.207.38.202
@@ -4341,15 +4173,13 @@
  103.207.39.9
  103.207.4.43
  103.207.58.103
-103.207.6.238
+103.207.7.163
  103.207.7.82
-103.207.8.128
  103.207.96.21
  103.207.96.225
  103.207.96.226
  103.207.97.33
  103.208.120.125
-103.208.137.2
  103.208.152.184
  103.208.152.225
  103.208.152.34
@@ -4360,8 +4190,8 @@
  103.208.220.135
  103.208.220.139
  103.208.220.142
+103.208.220.195
  103.208.220.226
-103.208.225.98
  103.208.53.236
  103.208.82.119
  103.209.100.238
@@ -4374,7 +4204,6 @@
  103.209.194.101
  103.209.194.152
  103.209.194.158
-103.209.204.141
  103.209.38.121
  103.209.64.19
  103.209.65.12
@@ -4383,7 +4212,6 @@
  103.21.116.249
  103.21.117.92
  103.21.142.12
-103.21.143.161
  103.21.149.102
  103.21.149.92
  103.21.150.184
@@ -4400,24 +4228,18 @@
  103.21.40.35
  103.21.53.11
  103.21.58.156
-103.210.106.208
  103.210.120.40
  103.210.142.54
-103.210.21.207
-103.210.23.56
  103.210.236.229
  103.210.237.13
  103.210.29.193
  103.210.31.49
-103.210.72.60
  103.210.72.72
  103.211.10.14
-103.211.10.244
  103.211.11.233
  103.211.11.37
  103.211.11.57
  103.211.11.69
-103.211.15.97
  103.211.167.11
  103.211.190.194
  103.211.218.202
@@ -4453,13 +4275,14 @@
  103.211.8.89
  103.211.8.93
  103.211.8.97
+103.212.12.35
+103.212.12.41
+103.212.12.43
  103.212.128.152
  103.212.128.228
  103.212.128.253
  103.212.138.54
-103.212.144.3
  103.212.146.5
-103.212.146.95
  103.212.211.2
  103.212.211.4
  103.212.222.13
@@ -4469,7 +4292,6 @@
  103.212.223.155
  103.212.223.161
  103.212.225.238
-103.212.32.99
  103.212.69.171
  103.212.92.193
  103.212.92.201
@@ -4494,18 +4316,17 @@
  103.213.116.84
  103.213.116.88
  103.213.192.225
+103.213.193.14
  103.213.240.29
  103.213.245.102
  103.213.248.45
  103.213.96.15
  103.214.112.178
  103.214.12.10
-103.214.129.204
  103.214.137.155
  103.214.137.55
  103.214.138.189
  103.214.146.12
-103.214.171.14
  103.214.191.253
  103.214.201.17
  103.214.202.145
@@ -4522,17 +4343,12 @@
  103.214.65.230
  103.215.136.88
  103.215.139.109
-103.215.139.253
  103.215.148.17
  103.215.148.25
  103.215.148.4
  103.215.164.14
  103.215.165.144
  103.215.165.60
-103.215.166.48
-103.215.177.211
-103.215.177.224
-103.215.177.231
  103.215.203.25
  103.215.203.59
  103.215.220.120
@@ -4546,7 +4362,6 @@
  103.215.82.17
  103.216.135.141
  103.216.147.49
-103.216.155.238
  103.216.156.131
  103.216.167.72
  103.216.169.253
@@ -4559,7 +4374,6 @@
  103.216.218.159
  103.216.218.164
  103.216.218.183
-103.216.218.189
  103.216.218.207
  103.216.218.216
  103.216.218.46
@@ -4568,7 +4382,6 @@
  103.216.48.83
  103.216.49.47
  103.216.50.68
-103.216.63.74
  103.216.82.146
  103.216.82.153
  103.216.82.18
@@ -4580,7 +4393,6 @@
  103.216.82.200
  103.216.82.203
  103.216.82.206
-103.216.82.209
  103.216.82.211
  103.216.82.213
  103.216.82.214
@@ -4590,33 +4402,29 @@
  103.216.82.30
  103.216.82.37
  103.216.82.42
+103.216.82.43
  103.216.82.46
  103.216.82.52
  103.217.119.75
  103.217.152.30
  103.217.153.213
+103.217.153.247
  103.217.155.32
  103.217.173.210
  103.217.213.129
  103.217.213.145
  103.217.215.21
  103.217.217.190
-103.217.243.97
  103.217.247.224
-103.217.255.105
-103.217.255.42
+103.217.85.136
  103.217.89.136
  103.217.91.154
-103.218.0.45
  103.218.111.118
  103.218.2.188
  103.218.228.147
  103.218.24.8
-103.218.241.161
  103.218.27.76
  103.219.112.31
-103.219.112.47
-103.219.112.48
  103.219.112.63
  103.219.186.130
  103.219.187.55
@@ -4630,8 +4438,6 @@
  103.219.31.207
  103.219.36.28
  103.219.37.20
-103.219.39.218
-103.22.141.153
  103.22.144.67
  103.22.191.100
  103.22.191.144
@@ -4646,7 +4452,6 @@
  103.220.214.106
  103.220.28.105
  103.220.31.93
-103.220.47.34
  103.220.5.254
  103.220.6.106
  103.220.6.250
@@ -4659,12 +4464,13 @@
  103.221.232.111
  103.221.232.137
  103.221.232.231
+103.221.232.61
  103.221.234.183
+103.221.234.194
  103.221.234.238
+103.221.234.24
  103.221.234.29
  103.221.235.4
-103.221.235.57
-103.221.252.38
  103.221.252.46
  103.221.253.145
  103.221.253.242
@@ -4687,20 +4493,16 @@
  103.223.12.183
  103.223.12.33
  103.223.13.84
-103.223.6.216
  103.223.8.1
  103.223.8.102
  103.223.8.11
  103.223.8.110
  103.223.8.112
  103.223.8.114
-103.223.8.115
-103.223.8.118
  103.223.8.120
  103.223.8.121
  103.223.8.124
  103.223.8.127
-103.223.8.128
  103.223.8.13
  103.223.8.131
  103.223.8.132
@@ -4718,45 +4520,29 @@
  103.223.8.174
  103.223.8.177
  103.223.8.179
-103.223.8.181
-103.223.8.185
  103.223.8.187
-103.223.8.19
  103.223.8.191
  103.223.8.193
-103.223.8.194
  103.223.8.196
-103.223.8.197
  103.223.8.198
-103.223.8.199
  103.223.8.2
-103.223.8.20
  103.223.8.200
-103.223.8.205
  103.223.8.208
  103.223.8.211
-103.223.8.212
  103.223.8.214
  103.223.8.215
  103.223.8.217
  103.223.8.22
-103.223.8.223
  103.223.8.225
  103.223.8.229
  103.223.8.23
  103.223.8.230
-103.223.8.232
  103.223.8.233
-103.223.8.234
-103.223.8.236
-103.223.8.24
  103.223.8.246
  103.223.8.25
  103.223.8.250
  103.223.8.251
  103.223.8.252
-103.223.8.253
-103.223.8.254
  103.223.8.255
  103.223.8.27
  103.223.8.49
@@ -4767,43 +4553,29 @@
  103.223.8.63
  103.223.8.66
  103.223.8.7
-103.223.8.70
  103.223.8.73
  103.223.8.75
  103.223.8.78
  103.223.8.82
-103.223.8.83
-103.223.8.86
  103.223.8.90
-103.223.8.94
  103.223.8.95
-103.223.8.99
  103.223.9.0
  103.223.9.1
  103.223.9.10
  103.223.9.101
  103.223.9.103
  103.223.9.104
-103.223.9.105
  103.223.9.11
  103.223.9.113
-103.223.9.114
  103.223.9.117
  103.223.9.118
-103.223.9.122
-103.223.9.125
-103.223.9.127
  103.223.9.128
-103.223.9.13
  103.223.9.131
  103.223.9.132
-103.223.9.135
-103.223.9.138
  103.223.9.139
  103.223.9.142
  103.223.9.143
  103.223.9.144
-103.223.9.145
  103.223.9.153
  103.223.9.154
  103.223.9.156
@@ -4816,41 +4588,22 @@
  103.223.9.175
  103.223.9.178
  103.223.9.183
-103.223.9.188
  103.223.9.19
-103.223.9.193
-103.223.9.194
  103.223.9.195
  103.223.9.197
  103.223.9.199
  103.223.9.2
-103.223.9.20
-103.223.9.200
  103.223.9.209
  103.223.9.21
-103.223.9.211
  103.223.9.214
-103.223.9.218
  103.223.9.221
  103.223.9.223
-103.223.9.234
  103.223.9.236
-103.223.9.237
  103.223.9.246
-103.223.9.247
-103.223.9.252
  103.223.9.255
-103.223.9.26
-103.223.9.32
-103.223.9.33
-103.223.9.36
  103.223.9.37
-103.223.9.38
-103.223.9.39
-103.223.9.41
  103.223.9.43
  103.223.9.46
-103.223.9.47
  103.223.9.52
  103.223.9.54
  103.223.9.55
@@ -4861,21 +4614,15 @@
  103.223.9.66
  103.223.9.7
  103.223.9.71
-103.223.9.73
  103.223.9.74
  103.223.9.75
  103.223.9.76
  103.223.9.79
-103.223.9.81
-103.223.9.82
  103.223.9.85
-103.223.9.88
  103.223.9.89
-103.223.9.90
  103.223.9.91
  103.223.9.93
  103.223.9.98
-103.223.9.99
  103.224.101.195
  103.224.118.79
  103.224.167.227
@@ -4898,10 +4645,12 @@
  103.224.83.71
  103.224.83.91
  103.225.136.151
+103.225.138.58
  103.225.206.22
  103.225.207.51
  103.225.207.90
-103.225.212.14
+103.225.212.13
+103.225.22.118
  103.225.222.14
  103.225.228.1
  103.225.228.101
@@ -4914,6 +4663,7 @@
  103.225.228.185
  103.225.228.189
  103.225.228.193
+103.225.228.201
  103.225.228.21
  103.225.228.217
  103.225.228.233
@@ -4964,10 +4714,9 @@
  103.228.143.116
  103.228.143.65
  103.228.152.25
-103.228.162.125
  103.228.181.206
-103.228.222.249
  103.228.244.242
+103.228.46.11
  103.228.53.155
  103.228.53.59
  103.228.71.39
@@ -4996,26 +4745,22 @@
  103.23.101.30
  103.23.101.97
  103.23.102.1
+103.23.102.129
  103.23.102.245
  103.23.119.60
-103.23.126.252
-103.23.127.108
-103.23.127.121
-103.23.127.38
+103.23.125.33
+103.23.125.34
  103.23.144.53
  103.23.144.74
-103.23.155.214
-103.23.202.206
  103.23.21.127
  103.23.224.89
  103.23.34.237
  103.23.34.239
  103.23.41.110
  103.230.107.229
-103.230.15.86
+103.230.152.101
  103.230.155.154
  103.230.155.69
-103.230.217.162
  103.230.49.143
  103.231.101.57
  103.231.162.68
@@ -5043,10 +4788,12 @@
  103.232.245.33
  103.232.33.147
  103.232.64.226
+103.232.65.66
  103.232.66.137
  103.232.66.154
  103.232.66.161
  103.232.66.162
+103.232.66.164
  103.232.66.75
  103.232.67.177
  103.232.67.180
@@ -5056,6 +4803,7 @@
  103.233.0.121
  103.233.0.18
  103.233.0.218
+103.233.1.167
  103.233.103.233
  103.233.103.237
  103.233.103.241
@@ -5071,7 +4819,6 @@
  103.233.152.179
  103.233.152.180
  103.233.153.126
-103.233.154.18
  103.233.154.19
  103.233.5.24
  103.233.68.9
@@ -5089,11 +4836,9 @@
  103.234.254.10
  103.234.254.164
  103.234.40.145
-103.234.94.45
  103.235.164.110
  103.235.164.87
-103.235.165.172
-103.235.165.228
+103.235.165.161
  103.235.170.162
  103.235.170.195
  103.235.197.42
@@ -5102,14 +4847,13 @@
  103.235.199.9
  103.235.224.77
  103.235.230.196
-103.235.232.178
  103.235.232.218
  103.235.254.210
-103.235.34.85
  103.236.114.38
  103.236.152.182
  103.236.152.183
  103.236.152.184
+103.236.153.82
  103.236.160.129
  103.236.161.11
  103.236.161.12
@@ -5129,7 +4873,6 @@
  103.236.162.206
  103.236.162.221
  103.236.179.162
-103.236.193.225
  103.236.201.110
  103.236.201.88
  103.236.252.80
@@ -5140,12 +4883,10 @@
  103.237.144.150
  103.237.145.182
  103.237.39.98
-103.237.56.108
-103.237.56.132
-103.237.56.165
-103.237.56.89
  103.237.57.217
  103.237.57.37
+103.237.57.60
+103.237.58.201
  103.237.78.6
  103.238.14.242
  103.238.224.138
@@ -5168,8 +4909,9 @@
  103.239.254.70
  103.239.255.170
  103.239.29.171
+103.239.29.196
  103.239.29.219
-103.239.52.185
+103.239.29.229
  103.239.55.73
  103.24.107.234
  103.24.107.75
@@ -5178,6 +4920,7 @@
  103.24.109.170
  103.24.109.218
  103.24.110.176
+103.24.110.89
  103.24.179.138
  103.24.179.85
  103.24.190.218
@@ -5192,7 +4935,6 @@
  103.240.160.21
  103.240.161.101
  103.240.161.108
-103.240.161.109
  103.240.168.138
  103.240.202.37
  103.240.206.152
@@ -5222,7 +4964,6 @@
  103.241.227.100
  103.241.227.105
  103.241.227.106
-103.241.227.107
  103.241.227.108
  103.241.227.110
  103.241.227.114
@@ -5238,6 +4979,7 @@
  103.242.107.226
  103.242.107.241
  103.242.107.82
+103.242.118.154
  103.242.118.188
  103.242.118.222
  103.242.119.230
@@ -5245,12 +4987,10 @@
  103.242.132.33
  103.242.14.68
  103.242.14.8
-103.242.15.37
  103.242.156.96
  103.242.168.14
  103.242.173.118
  103.242.186.60
-103.242.200.38
  103.242.224.105
  103.242.224.107
  103.242.224.108
@@ -5259,10 +4999,6 @@
  103.242.239.195
  103.242.45.233
  103.242.45.68
-103.242.47.230
-103.242.56.122
-103.242.56.174
-103.242.56.182
  103.242.66.56
  103.242.72.7
  103.243.112.173
@@ -5275,7 +5011,6 @@
  103.243.25.131
  103.243.25.214
  103.243.25.92
-103.243.252.20
  103.243.27.175
  103.243.27.23
  103.243.4.162
@@ -5284,8 +5019,8 @@
  103.243.81.252
  103.243.82.198
  103.243.82.234
-103.244.108.159
  103.244.108.160
+103.244.120.218
  103.244.193.25
  103.244.205.146
  103.244.5.230
@@ -5318,7 +5053,6 @@
  103.246.1.218
  103.246.1.220
  103.246.1.222
-103.246.110.106
  103.246.112.41
  103.246.113.9
  103.246.161.146
@@ -5331,13 +5065,12 @@
  103.247.142.178
  103.247.151.107
  103.247.151.122
+103.247.151.133
  103.247.151.139
  103.247.151.141
-103.247.151.154
  103.247.151.184
  103.247.151.195
  103.247.151.235
-103.247.151.88
  103.247.216.17
  103.247.218.186
  103.247.218.43
@@ -5353,13 +5086,9 @@
  103.248.219.172
  103.248.248.146
  103.248.31.50
-103.248.33.51
-103.248.43.62
  103.248.85.244
  103.249.155.109
  103.249.155.137
-103.249.155.141
-103.249.155.145
  103.249.155.169
  103.249.155.177
  103.249.155.185
@@ -5390,16 +5119,13 @@
  103.25.123.193
  103.25.123.197
  103.25.130.114
-103.25.132.2
-103.25.132.42
+103.25.132.28
  103.25.134.140
-103.25.134.143
  103.25.136.53
  103.25.152.51
  103.25.155.202
  103.25.21.34
  103.25.3.82
-103.25.36.194
  103.25.45.38
  103.25.6.111
  103.25.72.62
@@ -5409,7 +5135,6 @@
  103.25.84.176
  103.25.84.185
  103.25.84.207
-103.25.84.91
  103.250.148.82
  103.250.152.30
  103.250.153.203
@@ -5431,13 +5156,13 @@
  103.250.167.226
  103.250.168.132
  103.250.184.59
-103.250.185.144
  103.250.189.16
  103.250.68.10
  103.250.69.86
  103.250.69.94
  103.250.70.9
  103.250.71.33
+103.251.176.22
  103.251.189.129
  103.251.190.6
  103.251.214.167
@@ -5470,33 +5195,31 @@
  103.251.222.9
  103.251.223.13
  103.251.225.10
-103.251.225.13
  103.251.225.16
  103.251.225.18
  103.251.48.38
  103.251.57.23
+103.251.60.4
  103.251.64.44
  103.251.83.14
+103.252.116.138
  103.252.116.139
  103.252.116.184
  103.252.117.100
-103.252.117.149
+103.252.117.75
+103.252.13.13
  103.252.13.153
  103.252.131.112
  103.252.144.123
  103.252.16.224
  103.252.171.85
  103.252.19.22
-103.252.196.150
  103.253.112.17
-103.253.113.173
  103.253.113.54
  103.253.14.43
-103.253.140.2
  103.253.140.27
  103.253.140.28
  103.253.140.48
-103.253.140.55
  103.253.145.125
  103.253.145.133
  103.253.145.153
@@ -5504,20 +5227,16 @@
  103.253.146.142
  103.253.146.57
  103.253.147.242
-103.253.151.152
  103.253.153.21
  103.253.154.155
  103.253.154.52
-103.253.168.186
  103.253.172.107
  103.253.200.161
-103.253.208.210
  103.253.208.39
  103.253.208.96
  103.253.238.234
  103.253.251.238
  103.253.27.108
-103.253.3.214
  103.253.41.111
  103.253.41.63
  103.253.41.98
@@ -5532,7 +5251,6 @@
  103.254.167.74
  103.254.198.67
  103.254.207.197
-103.254.209.201
  103.254.210.244
  103.254.56.114
  103.254.58.250
@@ -5553,7 +5271,8 @@
  103.255.5.117
  103.255.53.98
  103.255.74.112
-103.255.77.29
+103.255.74.245
+103.255.74.26
  103.26.136.173
  103.26.213.117
  103.26.213.151
@@ -5561,13 +5280,11 @@
  103.26.246.122
  103.26.251.59
  103.26.40.145
-103.26.40.76
  103.26.87.0
  103.26.96.46
  103.27.108.113
  103.27.109.164
  103.27.109.166
-103.27.116.2
  103.27.202.58
  103.27.207.69
  103.27.227.228
@@ -5584,7 +5301,6 @@
  103.28.112.3
  103.28.112.5
  103.28.113.22
-103.28.114.101
  103.28.121.58
  103.28.149.180
  103.28.149.201
@@ -5594,12 +5310,10 @@
  103.28.225.223
  103.28.37.131
  103.28.38.166
-103.28.52.84
  103.28.52.93
  103.28.53.138
  103.28.56.214
  103.28.57.122
-103.28.57.78
  103.28.59.34
  103.28.60.199
  103.28.60.211
@@ -5623,17 +5337,19 @@
  103.28.67.162
  103.28.67.254
  103.28.70.87
-103.28.84.31
  103.28.86.241
  103.29.116.254
  103.29.156.142
  103.29.184.41
+103.29.185.166
  103.29.185.206
  103.29.185.33
  103.29.185.37
  103.29.185.49
  103.29.185.52
  103.29.185.65
+103.29.196.188
+103.29.196.230
  103.29.69.57
  103.29.70.69
  103.29.90.134
@@ -5641,12 +5357,9 @@
  103.3.121.29
  103.3.121.50
  103.3.225.114
-103.3.226.230
  103.3.46.213
  103.3.46.92
-103.3.60.128
  103.3.65.162
-103.3.79.42
  103.30.0.249
  103.30.0.5
  103.30.149.153
@@ -5655,7 +5368,6 @@
  103.30.188.130
  103.30.190.58
  103.30.40.248
-103.30.48.212
  103.30.92.91
  103.31.109.173
  103.31.109.180
@@ -5683,7 +5395,6 @@
  103.31.251.25
  103.31.45.105
  103.31.45.174
-103.31.47.58
  103.31.53.244
  103.31.84.122
  103.35.108.145
@@ -5694,6 +5405,7 @@
  103.35.111.101
  103.35.111.102
  103.35.132.50
+103.35.142.43
  103.35.171.178
  103.35.173.132
  103.35.64.12
@@ -5716,6 +5428,7 @@
  103.36.125.162
  103.36.126.14
  103.36.33.4
+103.36.35.131
  103.36.35.135
  103.36.44.130
  103.36.48.110
@@ -5723,7 +5436,6 @@
  103.36.84.180
  103.36.9.7
  103.36.92.112
-103.37.150.140
  103.37.205.47
  103.37.82.38
  103.38.102.182
@@ -5753,17 +5465,13 @@
  103.38.25.218
  103.38.25.226
  103.38.252.115
-103.38.4.28
  103.38.67.13
  103.39.10.169
  103.39.109.38
  103.39.131.88
-103.39.133.156
  103.39.139.113
  103.39.212.96
  103.39.213.170
-103.39.213.236
-103.39.219.76
  103.39.220.205
  103.39.235.166
  103.39.236.214
@@ -5789,15 +5497,10 @@
  103.40.172.190
  103.40.18.3
  103.40.187.34
-103.40.19.172
  103.40.197.163
  103.40.201.39
-103.40.21.80
  103.40.22.97
-103.40.23.52
-103.40.241.155
  103.40.242.32
-103.40.247.42
  103.40.248.195
  103.40.248.203
  103.40.248.239
@@ -5817,7 +5520,6 @@
  103.41.164.71
  103.41.177.33
  103.41.177.35
-103.41.204.6
  103.41.212.186
  103.41.24.0
  103.41.24.175
@@ -5845,6 +5547,7 @@
  103.41.26.145
  103.41.26.148
  103.41.26.149
+103.41.26.15
  103.41.26.150
  103.41.26.151
  103.41.26.153
@@ -6015,6 +5718,7 @@
  103.41.27.222
  103.41.27.225
  103.41.27.227
+103.41.27.228
  103.41.27.23
  103.41.27.230
  103.41.27.232
@@ -6064,6 +5768,7 @@
  103.41.27.95
  103.41.27.96
  103.41.27.97
+103.41.28.4
  103.41.28.70
  103.41.29.134
  103.41.36.106
@@ -6085,6 +5790,7 @@
  103.41.96.94
  103.42.126.40
  103.42.126.92
+103.42.127.181
  103.42.127.226
  103.42.127.248
  103.42.156.105
@@ -6104,7 +5810,6 @@
  103.42.254.102
  103.42.254.108
  103.42.254.194
-103.42.91.25
  103.43.129.227
  103.43.151.46
  103.43.16.146
@@ -6113,7 +5818,6 @@
  103.43.185.142
  103.43.185.166
  103.43.202.18
-103.43.203.225
  103.43.213.116
  103.43.40.94
  103.43.42.85
@@ -6124,13 +5828,13 @@
  103.44.14.129
  103.44.144.4
  103.44.144.7
+103.44.15.193
  103.44.18.233
  103.44.18.248
  103.44.240.204
  103.44.240.67
  103.44.241.133
  103.44.243.45
-103.44.248.87
  103.44.253.18
  103.44.253.47
  103.44.254.237
@@ -6147,24 +5851,18 @@
  103.45.104.83
  103.45.105.120
  103.45.106.5
-103.45.109.47
-103.45.115.160
+103.45.111.11
  103.45.115.211
  103.45.115.96
  103.45.116.121
  103.45.116.183
  103.45.116.188
-103.45.120.144
  103.45.131.11
-103.45.147.10
-103.45.147.120
-103.45.149.122
  103.45.150.170
  103.45.152.21
  103.45.175.130
  103.45.175.247
  103.45.176.61
-103.45.178.184
  103.45.182.116
  103.45.182.118
  103.45.182.120
@@ -6185,21 +5883,19 @@
  103.45.184.173
  103.45.184.227
  103.45.184.87
-103.45.185.173
  103.45.185.49
  103.45.185.76
  103.45.188.134
  103.45.188.38
  103.45.189.165
-103.45.189.189
  103.45.189.20
+103.45.189.232
  103.45.190.6
  103.45.248.169
  103.45.98.92
  103.46.12.181
  103.46.128.41
  103.46.128.43
-103.46.139.230
  103.46.234.129
  103.46.238.83
  103.47.104.244
@@ -6211,16 +5907,14 @@
  103.47.14.246
  103.47.150.11
  103.47.200.91
-103.47.216.151
  103.47.217.143
  103.47.217.155
  103.47.217.33
  103.47.217.79
  103.47.218.76
-103.47.219.235
  103.47.219.37
+103.47.219.79
  103.47.241.244
-103.47.66.154
  103.47.70.252
  103.47.80.164
  103.47.92.17
@@ -6228,13 +5922,12 @@
  103.47.93.113
  103.47.93.194
  103.47.93.196
+103.47.93.198
  103.47.93.200
-103.47.93.202
-103.47.93.204
  103.47.93.208
+103.47.93.212
+103.47.93.214
  103.47.93.216
-103.47.93.221
-103.47.93.222
  103.47.93.224
  103.47.93.226
  103.47.93.228
@@ -6255,11 +5948,11 @@
  103.48.181.189
  103.48.183.113
  103.48.186.119
+103.48.186.120
  103.48.186.141
  103.48.192.48
  103.48.193.7
  103.48.25.131
-103.48.25.194
  103.48.25.195
  103.48.25.250
  103.49.135.195
@@ -6272,15 +5965,14 @@
  103.49.28.64
  103.49.53.129
  103.49.56.137
-103.49.56.160
  103.49.69.172
  103.50.148.129
  103.50.150.225
+103.50.152.226
  103.50.162.156
  103.50.170.105
  103.50.170.113
  103.50.170.117
-103.50.170.121
  103.50.170.13
  103.50.170.137
  103.50.170.181
@@ -6291,7 +5983,6 @@
  103.50.170.41
  103.50.170.49
  103.50.170.65
-103.50.170.69
  103.50.170.73
  103.50.170.81
  103.50.170.9
@@ -6323,7 +6014,6 @@
  103.51.46.4
  103.51.47.9
  103.52.135.48
-103.52.171.165
  103.52.209.41
  103.52.209.81
  103.52.209.97
@@ -6354,16 +6044,17 @@
  103.52.220.1
  103.52.37.1
  103.52.37.65
-103.52.52.22
+103.52.61.77
  103.52.90.158
  103.53.0.178
  103.53.108.2
  103.53.109.162
  103.53.109.2
  103.53.110.45
+103.53.113.0
  103.53.113.168
  103.53.113.26
-103.53.113.35
+103.53.113.8
  103.53.190.186
  103.53.197.158
  103.53.197.202
@@ -6371,7 +6062,6 @@
  103.53.197.78
  103.53.198.89
  103.53.199.244
-103.53.208.19
  103.53.208.207
  103.53.208.224
  103.53.208.225
@@ -6383,7 +6073,6 @@
  103.53.44.85
  103.53.45.130
  103.53.53.14
-103.53.74.78
  103.53.76.82
  103.53.82.242
  103.53.83.24
@@ -6410,17 +6099,16 @@
  103.54.217.198
  103.54.217.80
  103.54.217.98
+103.54.219.106
  103.54.221.122
  103.54.251.152
  103.54.28.234
-103.54.29.167
  103.54.30.57
  103.54.95.70
  103.55.104.210
  103.55.144.157
  103.55.144.54
  103.55.144.70
-103.55.171.178
  103.55.191.113
  103.55.191.141
  103.55.24.2
@@ -6432,18 +6120,16 @@
  103.55.60.11
  103.55.91.131
  103.56.113.172
-103.56.113.224
  103.56.115.142
  103.56.115.156
  103.56.115.76
-103.56.149.75
  103.56.156.66
-103.56.157.225
  103.56.196.158
  103.56.205.114
  103.56.207.230
  103.56.207.233
  103.56.207.81
+103.56.235.186
  103.56.239.123
  103.56.239.48
  103.56.77.104
@@ -6457,11 +6143,11 @@
  103.57.220.28
  103.57.220.37
  103.57.222.230
+103.57.223.195
  103.57.240.90
  103.57.43.170
  103.57.43.171
  103.57.43.174
-103.57.70.231
  103.57.70.248
  103.57.71.137
  103.57.74.254
@@ -6487,11 +6173,11 @@
  103.57.83.192
  103.57.83.224
  103.57.85.244
-103.58.100.56
  103.58.16.106
  103.58.16.254
  103.58.16.46
  103.58.17.246
+103.58.249.54
  103.58.65.178
  103.58.66.204
  103.58.66.21
@@ -6502,14 +6188,12 @@
  103.59.105.241
  103.59.107.186
  103.59.113.128
-103.59.113.193
  103.59.134.166
  103.59.134.183
  103.59.145.229
  103.59.150.5
  103.59.151.21
  103.59.151.43
-103.59.165.93
  103.59.190.2
  103.59.190.209
  103.59.200.14
@@ -6547,36 +6231,31 @@
  103.61.198.114
  103.61.198.122
  103.61.198.234
-103.61.37.231
  103.62.140.66
  103.62.141.133
  103.62.144.152
-103.62.154.2
  103.62.232.11
  103.62.235.6
  103.62.235.7
  103.63.108.25
-103.63.109.74
  103.63.158.153
  103.63.158.18
  103.63.158.21
  103.63.158.93
  103.63.2.148
  103.63.2.210
-103.63.212.164
  103.64.13.51
  103.65.181.82
  103.65.182.26
  103.65.193.170
  103.65.194.3
  103.65.194.46
-103.65.24.243
-103.66.16.18
  103.66.176.45
  103.66.176.81
  103.66.178.43
  103.66.205.125
  103.66.211.43
+103.66.223.106
  103.66.233.137
  103.66.233.141
  103.66.233.161
@@ -6585,17 +6264,19 @@
  103.66.68.82
  103.66.69.74
  103.66.77.206
+103.66.77.78
  103.66.78.40
  103.66.78.45
  103.66.79.108
  103.66.79.116
+103.66.79.120
+103.66.79.27
  103.66.79.45
  103.66.79.64
  103.66.79.84
  103.67.13.247
  103.67.152.211
  103.67.154.214
-103.67.16.14
  103.67.16.221
  103.67.16.6
  103.67.17.1
@@ -6611,13 +6292,11 @@
  103.68.176.73
  103.68.181.35
  103.68.3.187
-103.68.33.34
  103.68.34.185
  103.68.35.162
  103.68.35.166
  103.68.53.76
  103.68.54.66
-103.68.68.23
  103.68.9.150
  103.69.118.77
  103.69.193.127
@@ -6629,14 +6308,12 @@
  103.69.20.149
  103.69.20.38
  103.69.20.42
-103.69.20.43
  103.69.20.46
  103.69.20.47
  103.69.20.99
  103.69.21.128
  103.69.21.192
  103.69.216.138
-103.69.217.19
  103.69.217.22
  103.69.220.11
  103.69.224.57
@@ -6644,8 +6321,7 @@
  103.69.245.182
  103.69.245.252
  103.69.245.55
-103.69.36.21
-103.69.46.198
+103.69.9.63
  103.69.91.211
  103.7.18.208
  103.7.244.10
@@ -6665,7 +6341,7 @@
  103.70.167.212
  103.70.189.14
  103.70.190.196
-103.70.199.189
+103.70.199.187
  103.70.204.1
  103.70.204.194
  103.70.204.201
@@ -6678,6 +6354,7 @@
  103.70.38.218
  103.70.38.46
  103.70.77.18
+103.71.168.86
  103.71.169.129
  103.71.169.130
  103.71.171.108
@@ -6686,34 +6363,29 @@
  103.71.20.107
  103.71.20.220
  103.71.20.26
+103.71.22.10
  103.71.22.25
  103.71.22.75
  103.71.254.17
  103.71.254.40
-103.71.66.67
  103.72.144.228
  103.72.169.121
  103.72.172.20
  103.72.218.247
  103.72.218.81
-103.72.221.45
-103.72.223.56
  103.72.4.148
  103.72.9.238
  103.73.101.29
  103.73.102.130
  103.73.105.42
  103.73.152.24bin.sh
-103.73.152.98
-103.73.153.10
-103.73.153.123
  103.73.153.60
-103.73.155.25
+103.73.154.188
+103.73.155.100
+103.73.155.12
  103.73.161.107
  103.73.161.149
  103.73.162.156
-103.73.182.198
-103.73.183.31
  103.73.35.38
  103.73.65.116
  103.73.66.182
@@ -6722,27 +6394,25 @@
  103.73.66.251
  103.73.66.68
  103.73.68.219
-103.73.74.131
  103.73.95.244
+103.73.96.111
  103.74.108.145
  103.74.117.151
  103.74.120.101
  103.74.120.89
  103.74.120.90
-103.74.122.223
  103.74.123.158
  103.74.227.130
-103.74.239.110
  103.74.244.157
  103.74.244.216
  103.74.244.244
+103.74.245.115
  103.74.246.110
-103.74.246.226
+103.74.246.254
  103.74.70.142
  103.74.70.97
  103.75.1.198
  103.75.1.252
-103.75.101.59
  103.75.148.103
  103.75.148.17
  103.75.148.203
@@ -6751,7 +6421,6 @@
  103.75.149.105
  103.75.149.106
  103.75.149.113
-103.75.149.121
  103.75.149.97
  103.75.161.38
  103.75.180.51
@@ -6765,8 +6434,6 @@
  103.75.208.53
  103.75.217.122
  103.75.219.130
-103.75.219.18
-103.75.219.50
  103.75.225.101
  103.75.225.37
  103.75.225.45
@@ -6785,7 +6452,6 @@
  103.76.172.230
  103.76.175.130
  103.76.175.88
-103.76.18.146
  103.76.18.66
  103.76.188.13
  103.76.188.2
@@ -6802,7 +6468,6 @@
  103.76.190.81
  103.76.20.155
  103.76.200.62
-103.76.201.114
  103.76.201.118
  103.76.201.181
  103.76.201.246
@@ -6831,7 +6496,6 @@
  103.77.23.241
  103.77.23.9
  103.77.37.19
-103.77.37.2
  103.77.49.194
  103.77.8.149
  103.78.13.4
@@ -6840,24 +6504,21 @@
  103.78.141.187
  103.78.141.27
  103.78.143.4
-103.78.15.2
  103.78.15.226
  103.78.150.32
  103.78.151.117
  103.78.151.222
+103.78.154.20
  103.78.16.194
  103.78.164.201
  103.78.168.105
  103.78.18.148
  103.78.180.158
  103.78.181.198
-103.78.209.204
-103.78.210.154
  103.78.210.158
  103.78.210.205
  103.78.213.226
  103.78.213.73
-103.78.215.150
  103.78.219.237
  103.78.23.26
  103.78.238.230
@@ -6889,14 +6550,13 @@
  103.79.117.5
  103.79.154.230
  103.79.169.129
-103.79.169.34
+103.79.169.153
  103.79.176.31
  103.79.200.22
-103.79.35.116
  103.79.35.156
  103.79.35.159
  103.79.35.169
-103.79.35.183
+103.79.35.176
  103.79.74.26
  103.79.74.3
  103.79.90.72
@@ -6906,7 +6566,6 @@
  103.8.119.17
  103.8.147.253
  103.8.195.34
-103.8.250.162
  103.8.27.10
  103.8.59.1
  103.8.59.9
@@ -6928,10 +6587,7 @@
  103.81.116.120
  103.81.15.38
  103.81.153.133
-103.81.156.10
-103.81.156.8
  103.81.215.26
-103.81.86.49
  103.82.11.209
  103.82.11.237
  103.82.11.97
@@ -6940,15 +6596,11 @@
  103.82.143.89
  103.82.145.110
  103.82.145.111
-103.82.145.79
  103.82.146.154
+103.82.147.156
  103.82.147.33
  103.82.157.163
  103.82.186.162
-103.82.222.106
-103.82.222.209
-103.82.222.85
-103.82.233.2
  103.82.24.110
  103.82.24.120
  103.82.24.125
@@ -6996,15 +6648,12 @@
  103.82.8.201
  103.82.8.209
  103.82.80.144
-103.82.81.106
  103.82.82.55
  103.82.98.151
  103.82.98.170
  103.83.107.234
  103.83.109.228
  103.83.110.21
-103.83.116.154
-103.83.116.226
  103.83.156.112
  103.83.156.113
  103.83.156.138
@@ -7031,7 +6680,6 @@
  103.83.187.202
  103.83.187.245
  103.83.205.57
-103.83.249.128
  103.83.249.252
  103.83.249.254
  103.83.70.250
@@ -7050,29 +6698,27 @@
  103.84.238.3
  103.84.240.153
  103.84.240.211
-103.84.240.221
  103.84.240.237
-103.84.240.244
+103.84.240.246
  103.84.240.251
+103.84.241.102
  103.84.241.117
+103.84.241.122
  103.84.241.145
  103.84.241.221
  103.84.241.5
  103.84.241.79
+103.84.241.80
  103.84.241.93
  103.84.37.142
  103.84.38.158
  103.84.38.243
-103.84.63.5
-103.84.71.238
  103.84.84.250
  103.85.150.201
  103.85.150.253
  103.85.162.62
-103.85.169.178
-103.85.21.28
+103.85.188.50
  103.85.23.60
-103.85.23.61
  103.85.63.66
  103.85.66.98
  103.85.67.114
@@ -7080,6 +6726,7 @@
  103.85.67.94
  103.85.84.185
  103.85.85.140
+103.85.9.81
  103.85.90.93
  103.86.1.17
  103.86.1.2
@@ -7089,7 +6736,6 @@
  103.86.1.34
  103.86.1.41
  103.86.1.9
-103.86.100.4
  103.86.103.85
  103.86.130.43
  103.86.134.194
@@ -7103,7 +6749,6 @@
  103.86.161.244
  103.86.172.129
  103.86.175.174
-103.86.176.17
  103.86.180.10
  103.86.195.186
  103.86.195.190
@@ -7116,20 +6761,19 @@
  103.86.45.77
  103.86.49.11
  103.86.50.211
+103.86.51.156
  103.86.53.130
  103.86.66.242
-103.86.68.50
  103.86.70.222
  103.86.86.71
  103.87.160.177
+103.87.168.147
  103.87.168.30
  103.87.169.135
-103.87.169.231
  103.87.169.243
  103.87.170.123
-103.87.170.215
+103.87.170.167
  103.87.170.90
-103.87.171.242
  103.87.173.139
  103.87.173.237
  103.87.174.54
@@ -7144,15 +6788,12 @@
  103.87.25.42
  103.87.251.146
  103.87.26.125
-103.87.26.229
-103.87.46.218
  103.87.48.1
  103.87.48.45
  103.87.48.57
  103.87.49.202
  103.87.49.60
  103.87.87.2
-103.88.140.162
  103.88.169.6
  103.88.221.105
  103.88.221.123
@@ -7164,6 +6805,7 @@
  103.89.152.190
  103.89.176.73
  103.89.176.74
+103.89.235.26
  103.89.252.123
  103.89.252.222
  103.89.254.138
@@ -7172,9 +6814,9 @@
  103.89.88.198
  103.89.88.222
  103.89.88.39
+103.89.88.53
  103.89.89.242
  103.89.89.248
-103.89.90.107
  103.89.90.44
  103.89.90.5
  103.89.91.186
@@ -7193,7 +6835,6 @@
  103.9.159.144
  103.9.174.120
  103.9.188.229
-103.9.195.59
  103.9.227.210
  103.9.79.132
  103.90.158.77
@@ -7204,10 +6845,8 @@
  103.90.224.154
  103.90.226.41
  103.90.228.121
-103.90.231.179
  103.90.231.89
  103.90.233.35
-103.90.237.57
  103.90.68.180
  103.90.72.211
  103.90.73.179
@@ -7219,7 +6858,6 @@
  103.91.17.136
  103.91.176.170
  103.91.176.98
-103.91.181.25
  103.91.204.30
  103.91.210.11
  103.91.210.187
@@ -7232,12 +6870,13 @@
  103.91.245.13
  103.91.245.13bin.sh
  103.91.245.14
+103.91.245.17
  103.91.245.18
-103.91.245.2
  103.91.245.27
  103.91.245.27bin.sh
  103.91.245.28
  103.91.245.3
+103.91.245.30
  103.91.245.3bin.sh
  103.91.245.41
  103.91.245.44
@@ -7246,10 +6885,10 @@
  103.91.245.47
  103.91.245.5
  103.91.245.60
+103.91.64.19
  103.91.65.216
  103.91.65.55
  103.91.69.30
-103.91.77.19
  103.91.80.224
  103.91.90.101
  103.91.90.103
@@ -7258,11 +6897,11 @@
  103.91.90.99
  103.91.92.134
  103.91.92.168
+103.91.92.169
  103.91.92.172
  103.91.92.173
  103.91.92.175
  103.92.101.178
-103.92.102.44
  103.92.104.127
  103.92.121.218
  103.92.123.153
@@ -7279,27 +6918,21 @@
  103.92.225.95
  103.92.24.245
  103.92.24.248
-103.92.24.252
  103.92.25.90
  103.92.25.95
  103.92.26.252
  103.92.29.247
-103.92.31.145
-103.93.10.205
  103.93.106.135
-103.93.106.42
-103.93.180.231
  103.93.181.10
  103.93.202.161
+103.93.202.184
  103.93.202.36
  103.93.220.182
-103.93.77.36
  103.93.88.62
  103.94.0.178
  103.94.112.22
  103.94.121.27
  103.94.125.254
-103.94.135.178
  103.94.16.129
  103.94.170.34
  103.94.2.110
@@ -7315,7 +6948,6 @@
  103.95.40.20
  103.95.40.9
  103.95.41.228
-103.95.41.9
  103.95.42.129
  103.95.42.141
  103.95.43.6
@@ -7328,16 +6960,13 @@
  103.95.98.179
  103.95.98.90
  103.95.99.229
-103.96.116.34
  103.96.129.21
  103.96.220.115
  103.96.73.160
  103.96.73.208
  103.97.124.53
  103.97.125.20
-103.97.138.107
-103.97.138.50
-103.97.139.53
+103.97.136.160
  103.97.164.98
  103.97.179.141
  103.97.213.136
@@ -7363,11 +6992,9 @@
  103.98.112.218
  103.98.120.89
  103.98.128.51
-103.98.17.10
-103.98.17.75
+103.98.149.144
  103.98.17.94
  103.98.176.188
-103.98.176.248
  103.98.19.22
  103.98.19.39
  103.98.32.15
@@ -7375,7 +7002,6 @@
  103.98.78.34
  103.99.0.124
  103.99.0.36
-103.99.1.117
  103.99.1.31
  103.99.109.146
  103.99.11.61
@@ -7393,7 +7019,6 @@
  103.99.189.29
  103.99.189.33
  103.99.189.37
-103.99.2.201
  103.99.2.245
  103.99.201.97
  103.99.206.16
@@ -7407,15 +7032,15 @@
  103.99.3.30
  103.99.3.5
  103.99.3.54
-103.99.37.13
+103.99.3.88
  1030408.servicesndt1.club
  103298943.snapchatprime.com
  10350.psdzy.com
  103967523358-dot-vhj-opi-mkl.ionos1n1.com
+104.11.88.224
  104.12.64.243
  104.12.66.70
  104.128.161.233
-104.128.226.68
  104.128.228.113
  104.128.35.50
  104.128.48.202
@@ -7429,26 +7054,25 @@
  104.129.184.232
  104.129.187.23
  104.129.188.171
-104.129.194.132
-104.129.194.241
-104.129.194.247
  104.129.194.50
  104.129.196.126
  104.129.199.75
  104.129.202.170
+104.129.202.48
+104.129.202.51
+104.129.202.55
  104.129.206.103
+104.129.206.199
  104.129.253.177
  104.129.253.179
-104.129.253.247
  104.129.253.72
  104.129.3.243
-104.129.3.250
  104.129.4.186
-104.129.47.241
  104.129.48.52
  104.129.58.198
  104.129.58.211
-104.129.58.225
+104.129.58.214
+104.129.58.229
  104.129.58.240
  104.129.58.247
  104.129.61.39
@@ -7499,7 +7123,6 @@
  104.131.114.87
  104.131.115.14
  104.131.116.221
-104.131.116.235
  104.131.116.29
  104.131.119.248
  104.131.12.181
@@ -7514,8 +7137,8 @@
  104.131.131.140
  104.131.135.41
  104.131.136.164
-104.131.138.126
  104.131.140.246
+104.131.142.224
  104.131.150.100
  104.131.150.216
  104.131.150.35
@@ -7539,7 +7162,6 @@
  104.131.175.91
  104.131.176.180
  104.131.178.207
-104.131.178.223
  104.131.178.225
  104.131.180.238
  104.131.181.4
@@ -7553,7 +7175,6 @@
  104.131.188.133
  104.131.188.89
  104.131.189.105
-104.131.189.4
  104.131.189.57
  104.131.19.14
  104.131.190.193
@@ -7575,7 +7196,6 @@
  104.131.22.162
  104.131.220.136
  104.131.221.134
-104.131.23.8
  104.131.231.109
  104.131.24.85
  104.131.242.136
@@ -7592,6 +7212,7 @@
  104.131.37.140
  104.131.38.152
  104.131.39.193
+104.131.39.238
  104.131.4.232
  104.131.41.185
  104.131.41.46
@@ -7603,7 +7224,6 @@
  104.131.46.166
  104.131.46.187
  104.131.48.26
-104.131.52.16
  104.131.54.244
  104.131.55.236
  104.131.57.95
@@ -7612,7 +7232,6 @@
  104.131.58.179
  104.131.59.42
  104.131.59.76
-104.131.60.171
  104.131.60.220
  104.131.60.87
  104.131.61.161
@@ -7627,7 +7246,6 @@
  104.131.7.119
  104.131.7.177
  104.131.7.9
-104.131.71.105
  104.131.71.92
  104.131.72.177
  104.131.72.40
@@ -7642,14 +7260,12 @@
  104.131.81.54
  104.131.83.113
  104.131.83.18
-104.131.83.204
  104.131.83.213
  104.131.84.0
  104.131.84.253
  104.131.84.29
  104.131.86.2
  104.131.86.255
-104.131.87.57
  104.131.88.1
  104.131.88.229
  104.131.90.107
@@ -7665,7 +7281,6 @@
  104.137.22.44
  104.139.47.189
  104.139.74.25
-104.14.128.114
  104.14.23.102
  104.140.102.10
  104.140.103.118
@@ -7695,23 +7310,23 @@
  104.140.242.35
  104.140.242.72
  104.140.245.66
+104.140.83.154
+104.140.83.202
  104.140.83.22
  104.143.14.92
  104.143.2.195
-104.143.37.109
-104.143.37.38
  104.143.38.34
  104.143.43.37
  104.143.83.242
-104.144.103.126
+104.144.103.121
  104.144.103.33
  104.144.110.144
  104.144.112.124
  104.144.112.184
-104.144.112.214
+104.144.112.186
+104.144.112.202
  104.144.112.223
  104.144.116.218
-104.144.119.140
  104.144.148.152
  104.144.153.242
  104.144.155.228
@@ -7721,8 +7336,8 @@
  104.144.18.168
  104.144.18.179
  104.144.180.212
-104.144.180.218
-104.144.182.134
+104.144.180.219
+104.144.184.201
  104.144.185.94
  104.144.191.103
  104.144.196.102
@@ -7733,17 +7348,12 @@
  104.144.207.207
  104.144.207.229
  104.144.21.252
-104.144.210.116
-104.144.210.120
-104.144.210.56
  104.144.210.8
  104.144.213.104
  104.144.213.105
  104.144.213.117
  104.144.215.74
  104.144.22.135
-104.144.22.142
-104.144.22.148
  104.144.22.184
  104.144.22.209
  104.144.22.251
@@ -7752,26 +7362,23 @@
  104.144.236.48
  104.144.248.217
  104.144.249.72
-104.144.249.90
  104.144.28.148
  104.144.28.155
  104.144.28.156
  104.144.28.185
-104.144.52.211
  104.144.53.209
  104.144.53.222
  104.144.53.237
  104.144.6.159
  104.144.71.114
+104.144.83.106
  104.144.83.115
  104.144.83.146
  104.144.83.16
  104.144.83.30
-104.144.83.41
  104.144.83.45
  104.144.89.139
  104.144.91.54
-104.145.100.186
  104.145.225.68
  104.145.225.69
  104.145.225.70
@@ -7837,12 +7444,10 @@
  104.149.148.229
  104.149.213.18
  104.149.50.108
-104.15.213.107
  104.151.127.13
  104.152.168.29
  104.152.187.114
  104.152.191.110
-104.152.209.11
  104.152.52.18
  104.152.52.22
  104.152.52.23
@@ -7861,23 +7466,21 @@
  104.152.52.37
  104.152.52.38
  104.152.52.39
-104.152.59.124
+104.152.52.8
+104.152.58.217
  104.152.59.155
  104.152.59.232
  104.153.101.197
  104.153.102.152
  104.153.105.98
-104.153.96.154
  104.154.147.52
  104.154.156.5
  104.154.160.251
-104.154.203.176
  104.154.203.62
  104.154.21.76
  104.154.236.234
  104.154.237.177
  104.154.238.114
-104.154.239.199
  104.154.239.64
  104.154.243.195
  104.154.245.218
@@ -7907,7 +7510,6 @@
  104.155.213.192
  104.155.213.9
  104.155.214.251
-104.155.215.32
  104.155.217.160
  104.155.225.130
  104.155.227.128
@@ -7927,20 +7529,20 @@
  104.157.103.6
  104.157.12.31
  104.157.61.95
+104.158.160.173
  104.158.198.141
  104.158.231.22
-104.158.244.29
  104.158.35.42
  104.159.28.244
  104.160.1.17
  104.160.1.179
-104.160.1.45
+104.160.11.219
  104.160.14.135
  104.160.14.14
+104.160.14.172
  104.160.14.181
  104.160.14.95
  104.160.185.227
-104.160.34.166
  104.160.44.80
  104.160.48.81
  104.160.8.121
@@ -7949,15 +7551,11 @@
  104.160.8.96
  104.161.21.53
  104.162.132.58
-104.162.177.27
  104.162.213.245
-104.162.226.38
-104.163.159.152
  104.163.160.252
  104.163.204.204
  104.166.89.122
  104.167.0.4
-104.167.102.69
  104.167.114.241
  104.167.12.146
  104.167.2.39
@@ -7969,8 +7567,8 @@
  104.168.125.136
  104.168.135.4
  104.168.136.8
+104.168.14.17
  104.168.140.240
-104.168.142.68
  104.168.145.67
  104.168.152.158
  104.168.153.200
@@ -8007,11 +7605,9 @@
  104.168.25.183
  104.168.253.120
  104.168.28.149
-104.168.28.195
  104.168.29.252
  104.168.30.147
  104.168.30.156
-104.168.4.203
  104.168.44.166
  104.168.44.191
  104.168.51.129
@@ -8021,7 +7617,6 @@
  104.168.53.157
  104.168.53.170
  104.168.53.213
-104.168.6.174
  104.168.65.162
  104.168.71.183
  104.168.82.51
@@ -8039,7 +7634,6 @@
  104.171.123.118
  104.171.172.246
  104.171.242.155
-104.171.250.233
  104.172.138.77
  104.172.59.225
  104.174.225.54
@@ -8050,11 +7644,9 @@
  104.177.64.122
  104.178.56.243
  104.180.54.90
-104.181.81.16
  104.183.197.177
  104.187.106.108
  104.187.161.81
-104.190.140.166
  104.192.0.18
  104.192.0.226
  104.192.103.3
@@ -8068,6 +7660,7 @@
  104.192.74.40
  104.192.74.41
  104.192.74.44
+104.193.173.216
  104.193.232.46
  104.193.252.207
  104.193.252.208
@@ -8120,13 +7713,13 @@
  104.197.106.235
  104.197.107.77
  104.197.113.132
+104.197.115.240
  104.197.126.15
  104.197.130.39
  104.197.134.78
  104.197.139.104
  104.197.173.169
  104.197.181.70
-104.197.197.221
  104.197.20.225
  104.197.216.242
  104.197.217.206
@@ -8134,6 +7727,7 @@
  104.197.225.182
  104.197.233.206
  104.197.238.50
+104.197.251.230
  104.197.27.37
  104.197.4.136
  104.197.50.221
@@ -8141,7 +7735,6 @@
  104.197.81.202
  104.197.97.113
  104.198.0.236
-104.198.100.105
  104.198.100.152
  104.198.102.123
  104.198.103.240
@@ -8156,7 +7749,6 @@
  104.198.163.89
  104.198.170.193
  104.198.172.68
-104.198.176.196
  104.198.19.60
  104.198.192.174
  104.198.200.69
@@ -8164,13 +7756,13 @@
  104.198.216.178
  104.198.220.180
  104.198.227.140
-104.198.228.2
  104.198.232.15
  104.198.232.252
  104.198.248.51
  104.198.34.42
  104.198.43.97
  104.198.48.56
+104.198.56.73
  104.198.63.244
  104.198.66.10
  104.198.76.130
@@ -8219,7 +7811,6 @@
  104.200.20.133
  104.200.20.46
  104.200.21.61
-104.200.25.118
  104.200.29.181
  104.200.29.197
  104.200.31.213
@@ -8235,15 +7826,16 @@
  104.205.176.87
  104.205.227.69
  104.206.119.134
+104.206.119.137
  104.206.119.149
  104.206.119.163
-104.206.119.177
-104.206.119.178
  104.206.119.186
-104.206.119.195
-104.206.119.208
+104.206.119.206
  104.206.119.220
+104.206.119.223
+104.206.119.232
  104.206.119.241
+104.206.119.248
  104.206.128.10
  104.206.128.14
  104.206.128.18
@@ -8264,7 +7856,7 @@
  104.206.128.70
  104.206.128.74
  104.206.128.78
-104.206.223.122
+104.206.182.31
  104.206.252.71
  104.206.81.132
  104.206.81.133
@@ -8294,13 +7886,12 @@
  104.208.32.156
  104.208.38.202
  104.209.151.115
-104.209.161.96
+104.209.182.130
  104.209.183.160
  104.209.248.48
  104.209.251.148
  104.209.34.100
  104.210.213.35
-104.210.214.89
  104.210.215.208
  104.210.223.139
  104.210.40.19
@@ -8311,19 +7902,14 @@
  104.211.16.26
  104.211.18.235
  104.211.183.247
-104.211.207.91
-104.211.213.59
-104.211.216.173
  104.211.227.138
  104.211.230.17
-104.211.246.25
  104.211.27.49
  104.211.28.157
  104.211.29.53
  104.211.49.188
-104.211.67.143
+104.211.8.174
  104.211.8.210
-104.214.116.45
  104.214.145.245
  104.214.148.138
  104.214.234.237
@@ -8332,9 +7918,7 @@
  104.214.51.98
  104.214.54.66
  104.214.59.120
-104.214.61.177
  104.214.69.26
-104.214.98.145
  104.215.124.156
  104.215.15.26
  104.215.151.21
@@ -8345,17 +7929,13 @@
  104.215.22.114
  104.215.49.64
  104.215.5.88
-104.215.57.49
  104.215.73.23
-104.215.75.0
-104.215.84.159
  104.217.252.25
  104.217.253.76
  104.218.136.190
  104.218.48.11
  104.218.63.119
  104.219.158.68
-104.219.248.110
  104.219.250.36
  104.219.52.201
  104.219.52.253
@@ -8363,25 +7943,18 @@
  104.220.168.124
  104.220.195.245
  104.220.211.171
-104.220.219.233
  104.220.36.195
  104.222.96.61
-104.223.105.180
  104.223.114.36
  104.223.123.98
  104.223.124.234
  104.223.143.150
-104.223.143.205
  104.223.143.234
  104.223.153.205
-104.223.153.250
-104.223.153.34
  104.223.17.18
  104.223.170.68
  104.223.170.93
  104.223.197.140
-104.223.197.142
-104.223.197.148
  104.223.197.227
  104.223.224.190
  104.223.225.56
@@ -8396,7 +7969,7 @@
  104.223.32.220
  104.223.33.30
  104.223.38.83
-104.223.57.194
+104.223.42.74
  104.223.79.124
  104.223.79.91
  104.224.139.137
@@ -8415,17 +7988,14 @@
  104.224.183.154
  104.224.187.120
  104.224.191.210
-104.224.199.234
  104.225.141.208
  104.225.145.53
  104.225.147.180
  104.225.153.190
  104.225.153.191
  104.225.154.136
-104.225.154.247
  104.225.158.162
  104.225.233.10
-104.225.238.37
  104.225.251.29
  104.226.31.66
  104.226.31.67
@@ -8435,40 +8005,35 @@
  104.227.116.215
  104.227.116.231
  104.227.121.107
+104.227.121.27
  104.227.121.41
-104.227.124.211
  104.227.124.212
  104.227.124.221
-104.227.124.223
  104.227.162.105
  104.227.168.130
  104.227.169.9
  104.227.173.123
  104.227.173.9
  104.227.175.34
-104.227.179.120
+104.227.179.110
  104.227.187.166
  104.227.20.21
  104.227.204.71
  104.227.204.77
  104.227.204.85
  104.227.205.12
+104.227.254.131
  104.227.4.203
  104.227.4.206
-104.227.4.234
  104.227.49.253
  104.227.54.139
-104.227.60.191
  104.227.77.181
-104.227.77.185
+104.227.77.182
  104.227.77.188
-104.227.77.220
  104.227.77.235
-104.227.88.50
  104.227.88.61
  104.227.90.76
  104.228.72.171
-104.229.203.202
  104.232.103.226
  104.232.116.94
  104.233.101.96
@@ -8493,25 +8058,20 @@
  104.236.112.177
  104.236.112.52
  104.236.114.23
-104.236.115.72
  104.236.116.168
  104.236.117.221
  104.236.118.20
  104.236.121.248
  104.236.122.229
  104.236.124.45
-104.236.125.98
  104.236.127.247
  104.236.130.131
  104.236.130.51
-104.236.134.112
  104.236.137.72
  104.236.139.208
  104.236.139.39
  104.236.14.182
-104.236.142.200
  104.236.142.204
-104.236.142.89
  104.236.147.141
  104.236.148.48
  104.236.151.120
@@ -8522,12 +8082,9 @@
  104.236.169.47
  104.236.169.64
  104.236.175.103
-104.236.175.127
  104.236.176.218
-104.236.179.140
  104.236.18.208
  104.236.180.86
-104.236.182.15
  104.236.182.223
  104.236.183.129
  104.236.184.25
@@ -8563,7 +8120,6 @@
  104.236.218.248
  104.236.219.174
  104.236.219.199
-104.236.22.133
  104.236.22.93
  104.236.220.165
  104.236.220.170
@@ -8571,11 +8127,9 @@
  104.236.221.118
  104.236.224.26
  104.236.224.69
-104.236.226.93
  104.236.228.230
  104.236.228.46
  104.236.229.60
-104.236.230.165
  104.236.230.184
  104.236.234.24
  104.236.236.216
@@ -8594,8 +8148,6 @@
  104.236.247.64
  104.236.25.143
  104.236.25.189
-104.236.250.155
-104.236.250.88
  104.236.251.157
  104.236.252.176
  104.236.253.54
@@ -8683,10 +8235,8 @@
  104.238.129.228
  104.238.131.42
  104.238.133.128
-104.238.138.181
  104.238.144.225
  104.238.144.62
-104.238.144.96
  104.238.145.74
  104.238.148.175
  104.238.149.217
@@ -8694,7 +8244,6 @@
  104.238.158.30
  104.238.162.80
  104.238.169.85
-104.238.170.40
  104.238.173.60
  104.238.174.93
  104.238.179.190
@@ -8711,13 +8260,13 @@
  104.238.220.24
  104.238.223.126
  104.238.235.186
+104.238.44.124
  104.238.46.28
  104.238.59.125
  104.238.59.131
  104.238.80.237
  104.238.83.242
  104.238.97.215
-104.239.146.73
  104.239.149.183
  104.239.163.85
  104.239.164.100
@@ -8755,7 +8304,6 @@
  104.244.73.183
  104.244.73.193
  104.244.73.220
-104.244.73.251
  104.244.73.43
  104.244.73.54
  104.244.73.93
@@ -8805,17 +8353,12 @@
  104.248.114.67
  104.248.115.109
  104.248.116.140
-104.248.117.234
-104.248.121.165
  104.248.121.185
  104.248.121.227
  104.248.122.140
-104.248.122.143
-104.248.122.148
  104.248.123.197
  104.248.124.109
  104.248.126.166
-104.248.126.170
  104.248.129.91
  104.248.13.184
  104.248.13.190
@@ -8825,12 +8368,10 @@
  104.248.131.113
  104.248.133.62
  104.248.134.104
-104.248.134.212
  104.248.136.155
  104.248.136.82
  104.248.137.80
  104.248.138.120
-104.248.138.24
  104.248.139.211
  104.248.14.45
  104.248.14.71
@@ -8840,9 +8381,9 @@
  104.248.144.147
  104.248.144.16
  104.248.145.254
-104.248.145.34
  104.248.145.47
  104.248.145.89
+104.248.146.21
  104.248.146.211
  104.248.146.226
  104.248.146.253
@@ -8853,7 +8394,6 @@
  104.248.149.130
  104.248.149.132
  104.248.151.229
-104.248.153.158
  104.248.154.162
  104.248.154.84
  104.248.155.249
@@ -8865,27 +8405,22 @@
  104.248.159.69
  104.248.16.234
  104.248.16.27
-104.248.16.41
  104.248.160.118
  104.248.160.58
  104.248.161.191
  104.248.163.35
  104.248.164.20
  104.248.165.25
-104.248.166.221
-104.248.167.176
  104.248.169.127
  104.248.169.128
  104.248.169.152
-104.248.170.186
  104.248.170.40
+104.248.172.238
  104.248.176.46
  104.248.181.156
-104.248.182.179
  104.248.183.240
  104.248.183.73
  104.248.186.42
-104.248.187.165
  104.248.19.228
  104.248.191.247
  104.248.2.150
@@ -8897,13 +8432,10 @@
  104.248.206.51
  104.248.208.227
  104.248.208.33
-104.248.209.204
  104.248.21.247
  104.248.216.15
  104.248.216.243
  104.248.218.189
-104.248.219.203
-104.248.22.27
  104.248.22.82
  104.248.226.148
  104.248.226.215
@@ -8916,20 +8448,15 @@
  104.248.231.46
  104.248.232.39
  104.248.233.157
-104.248.233.190
  104.248.233.34
-104.248.235.55
  104.248.236.112
  104.248.236.250
-104.248.237.70
  104.248.238.116
  104.248.238.198
  104.248.24.107
-104.248.24.208
  104.248.241.234
  104.248.244.119
  104.248.245.250
-104.248.246.4
  104.248.247.55
  104.248.251.117
  104.248.251.126
@@ -8942,7 +8469,6 @@
  104.248.38.48
  104.248.38.5
  104.248.39.81
-104.248.41.56
  104.248.44.26
  104.248.45.204
  104.248.48.161
@@ -8961,10 +8487,8 @@
  104.248.5.131
  104.248.50.207
  104.248.52.119
-104.248.52.211
  104.248.53.72
  104.248.55.129
-104.248.56.150
  104.248.56.243
  104.248.57.27
  104.248.59.156
@@ -8979,7 +8503,6 @@
  104.248.63.49
  104.248.65.129
  104.248.65.141
-104.248.66.115
  104.248.70.191
  104.248.71.34
  104.248.71.7
@@ -8991,6 +8514,7 @@
  104.248.81.158
  104.248.82.153
  104.248.84.36
+104.248.84.82
  104.248.88.112
  104.248.88.127
  104.248.89.7
@@ -8999,7 +8523,6 @@
  104.248.90.77
  104.248.93.66
  104.248.94.133
-104.248.94.159
  104.248.94.217
  104.250.102.143
  104.250.102.145
@@ -9053,14 +8576,12 @@
  104.250.98.53
  104.250.98.58
  104.250.98.59
-104.251.231.208
  104.251.236.153
  104.251.241.150
  104.252.222.149
  104.252.222.150
  104.254.244.100
  104.254.247.111
-104.254.90.235
  104.255.173.24
  104.255.65.207
  104.255.78.89
@@ -9068,11 +8589,11 @@
  104.31.85.69
  104.32.136.154
  104.32.43.13
-104.33.72.125
  104.34.111.22
  104.34.113.196
  104.34.205.25
  104.35.13.161
+104.35.218.177
  104.36.182.197
  104.36.71.132
  104.37.104.44
@@ -9083,7 +8604,6 @@
  104.37.47.8
  104.40.159.206
  104.40.197.65
-104.40.217.239
  104.40.222.165
  104.40.31.157
  104.40.57.109
@@ -9097,17 +8617,13 @@
  104.41.203.153
  104.41.205.252
  104.41.229.205
-104.41.3.236
-104.41.34.36
  104.41.42.167
-104.41.43.241
  104.41.52.218
  104.41.55.49
  104.41.57.96
  104.41.60.236
  104.42.48.216
  104.42.48.29
-104.42.76.121
  104.43.128.168
  104.43.133.226
  104.43.134.109
@@ -9127,21 +8643,17 @@
  104.45.186.203
  104.45.212.9
  104.45.41.45
-104.45.42.142
  104.45.6.203
-104.45.88.60
  104.46.116.201
  104.46.15.169
  104.46.227.151
  104.46.229.249
  104.46.234.52
  104.46.32.152
-104.46.36.244
  104.47.145.50
  104.47.147.196
  104.47.152.29
  104.47.167.206
-104.48.40.165
  104.50.144.110
  104.50.180.85
  104.50.201.209
@@ -9161,15 +8673,15 @@
  104.9.30.99
  1041469-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  104722155613106546.002.sh.cn
+105.101.3.229
  105.101.86.13
  105.103.160.197
  105.105.162.145
+105.107.34.131
  105.107.36.211
-105.107.81.2
  105.108.115.4
-105.110.170.76
-105.110.247.68
  105.112.10.244
+105.112.104.182
  105.112.121.63
  105.112.91.234
  105.139.82.89
@@ -9178,43 +8690,39 @@
  105.153.213.166
  105.154.151.250
  105.155.159.11
-105.155.161.10
  105.155.254.142
-105.156.193.56
+105.156.181.224
  105.158.91.157
  105.159.149.193
  105.159.205.19
  105.159.253.46
-105.159.40.35
  105.163.104.117
  105.163.171.179
  105.163.182.191
  105.174.38.250
  105.174.4.110
  105.184.19.206
-105.184.44.11
-105.185.152.173
+105.186.143.69
  105.186.99.148
  105.189.37.21
  105.208.44.183
  105.209.235.113
-105.21.33.2
  105.21.40.54
  105.212.115.3
  105.212.56.107
  105.213.103.27
  105.213.106.234
+105.213.113.37
  105.213.117.151
-105.213.120.142
  105.213.122.51
  105.225.107.181
-105.225.175.34
+105.225.121.36
  105.225.178.209
-105.225.244.115
  105.226.188.16
  105.226.97.18
  105.229.20.225
  105.229.22.206
+105.233.226.138
  105.233.34.9
  105.233.82.86
  105.234.154.230
@@ -9237,7 +8745,7 @@
  105.247.67.115
  105.255.193.185
  105.255.222.42
-105.27.116.46
+105.27.116.98
  105.27.143.190
  105.27.152.206
  105.27.155.182
@@ -9249,21 +8757,23 @@
  105.29.64.195
  105.29.67.20
  105.66.10.10
+105.67.1.230
  105.67.128.143
+105.67.5.14
  105.96.106.11
  105.96.109.13
  105.96.11.148
  105.96.11.65
  105.96.111.37
  105.96.26.111
-105.96.80.218
  1051a2e8-48cf-4f98-988c-b1aa7ec7e290.htmlcomponentservice.com
  1052068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  106-365.net
  106.0.4.31
  106.0.5.140
  106.0.5.69
-106.0.58.147
+106.0.56.176
+106.0.58.158
  106.0.6.236
  106.0.6.240
  106.0.6.33
@@ -9295,7 +8805,6 @@
  106.1.49.106
  106.1.50.182
  106.1.77.204
-106.1.81.24
  106.1.88.245
  106.1.89.22
  106.1.92.202
@@ -9309,7 +8818,6 @@
  106.104.134.174
  106.104.140.226
  106.104.151.142
-106.104.160.223
  106.104.163.13
  106.104.169.217
  106.104.169.249
@@ -9351,6 +8859,7 @@
  106.107.237.151
  106.109.112.zoom-lab.com
  106.110.104.29
+106.110.104.78
  106.110.105.60
  106.110.106.250
  106.110.107.114
@@ -9379,14 +8888,13 @@
  106.110.79.230
  106.110.88.210
  106.110.92.203
+106.110.92.87
  106.110.93.140
  106.110.93.16
  106.110.94.54
  106.110.94.77
-106.110.94.9
  106.111.155.239
  106.111.166.128
-106.111.169.103
  106.111.202.226
  106.111.224.174
  106.111.38.110
@@ -9412,13 +8920,11 @@
  106.115.121.229
  106.115.125.37
  106.115.190.214
-106.116.118.89
  106.116.118.90
  106.116.209.80
  106.116.98.137
  106.116.99.111
  106.117.207.186
-106.117.236.81
  106.117.236.82
  106.117.239.135
  106.117.239.19
@@ -9426,82 +8932,55 @@
  106.12.10.21
  106.12.10.72
  106.12.10.8
-106.12.100.184
-106.12.100.206
-106.12.100.73
  106.12.102.210
  106.12.102.54
  106.12.105.130
  106.12.105.161
  106.12.106.140
  106.12.106.221
-106.12.106.232
  106.12.106.34
  106.12.107.61
  106.12.108.170
  106.12.109.165
-106.12.109.33
  106.12.11.245
-106.12.110.157
  106.12.110.2
  106.12.111.189
  106.12.111.201
  106.12.112.120
  106.12.112.236
  106.12.112.49
-106.12.112.62
  106.12.113.111
  106.12.113.155
  106.12.113.204
  106.12.113.223
-106.12.113.27
  106.12.114.101
-106.12.114.48
-106.12.115.110
  106.12.115.169
  106.12.116.75
-106.12.117.248
  106.12.119.1
-106.12.119.218
-106.12.12.127
  106.12.12.242
-106.12.120.19
-106.12.120.207
  106.12.121.148
-106.12.121.179
  106.12.122.138
  106.12.123.239
  106.12.123.48
-106.12.123.82
-106.12.125.241
-106.12.125.38
  106.12.126.114
  106.12.127.136
  106.12.13.185
  106.12.130.189
  106.12.131.102
-106.12.131.36
  106.12.132.224
  106.12.133.103
  106.12.133.225
  106.12.133.38
  106.12.134.187
  106.12.136.154
-106.12.138.72
  106.12.14.130
  106.12.14.183
  106.12.140.168
-106.12.140.211
-106.12.140.232
-106.12.141.112
-106.12.141.212
  106.12.142.123
  106.12.143.215
-106.12.144.219
  106.12.144.57
  106.12.146.9
  106.12.147.216
-106.12.147.79
  106.12.148.170
  106.12.148.201
  106.12.148.74
@@ -9511,39 +8990,25 @@
  106.12.149.27
  106.12.15.56
  106.12.150.36
-106.12.151.250
  106.12.153.107
  106.12.153.161
  106.12.153.211
  106.12.154.24
-106.12.155.17
  106.12.155.254
-106.12.156.160
-106.12.156.236
-106.12.157.10
-106.12.157.243
  106.12.158.11
  106.12.159.112
  106.12.159.138
-106.12.159.7
  106.12.16.149
  106.12.16.2
-106.12.160.103
-106.12.160.220
  106.12.161.86
-106.12.161.99
-106.12.162.201
  106.12.162.234
  106.12.163.87
  106.12.165.253
  106.12.165.53
-106.12.166.166
  106.12.166.167
  106.12.166.201
  106.12.166.209
-106.12.168.88
  106.12.17.214
-106.12.171.188
  106.12.171.253
  106.12.171.31
  106.12.171.65
@@ -9560,47 +9025,26 @@
  106.12.175.38
  106.12.175.86
  106.12.176.2
-106.12.176.53
  106.12.178.228
-106.12.178.245
-106.12.178.246
-106.12.179.191
-106.12.179.35
  106.12.18.125
-106.12.18.168
  106.12.18.219
  106.12.180.136
  106.12.181.144
-106.12.181.184
  106.12.182.38
  106.12.183.209
-106.12.183.239
-106.12.183.6
  106.12.185.102
-106.12.185.161
  106.12.185.18
-106.12.185.50
-106.12.185.54
  106.12.186.130
  106.12.186.74
-106.12.189.197
-106.12.189.2
-106.12.189.89
-106.12.190.104
-106.12.190.177
  106.12.190.254
  106.12.190.49
  106.12.192.204
  106.12.192.91
  106.12.193.217
-106.12.193.96
  106.12.194.204
  106.12.194.26
  106.12.195.70
-106.12.195.99
  106.12.196.118
-106.12.196.237
-106.12.197.165
  106.12.197.52
  106.12.198.236
  106.12.199.117
@@ -9609,40 +9053,32 @@
  106.12.2.81
  106.12.20.113
  106.12.20.15
-106.12.20.192
  106.12.20.195
  106.12.20.251
-106.12.20.3
  106.12.200.239
  106.12.201.16
  106.12.201.95
  106.12.202.119
  106.12.202.180
-106.12.202.192
  106.12.204.25
  106.12.204.81
  106.12.205.137
  106.12.205.237
  106.12.205.55
  106.12.206.3
-106.12.207.197
  106.12.207.236
  106.12.207.92
  106.12.208.141
  106.12.208.211
-106.12.208.31
  106.12.209.57
  106.12.209.81
-106.12.21.124
  106.12.210.115
  106.12.210.127
  106.12.210.166
  106.12.211.254
  106.12.212.89
  106.12.214.128
-106.12.215.118
  106.12.215.238
-106.12.215.244
  106.12.217.122
  106.12.217.128
  106.12.217.176
@@ -9652,19 +9088,14 @@
  106.12.218.202
  106.12.218.31
  106.12.219.184
-106.12.219.231
  106.12.22.208
  106.12.220.109
-106.12.220.19
  106.12.220.251
  106.12.220.84
  106.12.221.83
-106.12.221.86
  106.12.222.209
-106.12.222.60
  106.12.23.44
  106.12.24.182
-106.12.24.193
  106.12.24.225
  106.12.242.19
  106.12.242.97
@@ -9672,14 +9103,10 @@
  106.12.25.96
  106.12.252.122
  106.12.254.9
-106.12.26.101
  106.12.26.131
-106.12.26.156
  106.12.26.160
  106.12.26.167
  106.12.26.237
-106.12.27.213
-106.12.28.124
  106.12.28.152
  106.12.28.157
  106.12.29.204
@@ -9690,7 +9117,6 @@
  106.12.31.186
  106.12.33.134
  106.12.33.174
-106.12.33.181
  106.12.33.195
  106.12.33.28
  106.12.33.78
@@ -9701,9 +9127,7 @@
  106.12.36.90
  106.12.37.20
  106.12.37.38
-106.12.38.105
  106.12.38.109
-106.12.38.114
  106.12.38.231
  106.12.4.158
  106.12.40.74
@@ -9712,62 +9136,39 @@
  106.12.43.54
  106.12.45.110
  106.12.45.214
-106.12.45.30
-106.12.45.32
  106.12.46.179
  106.12.46.229
-106.12.46.23
  106.12.47.108
-106.12.47.24
-106.12.48.78
-106.12.49.118
  106.12.5.13
  106.12.5.168
  106.12.5.190
-106.12.5.196
  106.12.5.48
  106.12.51.110
  106.12.52.154
  106.12.52.34
-106.12.52.59
-106.12.52.75
  106.12.52.98
-106.12.54.183
-106.12.55.112
-106.12.55.131
  106.12.55.170
-106.12.55.39
  106.12.55.57
-106.12.55.87
  106.12.56.126
-106.12.56.136
-106.12.56.143
  106.12.56.41
  106.12.56.84
  106.12.57.149
  106.12.57.165
  106.12.59.23
-106.12.59.49
-106.12.6.195
-106.12.6.55
+106.12.6.122
  106.12.60.40
-106.12.60.66
-106.12.61.64
  106.12.68.150
  106.12.68.197
  106.12.68.244
  106.12.69.156
  106.12.69.250
-106.12.69.35
  106.12.69.53
  106.12.69.68
  106.12.69.90
  106.12.69.94
-106.12.7.100
  106.12.7.40
  106.12.7.86
  106.12.70.112
-106.12.70.115
  106.12.70.118
  106.12.70.186
  106.12.70.99
@@ -9776,15 +9177,12 @@
  106.12.71.193
  106.12.71.84
  106.12.72.135
-106.12.73.128
  106.12.73.198
  106.12.73.204
-106.12.74.141
  106.12.74.23
  106.12.74.99
  106.12.76.35
  106.12.77.182
-106.12.77.183
  106.12.77.212
  106.12.77.32
  106.12.77.50
@@ -9793,13 +9191,11 @@
  106.12.79.84
  106.12.8.125
  106.12.8.149
-106.12.8.205
  106.12.80.246
  106.12.82.22
  106.12.82.242
  106.12.82.80
  106.12.82.89
-106.12.83.146
  106.12.83.217
  106.12.83.53
  106.12.84.29
@@ -9808,8 +9204,6 @@
  106.12.84.83
  106.12.85.128
  106.12.85.225
-106.12.86.112
-106.12.86.193
  106.12.86.205
  106.12.86.56
  106.12.87.149
@@ -9821,7 +9215,6 @@
  106.12.88.95
  106.12.89.154
  106.12.89.173
-106.12.89.184
  106.12.89.206
  106.12.90.29
  106.12.90.45
@@ -9831,7 +9224,6 @@
  106.12.91.225
  106.12.91.36
  106.12.92.246
-106.12.93.141
  106.12.93.25
  106.12.93.251
  106.12.93.253
@@ -9841,12 +9233,7 @@
  106.12.95.45
  106.12.96.23
  106.12.96.91
-106.12.97.132
  106.12.97.46
-106.12.97.53
-106.12.97.78
-106.12.98.182
-106.12.99.204
  106.120.198.90
  106.120.221.78
  106.120.75.98
@@ -9866,31 +9253,21 @@
  106.124.137.130
  106.124.139.161
  106.124.140.36
-106.124.141.108
  106.124.141.229
  106.124.142.64
  106.124.143.24
  106.124.188.160
  106.124.205.42
  106.124.47.136
-106.124.91.192
  106.124.93.69
  106.125.139.76
  106.127.184.14
-106.13.1.245
  106.13.10.242
-106.13.10.37
-106.13.100.50
  106.13.101.232
-106.13.102.154
  106.13.102.197
  106.13.104.41
  106.13.104.8
-106.13.105.231
-106.13.105.88
-106.13.107.13
  106.13.107.196
-106.13.11.238
  106.13.112.221
  106.13.112.252
  106.13.113.172
@@ -9898,128 +9275,79 @@
  106.13.115.113
  106.13.115.131
  106.13.115.17
-106.13.116.203
-106.13.118.102
  106.13.118.175
  106.13.119.163
  106.13.119.89
-106.13.120.224
  106.13.123.29
  106.13.123.73
  106.13.125.248
  106.13.125.64
  106.13.126.15
-106.13.126.174
  106.13.128.71
-106.13.129.37
  106.13.130.166
  106.13.131.132
-106.13.132.192
-106.13.134.19
-106.13.136.8
-106.13.137.67
-106.13.137.83
  106.13.138.162
-106.13.138.236
  106.13.138.253
  106.13.139.79
  106.13.140.138
  106.13.140.200
-106.13.140.33
  106.13.142.161
  106.13.142.93
  106.13.144.207
  106.13.144.233
  106.13.145.1
-106.13.147.69
  106.13.147.89
-106.13.148.104
  106.13.148.240
-106.13.149.227
  106.13.149.57
-106.13.15.122
-106.13.160.12
-106.13.160.127
  106.13.160.24
  106.13.160.249
  106.13.160.55
-106.13.161.132
-106.13.161.17
-106.13.161.250
  106.13.163.236
  106.13.164.136
  106.13.164.39
-106.13.164.67
  106.13.165.247
  106.13.165.83
-106.13.166.122
-106.13.166.205
  106.13.166.236
-106.13.166.38
-106.13.167.238
  106.13.167.3
  106.13.167.62
  106.13.167.77
  106.13.168.107
-106.13.168.31
  106.13.168.33
  106.13.168.43
  106.13.169.193
-106.13.17.8
-106.13.171.12
  106.13.171.239
  106.13.172.167
-106.13.173.12
-106.13.173.137
-106.13.173.161
-106.13.173.187
  106.13.173.228
  106.13.173.73
  106.13.174.171
  106.13.175.126
-106.13.175.211
  106.13.175.233
  106.13.176.163
  106.13.176.220
  106.13.177.53
-106.13.178.162
  106.13.178.211
  106.13.179.45
  106.13.18.86
  106.13.180.245
-106.13.181.196
  106.13.181.235
  106.13.181.242
  106.13.182.100
-106.13.182.60
-106.13.183.215
  106.13.183.89
  106.13.184.128
  106.13.184.136
-106.13.184.139
  106.13.184.174
  106.13.184.234
  106.13.184.243
  106.13.184.7
-106.13.186.119
  106.13.186.24
  106.13.187.27
  106.13.188.35
  106.13.189.143
  106.13.189.172
-106.13.19.137
-106.13.19.145
-106.13.19.178
-106.13.19.4
  106.13.19.6
  106.13.19.75
-106.13.190.11
-106.13.190.148
-106.13.190.51
  106.13.190.84
-106.13.191.132
  106.13.191.25
-106.13.192.5
  106.13.194.25
  106.13.194.64
  106.13.195.32
@@ -10029,126 +9357,71 @@
  106.13.198.167
  106.13.199.185
  106.13.199.34
-106.13.199.79
-106.13.2.130
  106.13.20.229
  106.13.20.31
-106.13.20.73
  106.13.200.150
  106.13.201.127
-106.13.201.158
  106.13.201.44
  106.13.201.85
-106.13.202.126
-106.13.203.171
  106.13.203.240
  106.13.203.62
-106.13.204.251
  106.13.206.111
  106.13.206.183
  106.13.207.159
  106.13.207.205
-106.13.207.225
  106.13.207.45
  106.13.209.80
  106.13.212.162
-106.13.213.118
-106.13.213.58
  106.13.213.76
-106.13.215.125
-106.13.215.17
  106.13.215.207
  106.13.215.94
  106.13.216.115
  106.13.217.10
  106.13.218.169
-106.13.219.148
-106.13.219.219
-106.13.22.60
  106.13.221.213
-106.13.222.115
  106.13.222.42
  106.13.223.100
-106.13.223.30
-106.13.224.130
  106.13.225.60
-106.13.226.112
-106.13.226.152
-106.13.226.170
-106.13.226.34
-106.13.227.104
-106.13.227.131
  106.13.227.19
  106.13.228.133
-106.13.228.21
-106.13.228.33
-106.13.228.62
  106.13.229.254
  106.13.229.99
-106.13.23.35
  106.13.230.219
-106.13.230.238
-106.13.230.250
-106.13.230.36
  106.13.231.103
-106.13.231.150
-106.13.231.171
  106.13.231.239
-106.13.232.193
-106.13.232.65
  106.13.232.67
  106.13.232.79
  106.13.233.102
-106.13.233.32
-106.13.233.4
-106.13.233.61
-106.13.234.23
  106.13.234.81
  106.13.235.57
  106.13.236.70
  106.13.236.94
  106.13.237.170
-106.13.237.235
  106.13.238.73
-106.13.239.120
-106.13.24.164
-106.13.24.214
  106.13.24.27
  106.13.25.242
  106.13.26.62
-106.13.26.67
  106.13.27.134
  106.13.27.156
  106.13.27.206
  106.13.27.75
-106.13.28.108
  106.13.29.92
  106.13.3.175
  106.13.3.238
-106.13.30.99
  106.13.31.93
-106.13.32.165
-106.13.32.45
  106.13.34.131
  106.13.34.173
  106.13.35.121
  106.13.35.176
  106.13.35.232
-106.13.35.234
  106.13.35.87
  106.13.36.10
-106.13.36.103
-106.13.36.185
  106.13.36.215
  106.13.37.118
-106.13.37.164
-106.13.37.170
  106.13.37.202
  106.13.37.213
  106.13.37.33
  106.13.38.121
-106.13.38.246
-106.13.39.34
  106.13.39.56
  106.13.4.132
  106.13.4.86
@@ -10157,62 +9430,41 @@
  106.13.41.25
  106.13.41.87
  106.13.42.140
-106.13.44.100
  106.13.44.83
  106.13.45.212
+106.13.45.56
  106.13.46.123
  106.13.47.10
  106.13.47.6
-106.13.47.78
-106.13.48.122
-106.13.48.241
  106.13.48.9
-106.13.49.133
-106.13.50.145
  106.13.50.219
  106.13.52.107
  106.13.52.192
-106.13.52.234
  106.13.52.83
  106.13.53.228
-106.13.54.106
  106.13.56.204
  106.13.56.219
-106.13.56.249
-106.13.57.178
-106.13.58.178
  106.13.58.240
-106.13.59.224
-106.13.6.116
  106.13.6.214
  106.13.6.70
  106.13.60.148
  106.13.60.152
-106.13.60.155
  106.13.60.222
-106.13.60.28
  106.13.60.62
  106.13.61.120
-106.13.61.165
-106.13.61.49
  106.13.63.215
  106.13.65.207
  106.13.65.237
  106.13.66.103
-106.13.68.101
  106.13.68.142
  106.13.68.145
  106.13.68.190
  106.13.69.159
-106.13.69.24
  106.13.70.177
  106.13.70.60
  106.13.70.63
  106.13.71.1
-106.13.72.150
-106.13.72.190
  106.13.73.189
-106.13.73.210
  106.13.73.235
  106.13.73.59
  106.13.74.61
@@ -10220,8 +9472,6 @@
  106.13.75.154
  106.13.75.158
  106.13.75.187
-106.13.75.73
-106.13.75.97
  106.13.77.182
  106.13.78.198
  106.13.78.210
@@ -10229,27 +9479,19 @@
  106.13.8.46
  106.13.80.141
  106.13.80.167
-106.13.80.186
  106.13.80.194
-106.13.81.181
-106.13.81.250
  106.13.82.151
  106.13.82.231
  106.13.82.49
  106.13.83.202
  106.13.84.151
  106.13.85.247
-106.13.86.199
  106.13.86.54
  106.13.87.145
-106.13.87.170
  106.13.88.44
  106.13.89.237
  106.13.9.153
  106.13.90.60
-106.13.90.78
-106.13.92.150
-106.13.93.199
  106.13.93.252
  106.13.93.32
  106.13.93.60
@@ -10258,21 +9500,14 @@
  106.13.94.193
  106.13.95.100
  106.13.96.65
-106.13.97.10
  106.13.97.228
-106.13.98.102
-106.13.98.132
  106.13.99.107
-106.13.99.145
  106.13.99.224
-106.13.99.51
  106.14.1.209
  106.14.135.136
  106.14.142.205
  106.14.188.79
-106.14.194.95
  106.14.199.121
-106.14.21.174
  106.14.211.77
  106.14.224.228
  106.14.241.0
@@ -10282,7 +9517,6 @@
  106.15.197.185
  106.15.231.104
  106.15.34.199
-106.15.35.211
  106.157.214.199
  106.158.113.33
  106.163.158.127
@@ -10298,7 +9532,6 @@
  106.185.31.92
  106.185.36.14
  106.185.48.84
-106.186.107.37
  106.186.112.160
  106.186.122.96
  106.186.30.11
@@ -10317,18 +9550,11 @@
  106.201.233.16
  106.201.238.227
  106.215.125.109
-106.217.86.167
-106.225.129.108
-106.225.130.128
-106.225.152.206
-106.225.155.224
-106.225.211.193
  106.225.211.248
  106.225.219.144
  106.225.228.68
  106.240.0.2
  106.240.131.5
-106.240.234.114
  106.240.24.38
  106.240.61.28
  106.240.86.211
@@ -10339,10 +9565,10 @@
  106.242.35.34
  106.242.87.138
  106.243.144.238
-106.243.2.244
-106.243.87.162
  106.244.127.11
+106.244.227.141
  106.244.233.87
+106.244.28.19
  106.244.77.149
  106.245.146.26
  106.245.183.58
@@ -10356,12 +9582,9 @@
  106.245.95.116
  106.246.158.235
  106.246.224.219
-106.246.250.202
-106.246.92.234
  106.247.13.4
  106.247.232.252
  106.247.237.179
-106.247.251.2
  106.248.143.195
  106.248.143.198
  106.248.68.85
@@ -10377,16 +9600,13 @@
  106.252.164.246
  106.253.177.150
  106.253.252.218
-106.254.255.42
  106.255.120.25
  106.255.222.195
  106.255.248.19
  106.255.253.178
  106.3.129.209
-106.3.130.53
  106.3.136.52
  106.3.196.33
-106.3.196.34
  106.3.227.3
  106.3.38.73
  106.3.40.140
@@ -10414,7 +9634,6 @@
  106.37.239.65
  106.37.239.66
  106.37.240.20
-106.37.72.121
  106.37.72.234
  106.37.74.142
  106.38.0.4
@@ -10428,12 +9647,10 @@
  106.38.20.182
  106.38.205.205
  106.38.3.251
-106.38.33.70
  106.38.53.234
  106.38.62.93
  106.38.70.178
  106.38.99.158
-106.39.15.168
  106.39.16.17
  106.39.16.2
  106.39.21.10
@@ -10444,78 +9661,58 @@
  106.40.149.6
  106.40.149.74
  106.40.150.212
-106.40.151.238
  106.40.188.16
+106.40.82.2
  106.42.40.160
  106.42.45.49
-106.46.124.68
  106.47.251.170
  106.5.159.234
  106.5.74.112
  106.5.93.27
-106.51.113.15
  106.51.139.44
  106.51.16.120
  106.51.164.41
  106.51.18.191
  106.51.2.56
  106.51.227.10
-106.51.230.186
  106.51.234.102
  106.51.255.21
  106.51.3.214
-106.51.36.64
  106.51.48.117
-106.51.50.2
  106.51.63.3
  106.51.73.204
-106.51.76.115
  106.51.78.18
-106.51.78.188
  106.51.79.96
  106.51.80.198
  106.51.81.136
  106.51.85.16
-106.51.85.66
  106.51.96.190
  106.51.98.159
-106.52.102.190
-106.52.104.135
  106.52.105.158
  106.52.105.178
-106.52.106.61
  106.52.107.167
-106.52.107.70
  106.52.107.79
-106.52.107.94
-106.52.114.12
  106.52.114.125
  106.52.115.154
  106.52.115.36
  106.52.119.148
  106.52.12.21
  106.52.122.203
-106.52.124.165
  106.52.128.100
  106.52.130.163
  106.52.130.172
-106.52.131.86
  106.52.132.186
  106.52.133.87
  106.52.135.239
  106.52.135.44
  106.52.135.88
-106.52.137.120
-106.52.137.134
  106.52.139.223
  106.52.140.195
  106.52.141.222
-106.52.141.231
  106.52.141.36
  106.52.141.88
  106.52.145.203
  106.52.146.120
-106.52.150.197
  106.52.150.93
  106.52.150.94
  106.52.152.16
@@ -10531,65 +9728,47 @@
  106.52.177.51
  106.52.178.166
  106.52.179.227
-106.52.179.55
  106.52.181.236
  106.52.181.73
-106.52.188.129
  106.52.188.250
-106.52.188.43
  106.52.196.163
  106.52.197.126
-106.52.198.131
  106.52.199.130
  106.52.2.174
  106.52.2.22
  106.52.20.112
  106.52.203.17
  106.52.209.36
-106.52.210.138
  106.52.210.175
  106.52.210.90
-106.52.212.117
  106.52.217.57
-106.52.220.147
+106.52.22.130
  106.52.222.11
  106.52.23.108
  106.52.231.125
  106.52.231.46
-106.52.234.191
  106.52.235.246
  106.52.236.23
-106.52.24.215
-106.52.240.160
  106.52.243.17
  106.52.244.128
  106.52.244.46
  106.52.249.134
  106.52.251.114
-106.52.251.24
  106.52.251.30
  106.52.26.50
  106.52.28.75
-106.52.32.84
  106.52.33.247
  106.52.33.78
-106.52.36.19
-106.52.42.153
  106.52.42.23
  106.52.43.123
-106.52.44.85
-106.52.48.179
-106.52.5.114
  106.52.50.225
  106.52.51.73
  106.52.52.50
  106.52.55.146
  106.52.56.193
  106.52.56.26
-106.52.58.235
  106.52.59.141
  106.52.6.77
-106.52.6.92
  106.52.64.125
  106.52.66.171
  106.52.68.43
@@ -10597,21 +9776,16 @@
  106.52.69.233
  106.52.71.148
  106.52.72.214
-106.52.80.21
  106.52.82.200
-106.52.84.117
-106.52.88.211
+106.52.86.172
  106.52.89.135
  106.52.9.154
  106.52.90.63
  106.52.92.220
  106.52.96.247
  106.52.98.89
-106.53.102.196
  106.53.103.194
-106.53.104.169
  106.53.105.168
-106.53.105.59
  106.53.108.16
  106.53.110.251
  106.53.112.52
@@ -10621,7 +9795,6 @@
  106.53.117.149
  106.53.117.74
  106.53.119.143
-106.53.12.243
  106.53.125.253
  106.53.125.98
  106.53.127.49
@@ -10633,19 +9806,14 @@
  106.53.2.93
  106.53.20.166
  106.53.20.179
-106.53.20.226
  106.53.202.195
  106.53.202.86
  106.53.207.227
  106.53.210.12
-106.53.219.82
-106.53.220.103
-106.53.220.175
  106.53.220.198
  106.53.223.127
  106.53.223.71
  106.53.226.224
-106.53.231.26
  106.53.232.157
  106.53.232.163
  106.53.232.38
@@ -10656,116 +9824,75 @@
  106.53.237.190
  106.53.238.111
  106.53.238.15
-106.53.238.97
  106.53.239.130
  106.53.239.195
  106.53.239.28
-106.53.240.190
  106.53.241.29
  106.53.249.204
  106.53.249.98
  106.53.253.248
-106.53.253.82
  106.53.26.197
  106.53.27.166
-106.53.28.5
  106.53.40.211
  106.53.5.85
  106.53.53.209
  106.53.55.105
+106.53.55.209
  106.53.55.86
  106.53.61.167
  106.53.62.73
-106.53.63.248
-106.53.66.103
-106.53.68.194
  106.53.70.152
  106.53.74.231
-106.53.74.246
-106.53.75.42
-106.53.81.17
  106.53.84.238
-106.53.85.121
  106.53.88.144
-106.53.89.104
  106.53.9.137
  106.53.9.163
  106.53.92.85
  106.53.93.44
-106.53.94.190
  106.53.96.123
  106.53.97.54
  106.54.1.58
  106.54.101.141
  106.54.105.9
  106.54.108.8
-106.54.109.98
-106.54.11.39
-106.54.110.44
  106.54.111.75
  106.54.112.173
-106.54.114.208
-106.54.114.248
  106.54.117.51
  106.54.121.152
-106.54.123.84
  106.54.126.152
-106.54.127.159
-106.54.127.78
-106.54.128.79
  106.54.129.69
  106.54.137.199
  106.54.139.117
-106.54.14.42
  106.54.140.165
  106.54.141.196
-106.54.141.45
-106.54.141.65
  106.54.144.22
-106.54.145.68
-106.54.155.35
-106.54.16.96
  106.54.163.106
-106.54.163.178
-106.54.164.208
  106.54.166.168
  106.54.166.187
  106.54.167.195
  106.54.170.28
  106.54.171.167
-106.54.173.220
  106.54.173.254
  106.54.174.38
  106.54.182.137
  106.54.182.161
-106.54.182.239
  106.54.183.246
  106.54.184.153
  106.54.184.192
-106.54.187.21
  106.54.189.18
  106.54.189.241
  106.54.189.93
-106.54.19.67
-106.54.190.20
  106.54.191.247
  106.54.194.35
  106.54.194.77
-106.54.197.97
  106.54.20.184
-106.54.200.209
-106.54.200.22
  106.54.201.240
  106.54.202.131
-106.54.203.54
  106.54.205.236
  106.54.206.184
-106.54.208.123
  106.54.217.12
  106.54.219.237
-106.54.22.172
  106.54.222.51
-106.54.224.208
  106.54.224.217
  106.54.227.32
  106.54.229.142
@@ -10773,39 +9900,27 @@
  106.54.236.220
  106.54.236.226
  106.54.238.208
-106.54.240.169
-106.54.242.239
  106.54.243.65
  106.54.245.12
  106.54.247.167
-106.54.251.179
  106.54.253.152
  106.54.253.41
  106.54.253.9
-106.54.255.11
  106.54.255.2
-106.54.3.80
  106.54.40.151
  106.54.44.202
-106.54.45.175
  106.54.47.12
-106.54.47.171
  106.54.48.130
  106.54.48.208
-106.54.48.241
-106.54.50.236
  106.54.50.55
-106.54.51.77
  106.54.52.141
  106.54.52.35
  106.54.56.45
-106.54.57.113
  106.54.57.203
  106.54.62.168
  106.54.64.77
  106.54.65.139
  106.54.65.144
-106.54.66.122
  106.54.67.233
  106.54.68.180
  106.54.72.123
@@ -10814,21 +9929,17 @@
  106.54.77.171
  106.54.78.101
  106.54.79.212
-106.54.80.173
-106.54.81.57
  106.54.82.69
-106.54.83.45
  106.54.84.191
  106.54.86.190
-106.54.86.217
  106.54.87.169
  106.54.89.231
-106.54.9.63
  106.54.90.60
  106.54.92.106
  106.54.92.214
  106.54.93.182
  106.54.93.30
+106.54.94.237
  106.54.94.58
  106.54.96.129
  106.54.97.87
@@ -10853,20 +9964,17 @@
  106.55.161.202
  106.55.161.22
  106.55.162.86
-106.55.164.28
  106.55.167.157
  106.55.167.169
  106.55.167.58
  106.55.168.138
  106.55.168.173
  106.55.168.232
-106.55.168.234
  106.55.169.74
  106.55.17.158
  106.55.17.63
  106.55.170.47
  106.55.170.49
-106.55.18.86
  106.55.21.141
  106.55.233.29
  106.55.238.164
@@ -10880,32 +9988,25 @@
  106.55.249.164
  106.55.26.195
  106.55.30.229
-106.55.32.232
+106.55.31.71
  106.55.34.241
  106.55.36.125
  106.55.37.132
  106.55.37.171
  106.55.37.174
  106.55.41.76
-106.55.42.188
  106.55.45.75
  106.55.47.184
  106.55.48.134
  106.55.49.141
-106.55.5.192
  106.55.53.121
  106.55.58.118
  106.55.59.64
-106.55.60.235
-106.55.9.175
  106.55.9.52
  106.56.48.43
  106.56.73.83
  106.57.51.8
  106.58.167.245
-106.58.169.162
-106.58.175.97
-106.58.189.125
  106.58.214.242
  106.58.215.95
  106.58.30.113
@@ -10923,14 +10024,11 @@
  106.69.193.120
  106.72.36.96
  106.73.14.99
-106.74.36.68
  106.75.10.4
  106.75.100.32
-106.75.101.156
  106.75.103.4
  106.75.103.67
  106.75.104.44
-106.75.110.232
  106.75.114.98
  106.75.116.12
  106.75.119.202
@@ -10942,6 +10040,7 @@
  106.75.13.192
  106.75.132.3
  106.75.133.250
+106.75.137.146
  106.75.138.38
  106.75.141.155
  106.75.141.160
@@ -10956,10 +10055,8 @@
  106.75.153.31
  106.75.156.107
  106.75.156.124
-106.75.156.128
  106.75.157.9
  106.75.16.115
-106.75.16.62
  106.75.161.98
  106.75.163.101
  106.75.164.156
@@ -10988,17 +10085,12 @@
  106.75.217.16
  106.75.218.71
  106.75.22.216
-106.75.222.121
  106.75.224.132
  106.75.225.193
  106.75.230.208
  106.75.231.107
-106.75.232.34
  106.75.234.61
-106.75.239.3
-106.75.239.63
  106.75.239.79
-106.75.240.46
  106.75.240.86
  106.75.241.193
  106.75.241.94
@@ -11012,76 +10104,59 @@
  106.75.254.109
  106.75.254.114
  106.75.26.61
-106.75.28.38
  106.75.3.35
-106.75.3.59
  106.75.30.102
-106.75.32.229
  106.75.34.41
  106.75.37.72
  106.75.4.19
-106.75.45.180
-106.75.5.180
  106.75.52.43
-106.75.53.228
-106.75.53.49
  106.75.55.46
-106.75.6.147
  106.75.6.230
  106.75.61.147
  106.75.61.203
  106.75.63.218
-106.75.63.36
-106.75.64.251
  106.75.66.59
  106.75.66.70
  106.75.67.6
  106.75.7.109
-106.75.7.92
  106.75.74.225
  106.75.77.230
  106.75.78.135
  106.75.8.155
-106.75.8.52
  106.75.84.197
  106.75.85.37
  106.75.86.180
-106.75.87.152
  106.75.9.141
  106.75.92.239
  106.75.92.78
  106.75.93.26
  106.75.97.129
  106.75.97.141
-106.75.99.198
-106.78.78.51
  106.8.121.138
-106.8.208.132
  106.8.208.214
  106.8.209.180
  106.8.211.3
  106.8.212.129
-106.8.213.149
  106.8.213.205
-106.8.214.27
  106.8.215.144
-106.8.215.161
  106.8.216.16
  106.8.216.9
  106.8.219.102
  106.8.219.198
+106.8.219.61
  106.8.220.19
  106.8.222.196
+106.83.196.144
  106.83.201.34
  106.86.48.10
  106.86.48.252
  106.86.50.225
+106.86.51.165
  106.86.51.28
  106.86.51.3
  106.86.52.200
  106.86.52.219
  106.86.54.0
-106.86.54.103
  106.86.55.66
  106.87.88.231
  106373423597656-dot-hi0-492-net.appspot.com
@@ -11090,12 +10165,10 @@
  107.0.200.227
  107.0.207.144
  107.126.103.75
-107.126.98.148
  107.13.118.140
  107.13.140.129
  107.13.141.32
  107.13.176.58
-107.13.186.21
  107.132.198.201
  107.132.88.42
  107.142.169.193
@@ -11104,7 +10177,6 @@
  107.144.198.205
  107.144.238.140
  107.144.64.190
-107.145.137.24
  107.145.140.50
  107.145.220.33
  107.145.58.245
@@ -11112,12 +10184,13 @@
  107.147.178.243
  107.147.249.75
  107.148.128.214
+107.148.129.135
  107.148.129.248
  107.148.130.125
  107.148.130.166
  107.148.130.217
+107.148.130.223
  107.148.189.11
-107.148.189.4
  107.15.154.173
  107.15.159.1
  107.15.40.62
@@ -11138,28 +10211,26 @@
  107.150.58.196
  107.150.60.26
  107.150.64.21
-107.150.64.81
  107.150.64.92
  107.150.65.11
  107.150.65.119
+107.150.65.125
  107.150.65.129
+107.150.65.38
  107.150.65.59
  107.150.70.90
  107.150.70.98
-107.150.89.166
  107.150.89.191
  107.150.89.199
  107.150.89.213
-107.150.98.17
  107.151.152.210
  107.151.184.138
  107.151.194.108
-107.151.202.182
+107.151.198.8
  107.151.218.131
  107.152.101.211
  107.152.101.213
  107.152.129.250
-107.152.139.218
  107.152.139.246
  107.152.139.247
  107.152.140.6
@@ -11169,62 +10240,54 @@
  107.152.161.64
  107.152.163.160
  107.152.163.166
-107.152.163.215
  107.152.163.218
-107.152.165.1
+107.152.171.165
  107.152.189.197
  107.152.196.168
-107.152.198.15
  107.152.210.26
  107.152.210.74
-107.152.210.96
  107.152.239.122
-107.152.239.188
  107.152.239.23
  107.152.239.35
  107.152.239.45
-107.152.239.46
  107.152.243.81
  107.152.246.148
  107.152.246.155
  107.152.247.0
  107.152.247.148
  107.152.247.150
+107.152.247.151
  107.152.247.158
-107.152.247.224
+107.152.247.229
  107.152.247.233
-107.152.247.234
  107.152.251.96
  107.152.254.93
  107.152.255.221
  107.152.255.98
-107.152.32.180
  107.152.35.192
  107.152.35.198
  107.152.47.41
  107.155.132.187
  107.155.132.75
-107.155.134.66
  107.155.15.253
  107.155.15.26
-107.155.153.98
  107.155.160.204
  107.155.162.15
-107.155.45.241
  107.155.48.36
  107.155.65.34
  107.155.69.26
-107.158.123.148
  107.158.123.149
+107.158.123.154
+107.158.123.168
  107.158.123.170
-107.158.123.174
+107.158.123.171
+107.158.123.172
  107.158.123.190
  107.158.154.111
  107.158.154.121
  107.158.154.126
  107.158.154.76
  107.158.154.78
-107.158.154.87
  107.158.154.88
  107.158.154.94
  107.158.154.99
@@ -11239,23 +10302,20 @@
  107.158.32.3
  107.158.32.48
  107.158.8.88
-107.158.84.121
  107.158.84.129
-107.158.84.203
-107.158.84.29
+107.158.84.89
  107.158.85.18
  107.158.85.208
  107.158.85.243
-107.158.9.102
  107.158.9.170
-107.158.9.187
  107.158.92.101
  107.158.92.57
+107.158.92.75
  107.158.93.12
+107.158.93.148
  107.158.93.165
  107.158.93.216
  107.158.93.244
-107.158.93.35
  107.158.93.55
  107.159.86.88
  107.159.93.103
@@ -11293,21 +10353,16 @@
  107.170.131.23
  107.170.135.29
  107.170.14.209
-107.170.143.77
  107.170.160.61
  107.170.162.155
  107.170.164.211
-107.170.17.129
  107.170.172.23
-107.170.178.103
  107.170.18.163
  107.170.184.26
-107.170.192.131
  107.170.192.181
  107.170.192.29
  107.170.194.42
  107.170.195.177
-107.170.195.87
  107.170.196.82
  107.170.197.213
  107.170.197.47
@@ -11317,7 +10372,6 @@
  107.170.200.113
  107.170.200.19
  107.170.203.195
-107.170.204.148
  107.170.208.126
  107.170.208.150
  107.170.210.211
@@ -11341,13 +10395,10 @@
  107.170.24.125
  107.170.240.244
  107.170.241.10
-107.170.244.110
  107.170.248.56
-107.170.249.243
  107.170.249.6
  107.170.250.177
  107.170.251.238
-107.170.254.146
  107.170.254.53
  107.170.27.84
  107.170.32.181
@@ -11362,14 +10413,12 @@
  107.170.50.207
  107.170.57.221
  107.170.6.56
-107.170.63.221
  107.170.64.6
  107.170.74.206
  107.170.76.170
  107.170.77.69
  107.170.8.24
  107.170.9.195
-107.170.91.121
  107.170.96.6
  107.170.99.119
  107.171.179.10
@@ -11377,25 +10426,25 @@
  107.172.0.112
  107.172.0.113
  107.172.0.128
-107.172.0.139
  107.172.0.161
  107.172.100.204
  107.172.101.71
  107.172.103.144
  107.172.104.125
+107.172.131.179
  107.172.137.129
  107.172.137.132
-107.172.14.241
  107.172.140.127
  107.172.141.105
+107.172.142.113
  107.172.142.122
  107.172.143.214
  107.172.146.81
  107.172.148.134
  107.172.148.174
-107.172.15.254
  107.172.150.56
  107.172.150.88
+107.172.151.208
  107.172.155.211
  107.172.156.153
  107.172.157.108
@@ -11409,7 +10458,6 @@
  107.172.193.13
  107.172.196.110
  107.172.197.101
-107.172.197.186
  107.172.198.10
  107.172.198.118
  107.172.198.146
@@ -11440,7 +10488,6 @@
  107.172.248.138
  107.172.249.10
  107.172.25.151
-107.172.3.124
  107.172.3.146
  107.172.35.136
  107.172.39.131
@@ -11458,7 +10505,6 @@
  107.172.63.251
  107.172.66.135
  107.172.68.247
-107.172.79.63
  107.172.80.110
  107.172.80.130
  107.172.80.132
@@ -11467,14 +10513,9 @@
  107.172.86.197
  107.172.89.15
  107.172.89.165
-107.172.99.22
-107.172.99.26
  107.172.99.62
  107.173.114.51
-107.173.117.234
  107.173.122.10
-107.173.137.144
-107.173.137.253
  107.173.140.114
  107.173.141.112
  107.173.141.161
@@ -11505,39 +10546,35 @@
  107.173.222.123
  107.173.222.153
  107.173.229.72
-107.173.230.205
-107.173.230.209
+107.173.230.206
  107.173.230.227
  107.173.233.12
  107.173.233.120
  107.173.24.170
-107.173.248.100
  107.173.248.115
+107.173.248.119
  107.173.248.129
-107.173.248.146
  107.173.248.151
-107.173.248.220
-107.173.248.26
  107.173.248.34
  107.173.248.73
  107.173.251.100
  107.173.251.157
-107.173.254.72
  107.173.27.180
-107.173.28.34
  107.173.28.55
  107.173.33.126
-107.173.34.202
  107.173.34.28
+107.173.4.197
  107.173.42.101
  107.173.48.253
  107.173.49.10
  107.173.49.12
+107.173.50.146
  107.173.50.220
  107.173.51.219
  107.173.51.246
  107.173.67.131
  107.173.70.251
+107.173.9.153
  107.173.91.144
  107.173.91.164
  107.174.13.220
@@ -11552,12 +10589,12 @@
  107.174.204.224
  107.174.206.110
  107.174.224.153
-107.174.224.154
-107.174.224.176
  107.174.224.184
  107.174.224.185
  107.174.226.133
  107.174.226.176
+107.174.226.222
+107.174.226.224
  107.174.231.198
  107.174.24.106
  107.174.24.12
@@ -11570,15 +10607,12 @@
  107.174.250.123
  107.174.250.128
  107.174.250.137
-107.174.254.152
  107.174.254.59
  107.174.26.146
  107.174.26.178
  107.174.26.181
  107.174.33.130
  107.174.33.159
-107.174.35.156
-107.174.35.226
  107.174.39.102
  107.174.39.107
  107.174.39.118
@@ -11587,14 +10621,12 @@
  107.174.5.242
  107.174.54.37
  107.174.61.168
-107.174.64.206
  107.174.76.237
  107.174.76.247
  107.175.0.13
-107.175.101.106
+107.175.108.254
  107.175.110.116
  107.175.114.127
-107.175.123.77
  107.175.128.141
  107.175.129.225
  107.175.129.252
@@ -11626,12 +10658,13 @@
  107.175.197.164
  107.175.197.177
  107.175.209.159
+107.175.236.254
+107.175.240.120
  107.175.247.36
  107.175.247.76
  107.175.247.88
  107.175.31.146
  107.175.32.92
-107.175.33.240
  107.175.33.29
  107.175.33.55
  107.175.34.41
@@ -11654,9 +10687,9 @@
  107.175.64.101
  107.175.64.137
  107.175.64.176
-107.175.64.187
  107.175.65.251
  107.175.66.73
+107.175.67.145
  107.175.71.42
  107.175.75.60
  107.175.76.13
@@ -11675,11 +10708,9 @@
  107.175.94.166
  107.175.94.18
  107.175.95.122
-107.178.242.127
  107.178.6.30
  107.178.91.53
  107.178.98.66
-107.179.13.141
  107.179.165.43
  107.179.178.132
  107.179.247.227
@@ -11705,10 +10736,8 @@
  107.180.84.251
  107.180.88.189
  107.180.88.41
-107.180.92.3
  107.180.95.70
  107.181.174.175
-107.181.174.74
  107.181.175.112
  107.181.180.173
  107.181.187.132
@@ -11735,8 +10764,10 @@
  107.189.10.101
  107.189.10.119
  107.189.10.174
+107.189.10.185
  107.189.10.243
  107.189.10.245
+107.189.10.251
  107.189.10.40
  107.189.10.42
  107.189.10.93
@@ -11789,6 +10820,7 @@
  107.21.196.112
  107.21.225.222
  107.21.77.7
+107.219.185.75
  107.22.127.222
  107.22.132.160
  107.22.152.148
@@ -11925,20 +10957,17 @@
  107.77.90.90
  107.77.94.82
  107.77.94.83
-107.9.138.59
  107217279.snapchatprime.com
  1073.co.jp
  108-365.net
-108.11.213.164
  108.11.29.107
-108.12.130.32
  108.12.147.7
-108.12.225.85
  108.14.14.194
+108.14.79.202
  108.160.138.55
  108.160.141.213
-108.160.142.160
  108.160.193.48
+108.160.95.80
  108.161.128.22
  108.161.128.7
  108.161.129.118
@@ -11949,11 +10978,11 @@
  108.161.134.78
  108.161.134.8
  108.162.139.230
-108.162.219.42
-108.162.229.172
-108.162.229.200
+108.162.219.11
+108.162.219.144
  108.162.229.226
  108.162.229.35
+108.162.241.214
  108.162.245.119
  108.162.245.83
  108.162.246.36
@@ -12000,6 +11029,7 @@
  108.171.85.14
  108.171.94.90
  108.172.246.109
+108.172.36.118
  108.173.197.6
  108.173.56.251
  108.173.64.161
@@ -12007,7 +11037,6 @@
  108.174.191.182
  108.174.195.240
  108.174.196.234
-108.174.198.218
  108.174.198.231
  108.174.199.180
  108.174.81.136
@@ -12029,12 +11058,10 @@
  108.179.217.85
  108.179.219.114
  108.179.219.12
-108.179.33.246
  108.179.54.171
  108.183.77.12
  108.185.130.115
  108.185.142.237
-108.185.173.255
  108.185.250.191
  108.185.49.129
  108.186.6.161
@@ -12045,7 +11072,6 @@
  108.19.140.2
  108.190.109.107
  108.190.145.34
-108.190.190.48
  108.190.250.48
  108.190.26.114
  108.190.31.236
@@ -12053,6 +11079,7 @@
  108.191.2.72
  108.197.138.180
  108.199.239.172
+108.199.50.228
  108.2.119.69
  108.20.186.210
  108.20.203.32
@@ -12065,7 +11092,6 @@
  108.209.99.209
  108.211.115.210
  108.212.188.189
-108.212.98.124
  108.213.120.73
  108.213.205.103
  108.215.164.14
@@ -12093,9 +11119,7 @@
  108.29.164.250
  108.29.202.7
  108.29.207.253
-108.29.3.190
  108.29.32.73
-108.29.55.15
  108.29.77.74
  108.30.135.146
  108.30.14.21
@@ -12106,7 +11130,6 @@
  108.31.26.131
  108.33.213.8
  108.35.101.26
-108.35.156.188
  108.35.175.234
  108.36.253.227
  108.39.181.17
@@ -12116,14 +11139,13 @@
  108.41.212.125
  108.41.254.185
  108.45.109.14
-108.45.80.119
  108.46.155.174
  108.46.223.160
  108.46.29.236
  108.48.176.222
  108.5.191.157
  108.5.49.62
-108.50.164.201
+108.50.231.111
  108.51.161.23
  108.51.195.163
  108.51.85.97
@@ -12133,18 +11155,14 @@
  108.53.145.212
  108.54.163.150
  108.54.174.183
-108.56.134.33
-108.56.183.188
  108.56.184.98
  108.56.225.252
  108.58.81.46
  108.58.84.194
  108.59.192.147
  108.59.8.80
-108.59.86.93
  108.6.140.26
  108.6.205.196
-108.6.44.59
  108.60.183.101
  108.60.206.189
  108.60.219.24
@@ -12190,6 +11208,7 @@
  108.61.86.34
  108.61.87.179
  108.62.116.27
+108.62.118.2
  108.62.121.177
  108.62.121.210
  108.62.21.154
@@ -14248,11 +13267,11 @@
  108.66.251.224
  108.67.148.87
  108.72.209.30
+108.72.76.83
  108.73.23.194
  108.74.113.180
  108.75.3.147
  108.77.246.129
-108.79.36.244
  108.80.60.218
  108.85.84.173
  108.9.195.212
@@ -14265,12 +13284,9 @@
  108studija.lt
  109-365.net
  109.1.105.79
-109.10.165.189
  109.10.194.233
  109.100.124.75
-109.100.158.205
  109.100.43.230
-109.100.61.19
  109.101.137.162
  109.101.137.186
  109.101.139.106
@@ -14297,6 +13313,7 @@
  109.103.55.145
  109.103.62.40
  109.103.74.3
+109.104.162.96
  109.104.164.105
  109.104.197.153
  109.104.206.40
@@ -14304,18 +13321,15 @@
  109.104.74.88
  109.104.76.142
  109.104.87.199
-109.105.173.180
  109.105.195.250
  109.105.205.229
  109.105.205.230
-109.105.205.232
+109.105.219.187
  109.105.242.31
  109.106.136.187
  109.106.139.225
-109.107.240.6
  109.107.88.91
  109.107.95.226
-109.108.136.103
  109.108.48.74
  109.108.87.136
  109.108.88.156
@@ -14333,13 +13347,11 @@
  109.111.237.38
  109.115.102.150
  109.115.243.142
-109.115.6.161
+109.115.246.230
  109.116.152.107
-109.116.196.174
  109.116.245.220
  109.116.245.80
  109.116.41.157
-109.116.41.170
  109.116.41.238
  109.116.7.179
  109.117.125.132
@@ -14370,14 +13382,12 @@
  109.122.81.1
  109.122.81.11
  109.123.101.28
-109.123.102.209
  109.123.117.146
  109.123.118.162
  109.123.120.107
  109.123.213.130
  109.123.66.206
  109.124.162.238
-109.124.65.86
  109.125.131.162
  109.125.132.143
  109.125.133.156
@@ -14389,23 +13399,20 @@
  109.125.209.0
  109.125.218.134
  109.128.122.124
-109.128.209.248
  109.129.168.51
  109.129.18.13
+109.13.179.195
  109.130.101.37
  109.130.46.33
  109.133.195.236
-109.133.31.73
  109.134.199.197
  109.134.232.81
  109.136.135.101
  109.136.220.23
-109.145.170.80
+109.136.35.45
  109.145.205.193
-109.145.64.100
  109.148.140.120
  109.149.177.137
-109.149.80.206
  109.151.179.17
  109.152.105.238
  109.153.250.207
@@ -14414,8 +13421,6 @@
  109.156.113.47
  109.157.106.232
  109.157.133.203
-109.159.194.226
-109.160.19.209
  109.160.55.202
  109.160.72.219
  109.160.72.231
@@ -14434,21 +13439,17 @@
  109.162.240.112
  109.162.240.121
  109.162.240.123
-109.162.240.133
-109.162.240.135
  109.162.240.150
  109.162.240.162
  109.162.240.171
  109.162.240.191
  109.162.240.192
-109.162.240.20
  109.162.240.202
-109.162.240.211
  109.162.240.217
  109.162.240.246
+109.162.240.247
  109.162.240.253
  109.162.240.28
-109.162.240.37
  109.162.240.40
  109.162.240.44
  109.162.240.47
@@ -14459,8 +13460,9 @@
  109.162.241.104
  109.162.241.115
  109.162.241.119
+109.162.241.122
  109.162.241.130
-109.162.241.152
+109.162.241.177
  109.162.241.182
  109.162.241.189
  109.162.241.193
@@ -14470,39 +13472,34 @@
  109.162.241.232
  109.162.241.237
  109.162.241.244
-109.162.241.251
-109.162.241.3
  109.162.241.38
  109.162.241.52
  109.162.241.70
  109.162.241.74
  109.162.241.8
-109.162.242.100
-109.162.242.104
+109.162.242.101
  109.162.242.12
-109.162.242.141
  109.162.242.145
  109.162.242.148
  109.162.242.156
-109.162.242.175
  109.162.242.193
  109.162.242.202
  109.162.242.214
  109.162.242.22
  109.162.242.248
-109.162.242.254
  109.162.242.32
  109.162.242.42
  109.162.242.47
  109.162.242.50
-109.162.242.55
+109.162.242.63
  109.162.242.84
+109.162.242.96
  109.162.243.10
  109.162.243.110
  109.162.243.124
-109.162.243.131
  109.162.243.134
  109.162.243.138
+109.162.243.14
  109.162.243.145
  109.162.243.151
  109.162.243.162
@@ -14511,12 +13508,11 @@
  109.162.243.199
  109.162.243.206
  109.162.243.209
-109.162.243.213
+109.162.243.212
  109.162.243.22
  109.162.243.224
  109.162.243.235
  109.162.243.242
-109.162.243.245
  109.162.243.25
  109.162.243.250
  109.162.243.28
@@ -14530,24 +13526,28 @@
  109.162.244.131
  109.162.244.132
  109.162.244.134
+109.162.244.141
  109.162.244.147
  109.162.244.159
  109.162.244.167
  109.162.244.172
  109.162.244.177
  109.162.244.18
+109.162.244.190
  109.162.244.193
  109.162.244.194
-109.162.244.196
+109.162.244.197
  109.162.244.202
  109.162.244.21
+109.162.244.211
+109.162.244.215
  109.162.244.223
  109.162.244.233
-109.162.244.251
  109.162.244.29
  109.162.244.36
+109.162.244.50
  109.162.244.60
-109.162.244.82
+109.162.244.71
  109.162.245.105
  109.162.245.111
  109.162.245.12
@@ -14555,29 +13555,33 @@
  109.162.245.123
  109.162.245.142
  109.162.245.145
+109.162.245.163
  109.162.245.179
  109.162.245.182
  109.162.245.19
  109.162.245.196
  109.162.245.198
  109.162.245.216
+109.162.245.225
  109.162.245.228
  109.162.245.24
+109.162.245.240
  109.162.245.254
  109.162.245.29
  109.162.245.30
  109.162.245.32
  109.162.245.42
+109.162.245.46
  109.162.245.55
  109.162.245.74
  109.162.245.78
  109.162.245.83
  109.162.245.93
  109.162.245.98
+109.162.246.130
+109.162.246.144
  109.162.246.150
  109.162.246.162
-109.162.246.17
-109.162.246.177
  109.162.246.194
  109.162.246.216
  109.162.246.237
@@ -14592,17 +13596,19 @@
  109.162.247.157
  109.162.247.161
  109.162.247.168
+109.162.247.195
  109.162.247.204
  109.162.247.212
-109.162.247.234
  109.162.247.239
+109.162.247.242
  109.162.247.35
  109.162.247.54
+109.162.247.57
  109.162.247.60
  109.162.247.64
  109.162.248.102
+109.162.248.116
  109.162.248.129
-109.162.248.13
  109.162.248.130
  109.162.248.138
  109.162.248.146
@@ -14610,15 +13616,20 @@
  109.162.248.175
  109.162.248.178
  109.162.248.18
-109.162.248.198
  109.162.248.202
+109.162.248.212
+109.162.248.215
+109.162.248.227
  109.162.248.235
  109.162.248.237
  109.162.248.246
+109.162.248.32
  109.162.248.38
+109.162.248.43
  109.162.248.75
  109.162.248.82
  109.162.249.156
+109.162.249.194
  109.162.249.201
  109.162.249.204
  109.162.249.219
@@ -14628,6 +13639,7 @@
  109.162.249.26
  109.162.249.72
  109.162.249.77
+109.162.249.78
  109.162.249.87
  109.162.250.107
  109.162.250.123
@@ -14639,6 +13651,7 @@
  109.162.250.46
  109.162.250.52
  109.162.250.78
+109.162.251.113
  109.162.251.118
  109.162.251.127
  109.162.251.136
@@ -14647,6 +13660,7 @@
  109.162.251.184
  109.162.251.206
  109.162.251.224
+109.162.251.24
  109.162.251.240
  109.162.251.35
  109.162.251.75
@@ -14677,7 +13691,6 @@
  109.167.200.10
  109.167.207.72
  109.167.210.163
-109.167.225.59
  109.167.226.107
  109.167.231.99
  109.167.245.164
@@ -14686,12 +13699,8 @@
  109.168.109.50
  109.168.145.81
  109.168.27.35
-109.168.66.27
  109.169.20.168
-109.169.20.189
-109.169.20.190
  109.169.25.101
-109.169.29.232
  109.169.29.30
  109.169.33.163
  109.169.6.152
@@ -14708,10 +13717,10 @@
  109.172.102.60
  109.172.150.4
  109.172.180.157
-109.172.57.250
  109.172.57.64
  109.172.57.68
  109.172.67.82
+109.173.116.185
  109.173.131.184
  109.173.131.67
  109.173.17.154
@@ -14723,10 +13732,10 @@
  109.174.24.121
  109.175.10.239
  109.175.155.94
-109.175.166.38
  109.175.17.198
  109.175.56.113
  109.175.68.124
+109.18.168.169
  109.180.175.115
  109.182.230.52
  109.183.177.6
@@ -14734,11 +13743,10 @@
  109.183.251.77
  109.183.32.106
  109.183.79.195
-109.184.204.225
+109.184.224.128
  109.184.239.84
  109.184.60.62
  109.184.61.77
-109.185.141.61
  109.185.180.87
  109.185.239.77
  109.185.4.203
@@ -14781,10 +13789,8 @@
  109.194.107.121
  109.194.162.252
  109.194.17.181
-109.194.174.78
  109.194.175.108
  109.194.175.135
-109.194.175.27
  109.194.246.48
  109.194.27.59
  109.194.3.165
@@ -14793,25 +13799,21 @@
  109.195.139.50
  109.195.179.88
  109.195.194.79
-109.195.198.27
  109.195.215.52
  109.195.38.201
+109.195.83.165
  109.195.84.141
  109.195.84.213
  109.196.119.59
-109.196.164.169
  109.196.172.5
  109.196.2.4
-109.196.243.87
  109.196.50.184
-109.196.55.45
  109.196.68.236
  109.196.82.214
  109.197.189.42
  109.197.191.163
  109.197.191.30
-109.197.217.194
-109.197.248.233
+109.197.191.6
  109.197.80.136
  109.197.81.131
  109.197.81.36
@@ -14829,10 +13831,10 @@
  109.200.24.98
  109.200.26.99
  109.201.133.100
-109.201.133.134
  109.201.133.145
  109.201.133.22
  109.201.133.26
+109.201.14.114
  109.201.140.103
  109.201.140.50
  109.201.140.9
@@ -14853,12 +13855,9 @@
  109.206.245.10
  109.206.245.123
  109.206.246.149
-109.206.246.154
-109.206.246.75
  109.206.255.6
  109.207.102.183
  109.207.107.115
-109.207.166.232
  109.207.191.188
  109.207.191.44
  109.207.35.207
@@ -14874,12 +13873,10 @@
  109.207.79.248
  109.208.111.148
  109.21.2.25
-109.210.178.220
  109.210.97.157
  109.215.78.133
  109.217.85.164
  109.218.232.68
-109.22.102.75
  109.224.1.210
  109.224.11.234
  109.224.12.170
@@ -14897,13 +13894,12 @@
  109.224.54.18
  109.224.55.10
  109.224.55.6
-109.224.60.228
  109.225.105.87
  109.225.118.170
  109.225.55.172
  109.226.11.131
  109.226.206.132
-109.226.207.105
+109.226.21.52
  109.226.213.125
  109.226.220.205
  109.226.220.93
@@ -14916,6 +13912,7 @@
  109.228.157.237
  109.228.21.246
  109.228.46.119
+109.228.49.158
  109.228.50.121
  109.228.53.116
  109.228.53.229
@@ -14944,6 +13941,7 @@
  109.230.218.248
  109.230.236.194
  109.230.236.230
+109.230.238.190
  109.230.238.68
  109.230.245.229
  109.230.251.8
@@ -14962,16 +13960,16 @@
  109.235.50.135
  109.235.69.120
  109.236.105.40
+109.236.18.246
  109.236.180.67
+109.236.52.109
  109.236.52.115
+109.236.52.120
  109.236.52.176
  109.236.52.200
  109.236.52.202
  109.236.52.23
-109.236.52.27
-109.236.52.40
  109.236.52.45
-109.236.52.86
  109.236.52.96
  109.236.54.154
  109.236.54.49
@@ -14994,10 +13992,10 @@
  109.237.225.106
  109.237.227.194
  109.237.232.140
+109.237.233.239
  109.237.235.73
  109.237.26.218
  109.237.92.138
-109.238.186.171
  109.238.186.62
  109.238.190.42
  109.238.208.130
@@ -15013,24 +14011,17 @@
  109.238.230.42
  109.238.46.186
  109.24.144.155
-109.24.144.69
  109.241.164.89
  109.241.188.138
-109.241.98.147
  109.242.120.86
  109.242.153.9
-109.242.191.193
  109.242.197.81
  109.242.202.11
  109.242.205.251
  109.242.65.60
-109.244.101.166
-109.244.101.215
-109.244.101.232
  109.244.102.16
  109.244.102.25
  109.244.103.150
-109.244.17.38
  109.244.35.48
  109.244.96.201
  109.244.97.16
@@ -15051,7 +14042,6 @@
  109.248.128.9
  109.248.129.241
  109.248.13.38
-109.248.14.90
  109.248.143.209
  109.248.144.77
  109.248.147.150
@@ -15065,6 +14055,7 @@
  109.248.203.69
  109.248.205.252
  109.248.206.13
+109.248.55.143
  109.248.55.51
  109.248.62.207
  109.248.82.196
@@ -15074,34 +14065,26 @@
  109.250.159.53
  109.251.247.240
  109.251.252.123
-109.251.55.235
-109.251.68.112
  109.251.76.229
  109.251.94.34
  109.252.109.176
-109.252.116.137
  109.252.123.74
  109.252.128.242
-109.252.140.9
  109.252.2.48
-109.252.240.202
  109.252.255.162
  109.252.28.102
-109.254.191.69
  109.254.22.31
  109.254.37.147
  109.254.6.40
  109.254.6.55
  109.254.93.166
  109.255.152.153
-109.255.185.65
+109.255.19.91
  109.28.24.17
-109.40.2.141
-109.41.65.165
+109.41.130.125
  109.48.7.90
  109.49.172.172
  109.50.204.198
-109.50.229.100
  109.61.10.121
  109.61.112.10
  109.61.112.33
@@ -15110,15 +14093,17 @@
  109.61.14.0
  109.61.2.166
  109.61.207.181
-109.62.223.254
+109.61.236.154
+109.61.237.200
  109.62.245.212
  109.63.185.114
  109.64.229.66
+109.64.23.179
  109.64.231.189
  109.64.95.196
  109.65.4.202
  109.65.53.14
-109.66.197.216
+109.66.114.141
  109.66.219.252
  109.66.55.232
  109.66.65.126
@@ -15133,9 +14118,8 @@
  109.69.1.234
  109.69.10.116
  109.69.161.131
-109.69.66.105
-109.69.66.99
  109.69.67.17
+109.69.75.5
  109.7.44.186
  109.70.100.18
  109.70.100.19
@@ -15181,19 +14165,20 @@
  109.70.100.60
  109.70.132.150
  109.70.189.51
+109.70.189.56
  109.70.189.70
  109.70.3.229
  109.70.36.102
  109.71.41.50
  109.71.44.143
  109.72.102.202
-109.72.109.253
  109.72.238.94
  109.72.239.244
  109.72.83.127
  109.72.85.41
  109.72.87.206
  109.72.97.66
+109.73.164.58
  109.73.181.76
  109.73.186.11
  109.73.74.154
@@ -15210,6 +14195,7 @@
  109.74.194.190
  109.74.194.36
  109.74.198.200
+109.74.198.86
  109.74.206.146
  109.74.44.138
  109.74.5.95
@@ -15229,7 +14215,6 @@
  109.75.41.71
  109.75.42.231
  109.75.43.17
-109.75.47.248
  109.80.128.210
  109.81.215.70
  109.86.121.118
@@ -15249,17 +14234,15 @@
  109.87.131.244
  109.87.141.136
  109.87.143.67
+109.87.172.204
  109.87.183.226
  109.87.20.125
  109.87.224.76
-109.87.44.14
  109.87.78.144
  109.88.32.151
  109.89.177.248
  109.89.234.94
-109.89.78.164
  109.9.175.65
-109.90.122.185
  109.90.2.70
  109.92.141.118
  109.92.17.115
@@ -15267,14 +14250,12 @@
  109.92.179.3
  109.92.202.222
  109.92.205.35
-109.92.206.166
  109.92.222.102
  109.92.222.170
  109.94.115.108
  109.94.119.10
  109.94.119.2
  109.94.119.6
-109.94.171.102
  109.94.172.17
  109.94.172.24
  109.94.172.60
@@ -15286,15 +14267,14 @@
  109.94.182.128
  109.94.182.9
  109.94.220.120
-109.94.220.133
  109.94.220.136
  109.94.220.155
-109.94.220.19
  109.94.220.200
  109.94.220.208
  109.94.220.212
  109.94.220.39
  109.94.220.48
+109.94.220.54
  109.94.220.58
  109.94.220.95
  109.94.222.157
@@ -15304,13 +14284,13 @@
  109.95.218.121
  109.95.219.239
  109.95.255.82
-109.95.42.42
  109.95.96.234
  109.96.177.2
  109.96.233.9
  109.96.26.48
  109.96.66.75
  109.97.116.131
+109.97.54.206
  109.99.109.236
  109.99.146.210
  109.99.168.234
@@ -15361,8 +14341,6 @@
  110.10.179.65
  110.10.183.98
  110.12.143.150
-110.12.8.10
-110.130.175.205
  110.132.199.200
  110.136.129.228
  110.136.207.150
@@ -15372,7 +14350,6 @@
  110.136.29.206
  110.137.200.233
  110.137.223.62
-110.137.226.29
  110.137.239.20
  110.139.121.209
  110.139.128.232
@@ -15384,10 +14361,8 @@
  110.14.184.43
  110.14.58.190
  110.140.161.226
-110.141.212.12
  110.141.221.58
  110.141.249.250
-110.141.249.93
  110.141.252.109
  110.141.252.2
  110.141.255.108
@@ -15399,7 +14374,6 @@
  110.143.84.202
  110.144.66.55
  110.145.101.66
-110.145.140.210
  110.145.77.103
  110.15.30.241
  110.15.30.242
@@ -15429,8 +14403,6 @@
  110.159.88.153
  110.16.13.180
  110.16.185.162
-110.16.202.78
-110.16.76.213
  110.16.79.74
  110.16.95.206
  110.164.101.129
@@ -15443,18 +14415,14 @@
  110.164.57.4
  110.164.86.203
  110.164.91.50
-110.164.93.99
  110.165.19.77
  110.165.35.52
  110.165.37.61
  110.166.199.150
+110.166.254.108
  110.166.254.114
-110.166.254.119
  110.166.254.122
  110.166.254.97
-110.166.81.113
-110.166.82.211
-110.166.85.169
  110.166.87.119
  110.167.133.45
  110.167.135.93
@@ -15463,7 +14431,6 @@
  110.167.30.110
  110.167.30.50
  110.167.76.76
-110.168.170.43
  110.168.212.185
  110.168.255.216
  110.168.38.162
@@ -15472,16 +14439,18 @@
  110.169.137.77
  110.169.44.239
  110.17.174.253
+110.17.40.101
  110.17.41.183
  110.17.41.93
  110.17.42.234
  110.17.76.54
-110.170.180.66
  110.170.254.50
  110.170.37.194
  110.170.65.146
+110.171.216.120
  110.171.226.67
  110.171.33.104
+110.172.101.75
  110.172.147.35
  110.172.160.42
  110.172.166.161
@@ -15496,7 +14465,6 @@
  110.174.3.2
  110.175.118.246
  110.175.128.62
-110.175.173.142
  110.177.12.230
  110.177.3.152
  110.179.14.69
@@ -15526,8 +14494,6 @@
  110.182.99.228
  110.183.108.189
  110.185.104.126
-110.185.107.51
-110.185.125.103
  110.185.125.72
  110.185.125.94
  110.185.160.106
@@ -15535,8 +14501,7 @@
  110.185.164.133
  110.185.164.158
  110.185.185.17
-110.185.2.141
-110.185.227.238
+110.185.211.240
  110.185.229.247
  110.187.229.223
  110.187.78.101
@@ -15544,23 +14509,19 @@
  110.188.138.135
  110.188.138.221
  110.188.153.69
-110.188.20.58
-110.188.23.57
  110.188.66.133
-110.188.66.137
+110.188.66.139
  110.188.66.141
  110.188.66.142
  110.188.70.99
  110.189.104.54
  110.189.152.59
  110.189.201.118
-110.189.209.17
+110.189.214.99
  110.189.215.148
-110.19.111.2
  110.19.111.202
  110.19.243.1
  110.19.99.107
-110.22.10.63
  110.22.11.171
  110.227.118.199
  110.227.248.39
@@ -15572,13 +14533,13 @@
  110.228.219.153
  110.228.224.125
  110.228.251.80
-110.228.255.27
  110.228.91.170
  110.229.155.44
  110.23.201.16
  110.230.97.122
  110.232.115.241
  110.232.248.35
+110.232.248.62
  110.232.249.176
  110.232.249.236
  110.232.252.145
@@ -15591,8 +14552,6 @@
  110.232.83.117
  110.232.86.52
  110.232.87.3
-110.232.87.83
-110.234.27.53
  110.235.246.252
  110.235.250.208
  110.235.250.71
@@ -15620,11 +14579,11 @@
  110.244.61.117
  110.247.141.5
  110.247.16.64
-110.247.27.85
  110.248.110.203
  110.248.180.228
  110.248.191.170
  110.248.34.56
+110.248.38.151
  110.249.101.165
  110.249.137.131
  110.249.143.202
@@ -15641,22 +14600,23 @@
  110.25.94.142
  110.250.94.156
  110.251.132.10
-110.251.14.196
  110.251.166.118
  110.251.188.189
  110.251.202.250
  110.251.206.31
  110.251.206.97
+110.251.215.102
  110.251.220.175
  110.251.243.142
  110.251.67.33
+110.251.9.47
  110.252.122.115
  110.252.211.187
  110.252.8.175
  110.253.156.43
+110.253.224.139
  110.253.54.10
  110.253.86.206
-110.255.106.235
  110.255.95.62
  110.32.165.79
  110.32.201.239
@@ -15664,7 +14624,6 @@
  110.34.110.129
  110.34.121.15
  110.34.122.196
-110.34.164.78
  110.34.166.35
  110.34.166.38
  110.34.166.52
@@ -15676,14 +14635,13 @@
  110.35.11.212
  110.35.136.73
  110.35.17.123
-110.35.173.103
-110.35.173.2
  110.35.200.29
  110.35.200.51
  110.35.204.152
  110.35.208.21
  110.35.209.175
  110.35.214.17
+110.35.221.111
  110.35.221.134
  110.35.221.15
  110.35.225.22
@@ -15697,6 +14655,7 @@
  110.35.242.44
  110.35.245.16
  110.35.245.162
+110.35.249.21
  110.35.29.85
  110.35.3.55
  110.35.47.164
@@ -15705,6 +14664,7 @@
  110.35.61.102
  110.35.79.23
  110.35.80.82
+110.36.200.165
  110.36.208.122
  110.36.216.218
  110.36.216.62
@@ -15714,8 +14674,10 @@
  110.36.228.178
  110.36.228.189
  110.36.228.98
+110.36.232.242
  110.36.234.146
  110.36.235.18
+110.36.238.218
  110.36.239.218
  110.36.239.220
  110.37.216.118
@@ -15729,12 +14691,14 @@
  110.37.226.83
  110.37.227.139
  110.38.28.91
+110.39.1.62
  110.39.128.134
  110.39.160.141
  110.39.163.2
  110.39.163.206
  110.39.174.58
  110.39.191.29
+110.39.196.222
  110.39.21.86
  110.39.23.154
  110.4.27.27
@@ -15746,22 +14710,19 @@
  110.42.1.213
  110.42.10.141
  110.42.6.121
-110.42.6.155
  110.42.98.4
  110.43.241.63
  110.43.40.146
-110.43.42.91
  110.43.46.88
  110.43.49.148
  110.43.50.203
-110.43.50.229
  110.43.52.158
  110.43.64.162
-110.43.69.204
  110.44.116.181
  110.44.116.2
  110.44.117.232
  110.44.117.26
+110.44.122.214
  110.44.123.116
  110.44.126.235
  110.44.236.131
@@ -15772,7 +14733,6 @@
  110.44.240.202
  110.45.139.12
  110.45.145.165
-110.45.145.178
  110.45.146.84
  110.45.147.246
  110.45.147.248
@@ -15801,9 +14761,6 @@
  110.49.167.189
  110.49.47.242
  110.49.60.66
-110.49.70.244
-110.49.70.245
-110.49.71.248
  110.5.102.238
  110.5.21.58
  110.50.50.181
@@ -15812,16 +14769,15 @@
  110.50.53.12
  110.50.84.162
  110.50.84.231
+110.50.84.248
  110.50.84.5
  110.50.85.162
-110.50.85.28
  110.50.86.196
  110.52.145.234
  110.52.223.243
  110.52.230.57
  110.52.27.102
  110.52.28.111
-110.52.28.118
  110.52.28.129
  110.52.28.195
  110.52.28.219
@@ -15833,13 +14789,13 @@
  110.52.29.171
  110.52.29.176
  110.52.29.192
-110.52.29.221
  110.53.162.130
  110.53.163.218
  110.53.182.126
  110.53.205.121
  110.53.205.126
  110.53.205.37
+110.53.234.76
  110.54.126.94
  110.54.33.157
  110.55.117.248
@@ -15869,12 +14825,10 @@
  110.74.222.213
  110.74.222.71
  110.76.128.53
-110.76.129.106
  110.76.155.145
  110.76.39.228
  110.77.132.217
  110.77.135.131
-110.77.135.148
  110.77.135.200
  110.77.135.215
  110.77.135.70
@@ -15882,17 +14836,14 @@
  110.77.137.213
  110.77.137.251
  110.77.145.159
+110.77.145.5
  110.77.148.50
  110.77.148.59
-110.77.148.62
  110.77.149.221
  110.77.149.227
-110.77.149.76
-110.77.154.149
  110.77.154.170
  110.77.154.185
  110.77.154.85
-110.77.159.160
  110.77.159.238
  110.77.159.242
  110.77.159.67
@@ -15902,11 +14853,11 @@
  110.77.162.32
  110.77.162.67
  110.77.170.28
+110.77.171.24
  110.77.173.178
  110.77.180.18
  110.77.180.194
  110.77.180.69
-110.77.184.134
  110.77.184.19
  110.77.184.223
  110.77.184.4
@@ -15916,42 +14867,44 @@
  110.77.187.190
  110.77.189.93
  110.77.196.121
+110.77.196.16
  110.77.197.166
  110.77.207.93
  110.77.217.238
+110.77.226.205
  110.77.226.221
  110.77.228.152
  110.77.232.231
  110.77.232.250
-110.77.232.3
  110.77.232.39
  110.77.232.49
  110.77.236.114
  110.77.236.121
+110.77.236.75
  110.77.240.101
  110.77.240.174
-110.77.241.90
+110.77.241.89
  110.77.242.85
  110.77.244.176
  110.77.244.85
  110.77.244.88
-110.77.246.212
  110.77.246.83
  110.77.248.135
+110.77.248.27
  110.77.250.185
  110.78.114.236
  110.78.136.153
  110.78.136.36
  110.78.136.65
  110.78.137.118
-110.78.142.144
+110.78.138.168
  110.78.142.189
  110.78.143.155
-110.78.143.176
  110.78.143.222
  110.78.147.136
  110.78.147.161
  110.78.148.142
+110.78.148.144
  110.78.148.152
  110.78.148.234
  110.78.148.58
@@ -15960,6 +14913,8 @@
  110.78.149.181
  110.78.149.184
  110.78.149.202
+110.78.149.221
+110.78.149.43
  110.78.149.51
  110.78.149.79
  110.78.151.200
@@ -15978,11 +14933,14 @@
  110.78.153.253
  110.78.153.43
  110.78.153.64
+110.78.153.81
+110.78.154.37
+110.78.155.16
  110.78.155.42
  110.78.157.227
  110.78.158.221
+110.78.159.19
  110.78.159.218
-110.78.159.54
  110.78.159.85
  110.78.164.188
  110.78.164.234
@@ -15993,6 +14951,7 @@
  110.78.171.220
  110.78.171.53
  110.78.172.249
+110.78.173.103
  110.78.177.124
  110.78.178.166
  110.78.178.20
@@ -16003,8 +14962,6 @@
  110.78.186.217
  110.78.186.220
  110.78.186.238
-110.78.186.32
-110.78.186.60
  110.78.186.73
  110.78.186.9
  110.78.20.62
@@ -16014,24 +14971,18 @@
  110.8.71.166
  110.8.84.231
  110.80.142.88
-110.82.244.132
-110.83.135.124
  110.83.152.224
  110.83.154.46
  110.83.154.99
-110.83.161.37
  110.83.32.25
  110.83.32.4
  110.83.40.106
  110.83.51.25
  110.84.220.174
-110.84.221.108
  110.84.221.162
-110.85.180.118
  110.85.180.78
  110.85.216.186
  110.85.5.210
-110.85.98.15
  110.85.99.220
  110.86.15.46
  110.86.180.243
@@ -16046,7 +14997,6 @@
  110.88.127.191
  110.88.160.179
  110.88.160.233
-110.89.122.110
  110.89.158.158
  110.89.240.90
  110.90.99.57
@@ -16074,7 +15024,6 @@
  111.1.184.250
  111.1.62.189
  111.10.19.16
-111.10.43.201
  111.108.18.89
  111.11.107.130
  111.11.117.90
@@ -16088,7 +15037,6 @@
  111.118.105.57
  111.118.108.122
  111.118.111.207
-111.118.115.206
  111.118.117.93
  111.118.118.86
  111.118.124.110
@@ -16114,6 +15062,7 @@
  111.118.45.228
  111.118.51.219
  111.118.65.204
+111.118.65.238
  111.118.65.24
  111.118.71.30
  111.118.74.150
@@ -16121,7 +15070,8 @@
  111.118.88.61
  111.118.9.16
  111.118.96.2
-111.119.187.27
+111.119.178.128
+111.119.187.6
  111.119.210.10
  111.119.218.179
  111.119.233.65
@@ -16129,14 +15079,13 @@
  111.119.245.114
  111.12.121.37
  111.12.191.180
-111.12.52.238
-111.120.16.2
  111.120.84.35
  111.121.110.139
  111.121.192.228
  111.122.15.139
  111.122.172.78
  111.122.175.73
+111.122.191.113
  111.122.224.101
  111.122.232.6
  111.122.248.164
@@ -16147,7 +15096,6 @@
  111.125.139.210
  111.125.139.212
  111.125.139.226
-111.125.209.159
  111.125.230.47
  111.125.87.199
  111.125.88.186
@@ -16158,18 +15106,16 @@
  111.132.5.132
  111.14.221.8
  111.14.222.130
-111.160.112.142
  111.160.124.194
  111.160.188.11
  111.160.188.12
  111.160.231.251
-111.160.46.10
  111.160.66.22
  111.161.41.156
  111.161.66.123
-111.161.66.251
  111.161.72.99
  111.161.74.100
+111.161.74.105
  111.161.74.106
  111.161.74.112
  111.161.74.113
@@ -16186,7 +15132,6 @@
  111.164.236.36
  111.165.223.102
  111.165.242.26
-111.165.253.224
  111.165.66.16
  111.165.9.204
  111.166.56.193
@@ -16210,34 +15155,28 @@
  111.170.85.31
  111.172.110.115
  111.172.180.125
-111.172.182.33
+111.172.37.128
  111.172.37.8
  111.172.57.73
  111.172.98.121
  111.172.99.239
  111.174.197.109
-111.174.217.176
  111.175.186.150
  111.175.32.207
  111.176.248.54
  111.176.46.94
  111.177.114.5
-111.177.16.4
-111.177.164.137
  111.177.18.194
  111.177.212.65
  111.177.22.74
  111.177.9.174
-111.177.97.106
  111.179.38.202
  111.179.77.186
-111.18.177.39
+111.18.177.123
  111.18.177.72
-111.18.87.251
  111.180.106.160
  111.180.108.79
  111.180.109.141
-111.180.24.216
  111.182.237.131
  111.184.170.120
  111.184.170.139
@@ -16245,16 +15184,21 @@
  111.185.126.245
  111.185.174.4
  111.185.19.107
+111.185.226.52
+111.185.227.40
+111.185.231.6
  111.185.234.27
  111.185.27.9
  111.185.40.23
  111.185.6.233
+111.185.62.40
  111.186.57.17
  111.187.45.87
  111.19.137.116
  111.19.162.235
  111.19.164.38
  111.19.198.4
+111.19.199.66
  111.19.255.10
  111.19.255.11
  111.19.255.12
@@ -16266,6 +15210,7 @@
  111.19.255.8
  111.19.255.9
  111.192.180.179
+111.192.183.128
  111.192.188.97
  111.192.3.82
  111.192.82.28
@@ -16277,23 +15222,23 @@
  111.194.236.30
  111.194.56.153
  111.196.185.12
+111.196.186.235
+111.197.62.243
  111.198.140.2
  111.198.3.45
  111.198.3.54
  111.198.48.187
  111.198.48.204
  111.198.53.72
-111.198.54.173
-111.199.108.82
  111.199.159.97
  111.2.10.187
  111.2.4.8
  111.20.159.74
  111.20.187.130
+111.20.190.44
+111.20.200.22
  111.20.52.198
-111.20.58.134
  111.200.197.227
-111.200.216.72
  111.200.244.226
  111.201.49.57
  111.202.12.190
@@ -16315,10 +15260,8 @@
  111.204.176.209
  111.204.204.72
  111.204.215.181
-111.204.86.194
  111.205.13.85
  111.205.14.10
-111.205.14.11
  111.205.14.7
  111.205.151.162
  111.205.170.2
@@ -16330,12 +15273,6 @@
  111.206.170.115
  111.206.170.119
  111.206.170.99
-111.206.198.16
-111.206.198.97
-111.206.221.112
-111.206.250.197
-111.206.250.198
-111.206.250.229
  111.206.250.230
  111.206.87.226
  111.207.1.151
@@ -16344,7 +15281,6 @@
  111.207.1.43
  111.207.1.54
  111.207.1.55
-111.207.105.199
  111.207.155.50
  111.207.167.147
  111.207.167.151
@@ -16357,10 +15293,9 @@
  111.21.176.79
  111.21.176.80
  111.21.185.67
-111.21.214.81
  111.21.255.2
  111.21.66.42
-111.21.99.227
+111.22.108.103
  111.22.120.137
  111.22.215.116
  111.22.216.175
@@ -16376,14 +15311,13 @@
  111.223.90.7
  111.224.127.188
  111.224.166.168
+111.224.166.178
  111.224.166.54
  111.224.167.140
-111.224.167.171
  111.224.167.239
-111.224.52.11
+111.224.52.74
  111.224.53.14
-111.224.53.224
-111.224.85.245
+111.224.53.47
  111.225.144.216
  111.225.205.11
  111.225.206.142
@@ -16393,6 +15327,7 @@
  111.225.88.229
  111.225.95.4
  111.226.191.185
+111.226.232.21
  111.226.238.146
  111.227.197.155
  111.227.197.33
@@ -16409,9 +15344,7 @@
  111.229.108.188
  111.229.109.26
  111.229.110.107
-111.229.113.117
  111.229.116.118
-111.229.116.227
  111.229.116.240
  111.229.117.243
  111.229.118.227
@@ -16419,13 +15352,10 @@
  111.229.120.173
  111.229.120.31
  111.229.121.142
-111.229.122.177
  111.229.124.151
  111.229.124.215
-111.229.125.124
  111.229.128.136
  111.229.128.9
-111.229.129.100
  111.229.129.176
  111.229.129.64
  111.229.13.242
@@ -16434,10 +15364,8 @@
  111.229.132.48
  111.229.134.68
  111.229.135.152
-111.229.136.177
  111.229.137.10
  111.229.137.13
-111.229.138.230
  111.229.139.95
  111.229.141.64
  111.229.142.192
@@ -16446,13 +15374,10 @@
  111.229.147.229
  111.229.148.198
  111.229.148.96
-111.229.15.228
  111.229.155.183
-111.229.155.209
  111.229.156.243
  111.229.156.53
  111.229.157.73
-111.229.158.180
  111.229.158.93
  111.229.159.69
  111.229.159.76
@@ -16462,19 +15387,15 @@
  111.229.163.149
  111.229.163.217
  111.229.163.224
-111.229.165.28
  111.229.165.57
  111.229.167.10
  111.229.167.91
  111.229.168.229
-111.229.170.155
  111.229.170.89
  111.229.171.178
-111.229.172.178
  111.229.176.206
  111.229.176.60
  111.229.177.38
-111.229.180.163
  111.229.181.50
  111.229.186.111
  111.229.187.216
@@ -16482,7 +15403,6 @@
  111.229.19.221
  111.229.19.254
  111.229.19.33
-111.229.190.111
  111.229.191.103
  111.229.191.95
  111.229.192.199
@@ -16490,8 +15410,6 @@
  111.229.193.164
  111.229.194.130
  111.229.194.156
-111.229.196.130
-111.229.196.144
  111.229.198.182
  111.229.199.239
  111.229.199.67
@@ -16499,7 +15417,6 @@
  111.229.204.204
  111.229.205.33
  111.229.206.250
-111.229.208.44
  111.229.208.88
  111.229.21.39
  111.229.211.5
@@ -16509,6 +15426,7 @@
  111.229.215.206
  111.229.216.155
  111.229.216.202
+111.229.217.202
  111.229.218.192
  111.229.218.60
  111.229.219.39
@@ -16524,24 +15442,18 @@
  111.229.231.152
  111.229.231.65
  111.229.232.74
-111.229.232.87
  111.229.235.119
  111.229.237.58
  111.229.239.203
  111.229.24.104
-111.229.240.102
  111.229.240.235
  111.229.242.108
  111.229.242.119
-111.229.242.150
  111.229.242.156
  111.229.244.205
  111.229.245.135
  111.229.246.143
  111.229.246.59
-111.229.246.61
-111.229.248.168
-111.229.248.236
  111.229.250.170
  111.229.251.35
  111.229.251.89
@@ -16556,45 +15468,36 @@
  111.229.30.149
  111.229.30.206
  111.229.31.134
-111.229.31.144
  111.229.32.56
  111.229.33.175
  111.229.33.187
  111.229.34.121
  111.229.35.95
-111.229.39.146
  111.229.39.187
  111.229.39.43
-111.229.4.186
  111.229.4.247
  111.229.4.66
  111.229.41.20
-111.229.43.153
-111.229.43.27
  111.229.44.68
-111.229.46.2
  111.229.48.141
  111.229.49.165
  111.229.50.131
  111.229.50.25
  111.229.53.186
-111.229.57.138
  111.229.57.21
  111.229.57.3
  111.229.58.117
  111.229.58.152
-111.229.6.246
  111.229.61.251
  111.229.61.82
  111.229.63.21
  111.229.63.223
-111.229.64.52
  111.229.65.34
  111.229.67.3
  111.229.68.113
  111.229.69.68
  111.229.70.97
-111.229.73.100
+111.229.73.197
  111.229.73.244
  111.229.74.209
  111.229.74.27
@@ -16606,52 +15509,45 @@
  111.229.78.199
  111.229.78.212
  111.229.79.17
-111.229.81.5
-111.229.82.131
-111.229.83.100
  111.229.84.77
  111.229.85.164
  111.229.85.222
  111.229.89.86
+111.229.90.123
  111.229.92.17
  111.229.92.95
  111.229.93.104
  111.229.95.77
  111.229.99.165
-111.229.99.69
-111.23.173.201
+111.23.173.207
+111.23.173.208
  111.23.173.210
  111.23.173.211
  111.23.173.218
  111.23.173.221
  111.23.173.226
-111.23.173.228
+111.23.173.227
  111.23.173.231
  111.23.173.232
  111.23.173.234
  111.23.173.238
  111.23.173.241
  111.23.173.243
-111.23.173.244
-111.23.173.246
-111.23.173.250
  111.23.252.51
  111.230.10.176
  111.230.105.142
  111.230.136.231
-111.230.140.177
  111.230.141.155
+111.230.146.246
  111.230.148.82
  111.230.151.123
  111.230.151.13
-111.230.152.175
  111.230.157.123
  111.230.157.219
  111.230.170.95
  111.230.174.114
  111.230.175.183
  111.230.179.116
-111.230.180.65
  111.230.181.128
  111.230.181.82
  111.230.19.79
@@ -16659,23 +15555,16 @@
  111.230.204.113
  111.230.206.161
  111.230.209.21
-111.230.209.68
  111.230.210.140
  111.230.210.176
-111.230.210.229
  111.230.210.78
  111.230.219.156
  111.230.221.203
-111.230.223.94
  111.230.226.124
  111.230.231.145
-111.230.231.196
-111.230.236.93
  111.230.241.110
  111.230.244.13
-111.230.244.45
  111.230.247.243
-111.230.248.93
  111.230.25.75
  111.230.29.17
  111.230.56.118
@@ -16683,26 +15572,19 @@
  111.230.73.133
  111.230.90.144
  111.230.92.241
-111.231.103.192
  111.231.103.64
  111.231.110.149
-111.231.113.236
  111.231.115.43
  111.231.116.149
  111.231.119.188
  111.231.119.203
  111.231.119.93
  111.231.120.22
-111.231.121.62
  111.231.132.94
-111.231.133.72
  111.231.134.75
-111.231.137.158
  111.231.137.83
  111.231.140.184
  111.231.141.141
-111.231.143.71
-111.231.145.104
  111.231.145.199
  111.231.164.168
  111.231.18.208
@@ -16713,27 +15595,22 @@
  111.231.194.190
  111.231.195.159
  111.231.198.139
+111.231.198.37
  111.231.199.243
  111.231.201.210
  111.231.202.118
  111.231.202.195
  111.231.205.120
-111.231.208.167
-111.231.215.244
  111.231.218.145
  111.231.220.177
  111.231.223.88
-111.231.225.71
  111.231.226.216
  111.231.226.87
  111.231.227.35
  111.231.228.239
  111.231.231.22
-111.231.231.87
  111.231.237.27
  111.231.238.159
-111.231.238.83
-111.231.243.21
  111.231.33.135
  111.231.33.19
  111.231.4.95
@@ -16741,7 +15618,6 @@
  111.231.54.212
  111.231.54.28
  111.231.54.33
-111.231.55.203
  111.231.55.74
  111.231.55.75
  111.231.57.126
@@ -16749,20 +15625,14 @@
  111.231.62.217
  111.231.63.14
  111.231.63.42
-111.231.69.68
-111.231.70.144
-111.231.71.1
  111.231.71.157
  111.231.71.53
-111.231.72.24
  111.231.74.105
  111.231.75.83
  111.231.77.115
  111.231.79.227
-111.231.81.72
  111.231.82.143
  111.231.87.204
-111.231.88.31
  111.231.88.39
  111.231.89.140
  111.231.89.190
@@ -16770,25 +15640,19 @@
  111.231.93.242
  111.231.93.35
  111.231.94.127
-111.231.94.138
-111.235.254.73
  111.235.65.211
  111.240.27.112
  111.241.108.180
  111.241.109.33
-111.241.162.202
  111.241.164.110
  111.241.167.13
-111.241.179.130
  111.241.20.165
  111.241.22.206
-111.241.33.107
  111.241.71.5
  111.242.237.71
  111.242.60.115
  111.243.206.9
  111.243.210.20
-111.243.223.13
  111.243.224.2
  111.243.90.102
  111.246.148.90
@@ -16796,6 +15660,7 @@
  111.246.159.210
  111.246.29.10
  111.246.44.92
+111.246.81.228
  111.246.84.198
  111.246.91.23
  111.246.93.28
@@ -16805,12 +15670,13 @@
  111.248.56.99
  111.249.11.149
  111.249.15.37
+111.249.170.126
  111.250.143.63
-111.250.143.83
  111.250.16.172
  111.250.20.122
  111.250.200.37
  111.250.55.218
+111.250.56.197
  111.250.90.206
  111.251.180.13
  111.251.2.43
@@ -16818,6 +15684,7 @@
  111.251.3.66
  111.251.31.2
  111.251.40.221
+111.251.58.251
  111.252.122.155
  111.252.155.184
  111.252.248.106
@@ -16829,6 +15696,7 @@
  111.253.53.98
  111.253.84.46
  111.254.10.58
+111.254.104.139
  111.254.25.199
  111.254.68.173
  111.254.83.95
@@ -16840,6 +15708,7 @@
  111.255.37.224
  111.255.71.226
  111.255.83.152
+111.26.104.121
  111.26.108.163
  111.26.108.164
  111.26.108.166
@@ -16854,6 +15723,7 @@
  111.26.192.91
  111.26.192.93
  111.26.195.187
+111.26.207.48
  111.26.222.120
  111.26.64.31
  111.26.70.114
@@ -16863,7 +15733,6 @@
  111.30.114.22
  111.30.34.48
  111.30.35.162
-111.30.9.82
  111.30.98.26
  111.31cf4fdae.com
  111.33.112.129
@@ -16894,7 +15763,6 @@
  111.38.123.171
  111.38.123.18
  111.38.123.197
-111.38.123.200
  111.38.123.23
  111.38.13.156
  111.38.173.128
@@ -16981,7 +15849,6 @@
  111.42.74.65
  111.42.89.137
  111.43.104.225
-111.43.106.245
  111.43.111.226
  111.43.115.15
  111.43.174.247
@@ -17004,6 +15871,8 @@
  111.43.223.59
  111.43.223.80
  111.43.3.36
+111.43.41.78
+111.44.251.120
  111.47.112.242
  111.47.171.44
  111.47.18.22
@@ -17015,7 +15884,6 @@
  111.50.30.2
  111.53.119.184
  111.53.120.12
-111.53.155.88
  111.53.192.211
  111.53.192.213
  111.53.98.29
@@ -17031,13 +15899,14 @@
  111.56.79.3
  111.56.79.52
  111.57.0.90
+111.59.120.60
  111.59.149.75
  111.59.152.151
  111.59.156.196
  111.59.174.46
  111.59.184.172
  111.59.189.75
-111.59.236.54
+111.59.48.194
  111.59.62.21
  111.59.65.15
  111.59.67.40
@@ -17050,8 +15919,6 @@
  111.6.79.58
  111.6.96.72
  111.61.101.86
-111.61.154.107
-111.61.177.158
  111.61.196.113
  111.61.223.67
  111.61.234.47
@@ -17069,53 +15936,30 @@
  111.67.159.3
  111.67.192.130
  111.67.192.149
-111.67.192.151
-111.67.193.170
  111.67.193.204
-111.67.193.218
  111.67.193.240
  111.67.194.41
  111.67.194.53
-111.67.194.59
-111.67.195.106
-111.67.195.165
-111.67.195.53
  111.67.195.77
-111.67.195.93
  111.67.196.227
-111.67.196.243
-111.67.196.5
-111.67.197.173
  111.67.197.44
+111.67.198.139
  111.67.198.184
  111.67.199.130
  111.67.199.142
-111.67.199.188
-111.67.199.38
-111.67.199.42
  111.67.199.62
  111.67.199.99
  111.67.20.202
  111.67.200.148
  111.67.201.13
-111.67.201.26
-111.67.202.119
  111.67.202.120
-111.67.202.196
  111.67.202.234
  111.67.202.37
  111.67.203.82
-111.67.203.85
  111.67.204.137
-111.67.204.182
  111.67.204.202
  111.67.204.220
-111.67.205.161
  111.67.205.90
-111.67.206.115
-111.67.206.143
-111.67.206.248
-111.67.206.52
  111.67.207.154
  111.67.207.160
  111.67.207.218
@@ -17125,7 +15969,6 @@
  111.67.92.66
  111.68.101.16
  111.68.101.231
-111.68.103.107
  111.68.103.248
  111.68.105.76
  111.68.108.116
@@ -17136,7 +15979,6 @@
  111.68.27.46
  111.68.31.134
  111.68.96.187
-111.68.98.152
  111.68.98.210
  111.69.49.122
  111.69.49.124
@@ -17147,19 +15989,24 @@
  111.7.82.29
  111.7.82.34
  111.7.82.35
+111.70.1.229
  111.70.1.50
  111.70.4.193
-111.72.193.184
-111.72.193.231
-111.72.193.63
-111.72.194.148
+111.70.4.215
+111.72.193.164
+111.72.193.5
+111.72.193.60
+111.72.193.61
  111.72.194.174
  111.72.194.192
-111.72.194.227
  111.72.194.61
  111.72.194.93
-111.72.195.107
-111.72.196.116
+111.72.195.181
+111.72.195.56
+111.72.195.6
+111.72.196.109
+111.72.196.168
+111.72.196.188
  111.72.197.233
  111.73.0.157
  111.73.0.254
@@ -17171,18 +16018,23 @@
  111.74.11.82
  111.74.153.234
  111.74.155.145
+111.75.137.163
  111.75.149.176
  111.75.149.221
  111.75.158.207
  111.75.159.99
  111.75.164.133
+111.75.164.134
+111.75.164.135
+111.75.164.137
  111.75.164.139
-111.75.164.141
-111.75.164.144
  111.75.164.145
-111.75.164.147
  111.75.164.148
+111.75.164.149
+111.75.164.150
  111.75.164.152
+111.75.164.157
+111.75.164.159
  111.75.210.58
  111.75.222.141
  111.75.226.53
@@ -17195,6 +16047,7 @@
  111.77.250.110
  111.77.250.205
  111.77.250.65
+111.77.251.94
  111.77.77.146
  111.78.210.191
  111.79.197.173
@@ -17205,12 +16058,10 @@
  111.8.34.154
  111.8.57.61
  111.85.191.131
-111.88.108.101
+111.85.191.157
  111.88.42.112
-111.88.42.224
  111.89.169.113
-111.89.177.51
-111.9.56.34
+111.89.208.82
  111.90.138.208
  111.90.139.55
  111.90.140.136
@@ -17245,9 +16096,9 @@
  111.90.159.147
  111.90.177.130
  111.90.187.94
-111.91.162.217
  111.91.71.176
  111.92.104.185
+111.92.104.198
  111.92.104.217
  111.92.106.38
  111.92.106.46
@@ -17256,7 +16107,6 @@
  111.92.109.53
  111.92.139.2
  111.92.164.246
-111.92.164.249
  111.92.164.251
  111.92.189.91
  111.92.240.134
@@ -17270,7 +16120,6 @@
  111.93.109.98
  111.93.121.26
  111.93.145.20
-111.93.156.74
  111.93.169.90
  111.93.175.114
  111.93.2.53
@@ -17286,12 +16135,15 @@
  111.93.62.26
  111.93.71.219
  111.94.37.90
+111.94.8.223
  111.95.108.234
  111.95.141.34
  111.95.161.160
+111.95.17.87
  111.95.174.139
  111.95.203.73
  111.95.27.103
+111.95.27.177
  111.95.27.229
  111.95.27.53
  111.95.27.8
@@ -17303,7 +16155,6 @@
  111qqq.vip
  112-111-vip888.com
  112-365.net
-112.0.170.178
  112.1.148.88
  112.101.100.104
  112.101.74.223
@@ -17318,7 +16169,9 @@
  112.104.149.39
  112.104.191.244
  112.104.85.17
+112.105.209.17
  112.105.37.51
+112.105.39.13
  112.105.49.30
  112.105.57.190
  112.105.63.232
@@ -17338,12 +16191,12 @@
  112.111.162.131
  112.111.163.165
  112.111.163.33
+112.111.172.124
  112.111.172.201
  112.111.173.219
  112.112.13.126
  112.112.60.58
  112.112.7.202
-112.112.95.50
  112.113.13.63
  112.113.159.7
  112.113.217.191
@@ -17352,7 +16205,6 @@
  112.115.105.132
  112.115.210.251
  112.115.247.130
-112.115.40.228
  112.115.51.115
  112.115.90.121
  112.116.119.218
@@ -17362,6 +16214,7 @@
  112.118.138.54
  112.118.152.218
  112.118.182.158
+112.118.185.93
  112.118.192.240
  112.118.227.201
  112.118.236.220
@@ -17376,10 +16229,12 @@
  112.119.212.25
  112.119.219.173
  112.119.241.152
+112.119.32.213
  112.119.36.199
  112.119.84.20
  112.119.87.63
  112.12.35.85
+112.12.6.77
  112.12.63.62
  112.120.0.41
  112.120.119.173
@@ -17402,7 +16257,6 @@
  112.121.10.7
  112.121.164.154
  112.121.184.244
-112.121.225.249
  112.121.247.212
  112.122.102.136
  112.122.189.40
@@ -17421,6 +16275,7 @@
  112.123.18.16
  112.123.187.171
  112.123.226.100
+112.123.54.116
  112.123.61.18
  112.123.62.14
  112.123.62.154
@@ -17428,15 +16283,12 @@
  112.124.32.163
  112.124.46.131
  112.125.89.61
-112.126.102.194
  112.126.65.178
  112.126.81.202
  112.13.101.72
  112.13.101.77
  112.13.101.79
  112.13.101.81
-112.13.200.154
-112.13.91.29
  112.132.0.7
  112.132.144.159
  112.132.144.221
@@ -17451,24 +16303,19 @@
  112.133.194.62
  112.133.206.138
  112.133.206.59
-112.133.207.66
  112.133.209.52
-112.133.215.164
  112.133.219.167
  112.133.222.151
  112.133.222.158
  112.133.232.135
  112.133.232.139
-112.133.236.221
+112.133.236.93
  112.133.244.169
  112.133.251.113
  112.133.254.146
  112.134.114.194
-112.134.64.107
-112.134.64.73
-112.134.67.22
-112.134.67.6
  112.134.70.134
+112.135.205.95
  112.135.3.80
  112.137.164.101
  112.137.95.27
@@ -17502,7 +16349,9 @@
  112.16.75.225
  112.16.81.235
  112.160.10.178
+112.160.133.217
  112.160.152.199
+112.160.159.245
  112.160.209.116
  112.160.228.146bin.sh
  112.160.232.174
@@ -17517,7 +16366,6 @@
  112.161.220.223
  112.161.236.76
  112.161.4.45
-112.161.78.70
  112.161.97.145
  112.162.120.13
  112.162.136.159
@@ -17529,7 +16377,7 @@
  112.162.36.184
  112.162.70.139
  112.162.78.138
-112.163.153.141
+112.162.80.136
  112.163.155.112
  112.163.156.71
  112.163.174.76
@@ -17537,6 +16385,7 @@
  112.163.199.65
  112.163.242.250
  112.163.245.186
+112.164.0.51
  112.164.125.145
  112.164.132.130
  112.164.139.12
@@ -17547,9 +16396,11 @@
  112.164.225.19bin.sh
  112.164.242.29
  112.164.25.228
+112.164.5.105
  112.164.67.234
  112.164.77.5
  112.165.0.158
+112.165.202.117
  112.165.209.225
  112.165.209.227
  112.165.213.135
@@ -17557,6 +16408,7 @@
  112.165.59.245
  112.165.59.30
  112.165.59.63
+112.165.65.93
  112.165.78.23
  112.165.86.212
  112.165.92.131
@@ -17574,6 +16426,7 @@
  112.167.18.28
  112.167.229.237
  112.167.37.73
+112.167.96.77
  112.168.0.84
  112.168.0.84bin.sh
  112.168.124.44
@@ -17583,9 +16436,8 @@
  112.168.22.115
  112.168.228.254
  112.168.251.132
-112.169.152.105
+112.169.231.236
  112.169.86.110
-112.169.9.160
  112.17.104.45
  112.17.107.86
  112.17.119.125
@@ -17621,9 +16473,11 @@
  112.17.91.49
  112.17.94.217
  112.170.113.211
+112.170.157.45
  112.170.225.194
  112.170.225.229
  112.170.225.86
+112.170.226.230
  112.170.59.191
  112.170.97.211
  112.171.215.191
@@ -17638,6 +16492,7 @@
  112.172.54.157
  112.172.58.137
  112.172.6.167
+112.172.66.232
  112.173.1.237
  112.173.17.170
  112.173.206.232
@@ -17655,11 +16510,14 @@
  112.184.17.241
  112.184.179.48
  112.184.206.118
+112.184.214.127
  112.184.222.89
+112.185.115.55
  112.185.128.94
  112.185.168.194
  112.185.187.45
  112.185.190.30
+112.185.223.123
  112.185.242.157
  112.185.50.161
  112.185.50.176
@@ -17667,46 +16525,46 @@
  112.185.64.233
  112.185.72.207
  112.186.124.197
+112.186.175.233
  112.186.197.6
  112.186.199.93
  112.186.228.208
-112.186.243.10
+112.186.228.30
  112.186.3.67
+112.186.37.77
  112.186.41.142
  112.186.46.158
  112.186.78.13
-112.186.79.4
  112.186.91.105
  112.187.166.204
  112.187.166.235
  112.187.166.56
+112.187.211.181
+112.187.238.65
  112.187.239.46
  112.187.240.211
  112.187.6.59
  112.187.84.75
  112.187.85.244
+112.187.90.195
  112.19.174.226
-112.19.176.4
-112.192.154.226
  112.192.159.136
  112.192.159.4
  112.192.160.18
+112.192.160.229
  112.192.195.203
  112.192.199.111
-112.193.157.253
  112.194.135.241
  112.194.138.3
  112.195.167.9
+112.195.58.115
  112.195.82.143
  112.195.82.144
  112.195.83.244
  112.195.85.61
-112.196.106.61
  112.196.13.60
-112.196.149.4
  112.196.16.26
  112.196.16.50
-112.196.183.47
  112.196.26.204
  112.196.28.180
  112.196.45.186
@@ -17714,9 +16572,9 @@
  112.196.64.139
  112.196.72.188
  112.196.9.88
+112.197.0.125
  112.197.113.166
  112.197.136.69
-112.197.139.85
  112.197.174.108
  112.197.179.130
  112.197.187.253
@@ -17727,11 +16585,9 @@
  112.197.235.7
  112.197.75.16
  112.198.103.183
-112.198.207.92
  112.198.215.199
  112.198.230.52
  112.198.246.46
-112.198.43.130
  112.198.64.19
  112.198.77.219
  112.199.118.195
@@ -17745,12 +16601,10 @@
  112.199.65.118
  112.199.76.44
  112.199.98.42
-112.2.219.4
  112.201.176.54
  112.201.66.149
  112.201.91.20
  112.202.160.210
-112.202.190.22
  112.202.39.210
  112.203.97.204
  112.204.183.90
@@ -17762,13 +16616,8 @@
  112.208.72.136
  112.21.162.146
  112.21.162.150
-112.21.188.148
-112.21.188.235
-112.21.188.250
-112.21.191.10
  112.21.191.244
  112.210.59.106
-112.211.148.194
  112.211.85.172
  112.212.109.100
  112.212.122.118
@@ -17818,7 +16667,6 @@
  112.218.66.91
  112.218.73.138
  112.218.78.238
-112.219.169.123
  112.219.201.124
  112.219.70.13
  112.220.106.164
@@ -17828,7 +16676,6 @@
  112.220.236.170
  112.220.236.187
  112.220.249.12
-112.220.29.100
  112.220.89.114
  112.221.132.26
  112.221.19.251
@@ -17836,13 +16683,13 @@
  112.221.9.233
  112.222.126.210
  112.222.150.126
-112.222.199.59
  112.222.222.221
  112.222.61.180
  112.223.232.155
  112.223.96.67
  112.225.103.205
  112.225.110.223
+112.225.132.151
  112.225.133.39
  112.225.15.207
  112.225.151.95
@@ -17852,6 +16699,7 @@
  112.225.197.116
  112.225.201.221
  112.225.204.1
+112.225.232.96
  112.225.246.43
  112.225.26.166
  112.225.28.70
@@ -17859,6 +16707,7 @@
  112.225.33.145
  112.225.36.98
  112.225.38.249
+112.225.43.75
  112.225.52.145
  112.225.52.41
  112.225.57.154
@@ -17873,9 +16722,7 @@
  112.226.119.12
  112.226.122.28
  112.226.138.39
-112.226.174.203
  112.226.180.116
-112.226.180.117
  112.226.186.68
  112.226.200.145
  112.226.200.247
@@ -17896,7 +16743,9 @@
  112.226.75.90
  112.226.79.80
  112.226.80.198
+112.226.83.70
  112.227.129.226
+112.227.252.250
  112.228.107.109
  112.228.11.40
  112.228.15.239
@@ -17930,6 +16779,7 @@
  112.230.48.165
  112.230.7.145
  112.230.87.251
+112.231.167.253
  112.232.137.135
  112.232.194.101
  112.232.95.237
@@ -17945,11 +16795,9 @@
  112.235.217.106
  112.235.234.75
  112.235.244.213
-112.235.248.255
  112.235.42.117
  112.235.52.25
  112.235.69.186
-112.235.94.79
  112.236.61.83
  112.236.63.166
  112.237.105.199
@@ -17958,14 +16806,12 @@
  112.237.127.98
  112.237.127.98bin.sh
  112.237.128.242
-112.237.132.238
  112.237.136.133
  112.237.137.10
  112.237.14.15
  112.237.140.181
  112.237.156.48
  112.237.159.207
-112.237.161.194
  112.237.161.5
  112.237.168.233
  112.237.168.32
@@ -17988,15 +16834,13 @@
  112.237.35.11
  112.237.4.196
  112.237.42.117
-112.237.5.251
  112.237.53.242
  112.237.62.183
-112.237.62.23
  112.237.66.227
+112.237.67.46
  112.237.74.249
  112.237.89.101
  112.238.105.41
-112.238.107.38
  112.238.107.61
  112.238.111.116
  112.238.13.28
@@ -18031,6 +16875,7 @@
  112.238.5.6
  112.238.50.90
  112.238.63.223
+112.238.91.4
  112.239.122.143
  112.239.155.95
  112.239.18.106
@@ -18074,7 +16919,6 @@
  112.242.53.15
  112.242.58.230
  112.242.62.171
-112.242.62.9
  112.242.76.197
  112.242.76.95
  112.242.81.11
@@ -18094,6 +16938,7 @@
  112.245.115.241
  112.245.119.106
  112.245.215.249
+112.245.236.62
  112.245.248.150
  112.245.248.52
  112.245.4.132
@@ -18101,16 +16946,15 @@
  112.245.91.43
  112.245.94.205
  112.246.124.14
+112.246.16.125
  112.246.16.56
  112.246.160.53
  112.246.189.169
  112.246.19.68
  112.246.224.127
  112.246.23.73
-112.246.253.213
  112.246.42.101
  112.246.6.143
-112.246.95.92
  112.247.12.114
  112.247.131.225
  112.247.158.19
@@ -18121,23 +16965,21 @@
  112.247.203.10
  112.247.219.186
  112.247.251.3
-112.247.5.82
  112.247.80.248
  112.247.80.72
  112.247.83.221
  112.247.87.225
  112.248.102.109
  112.248.102.109bin.sh
-112.248.103.107
  112.248.112.139
  112.248.115.154
  112.248.115.180
  112.248.125.144
  112.248.128.224
+112.248.134.113
  112.248.169.138
  112.248.169.138bin.sh
  112.248.175.162
-112.248.177.7
  112.248.179.79
  112.248.184.99
  112.248.195.208
@@ -18150,10 +16992,10 @@
  112.248.75.18
  112.248.85.247
  112.248.85.54
-112.249.103.13
  112.249.114.118
  112.249.114.59
-112.249.182.59
+112.249.122.64
+112.249.184.199
  112.249.191.12
  112.249.194.167
  112.249.204.12
@@ -18164,12 +17006,15 @@
  112.249.239.249
  112.249.239.37
  112.249.243.254
+112.249.253.187
  112.249.254.40
+112.249.26.202
  112.249.27.67
  112.249.33.8
  112.249.34.188
  112.249.40.91
  112.249.44.140
+112.249.56.169
  112.249.6.180
  112.249.61.143
  112.249.64.120
@@ -18177,7 +17022,6 @@
  112.249.76.149
  112.249.79.230
  112.249.82.57
-112.249.86.115
  112.25.11.42
  112.25.138.6
  112.25.170.221
@@ -18197,6 +17041,7 @@
  112.251.174.77
  112.251.52.42
  112.252.109.55
+112.252.196.101
  112.252.213.72
  112.252.220.249
  112.252.239.125
@@ -18205,6 +17050,7 @@
  112.252.74.188
  112.253.2.79
  112.254.114.121
+112.254.115.196
  112.254.13.52
  112.254.140.218
  112.254.177.210
@@ -18223,8 +17069,6 @@
  112.255.128.188
  112.255.130.102
  112.255.130.20
-112.255.131.133
-112.255.15.6
  112.255.157.245
  112.255.170.170
  112.255.173.57
@@ -18239,6 +17083,7 @@
  112.255.28.46
  112.255.32.166
  112.255.33.179
+112.255.34.4
  112.255.35.70
  112.255.51.104
  112.255.6.12
@@ -18250,16 +17095,14 @@
  112.255.84.55
  112.255.87.124
  112.255.87.203
-112.255.9.193
  112.255.92.233
  112.26.113.106
  112.26.160.67
-112.26.204.134
  112.26.26.90
  112.26.44.112
+112.26.7.149
  112.26.92.129
  112.26.92.246
-112.26.98.114
  112.26.98.122
  112.27.115.8
  112.27.121.163
@@ -18355,6 +17198,7 @@
  112.27.83.182
  112.27.83.23
  112.27.85.113
+112.27.87.130
  112.27.87.203
  112.27.87.213
  112.27.88.109
@@ -18377,8 +17221,7 @@
  112.28.98.61
  112.28.98.69
  112.28.98.70
-112.29.149.227
-112.29.149.252
+112.29.156.128
  112.29.170.202
  112.29.170.219
  112.29.170.53
@@ -18389,7 +17232,6 @@
  112.29.172.101
  112.29.172.102
  112.29.172.134
-112.29.172.157
  112.29.172.197
  112.29.172.207
  112.29.172.224
@@ -18407,11 +17249,6 @@
  112.29.238.18
  112.29.66.53
  112.3.20.155
-112.3.25.139
-112.3.29.203
-112.3.30.119
-112.3.30.17
-112.3.30.78
  112.30.1.119
  112.30.1.133
  112.30.1.139
@@ -18500,11 +17337,8 @@
  112.30.133.216
  112.30.133.36
  112.30.136.31
-112.30.139.46
  112.30.185.126
  112.30.195.171
-112.30.210.4
-112.30.210.50
  112.30.213.192
  112.30.35.237
  112.30.37.79
@@ -18544,13 +17378,14 @@
  112.30.4.90bin.sh
  112.30.61.183
  112.30.97.184
-112.31.12.175
+112.31.0.118
  112.31.12.214
  112.31.176.16
  112.31.191.217
  112.31.208.137
  112.31.211.135
  112.31.218.39
+112.31.240.45
  112.31.244.253
  112.31.65.24
  112.31.8.213
@@ -18558,33 +17393,26 @@
  112.31.87.98
  112.33.112.170
  112.33.13.124
-112.33.16.34
  112.33.251.252
  112.33.254.28
  112.33.34.76
-112.33.40.0
  112.33.40.113
-112.33.45.234
  112.33.45.247
  112.33.46.163
  112.33.47.243
  112.33.47.249
  112.33.47.25
  112.33.47.250
-112.33.55.210
-112.35.0.251
  112.35.127.243
  112.35.133.231
+112.35.146.115
  112.35.163.56
  112.35.184.193
  112.35.191.231
  112.35.204.27
  112.35.27.97
  112.35.27.98
-112.35.56.181
  112.35.62.225
-112.35.75.46
-112.35.77.101
  112.4.114.31
  112.4.116.70
  112.4.119.50
@@ -18597,17 +17425,15 @@
  112.44.108.251
  112.44.118.2
  112.47.3.53
+112.47.60.220
  112.48.19.111
  112.48.22.40
  112.48.22.44
  112.48.73.243
-112.48.74.134
-112.48.74.170
  112.49.34.179
  112.49.38.63
  112.5.129.206
  112.5.131.232
-112.5.14.48
  112.5.146.168
  112.5.179.25
  112.5.232.96
@@ -18634,11 +17460,11 @@
  112.53.72.163
  112.53.84.94
  112.54.12.215
+112.54.205.204
  112.54.84.29
  112.54.87.186
  112.6.118.247
  112.6.132.95
-112.6.231.114
  112.6.234.82
  112.6.40.63
  112.6.44.28
@@ -18648,10 +17474,8 @@
  112.64.176.54
  112.64.32.118
  112.64.33.38
-112.64.34.165
  112.64.52.207
  112.65.125.190
-112.65.127.154
  112.65.131.190
  112.65.157.165
  112.65.214.63
@@ -18661,9 +17485,12 @@
  112.66.107.5
  112.66.241.108
  112.66.244.130
+112.66.246.136
  112.66.48.95
  112.66.70.101
+112.66.73.101
  112.66.96.99
+112.67.160.163
  112.67.160.84
  112.67.163.39
  112.67.177.22
@@ -18674,21 +17501,17 @@
  112.69.139.98
  112.70.169.241
  112.70.187.134
-112.72.132.49
  112.72.133.118
  112.72.134.133
  112.72.134.162
-112.72.137.118
  112.72.137.176
  112.72.137.246
  112.72.137.94
-112.72.139.109
+112.72.139.102
  112.72.14.40
  112.72.143.181
  112.72.143.39
  112.72.143.77
-112.72.143.80
-112.72.144.66
  112.72.144.90
  112.72.146.150
  112.72.147.27
@@ -18697,16 +17520,14 @@
  112.72.157.63
  112.72.162.159
  112.72.162.49
-112.72.162.53
  112.72.167.241
  112.72.173.79
  112.72.175.124
  112.72.175.147
  112.72.176.112
-112.72.180.123
+112.72.176.84
  112.72.181.141
  112.72.181.6
-112.72.181.92
  112.72.182.143
  112.72.195.47
  112.72.200.38
@@ -18721,12 +17542,10 @@
  112.72.80.10
  112.72.95.152
  112.72.98.151
-112.73.0.146
  112.73.67.137
-112.74.163.176
  112.74.179.2
-112.74.188.10
  112.74.203.41
+112.74.43.100
  112.74.44.120
  112.74.48.31
  112.74.94.219
@@ -18744,11 +17563,11 @@
  112.78.15.81
  112.78.160.110
  112.78.160.143
-112.78.161.113
  112.78.161.18
  112.78.161.95
  112.78.162.105
  112.78.162.193
+112.78.162.74
  112.78.163.218
  112.78.163.238
  112.78.163.244
@@ -18757,7 +17576,6 @@
  112.78.165.206
  112.78.167.157
  112.78.167.195
-112.78.183.21
  112.78.184.30
  112.78.185.146
  112.78.186.110
@@ -18787,12 +17605,10 @@
  112.80.35.3
  112.80.38.210
  112.81.139.96
-112.81.199.105
  112.81.24.144
  112.81.3.15
  112.82.142.161
  112.82.163.152
-112.82.169.223
  112.82.18.255
  112.82.186.212
  112.82.198.79
@@ -18812,10 +17628,8 @@
  112.84.21.184
  112.84.225.35
  112.84.74.254
-112.84.95.186
  112.85.125.89
  112.85.18.10
-112.85.23.186
  112.85.32.130
  112.85.42.102
  112.85.42.110
@@ -18838,7 +17652,6 @@
  112.85.42.186
  112.85.42.188
  112.85.42.189
-112.85.42.195
  112.85.42.196
  112.85.42.200
  112.85.42.227
@@ -18851,6 +17664,7 @@
  112.85.42.47
  112.85.42.53
  112.85.42.67
+112.85.42.72
  112.85.42.73
  112.85.42.81
  112.85.42.85
@@ -18863,18 +17677,21 @@
  112.86.163.153
  112.86.163.224
  112.86.164.46
+112.86.167.192
  112.86.228.194
+112.86.252.171
  112.87.107.65
  112.87.125.51
  112.87.125.54
  112.87.136.109
  112.87.206.195
+112.87.212.169
  112.87.252.15
  112.87.72.83
-112.9.81.205
  112.9.82.185
  112.9.83.50
  112.90.131.43
+112.90.198.87
  112.90.217.199
  112.91.120.20
  112.91.135.184
@@ -18886,7 +17703,6 @@
  112.91.81.100
  112.92.133.33
  112.93.2.231
-112.93.225.125
  112.93.25.237
  112.94.161.92
  112.95.135.77
@@ -18896,8 +17712,10 @@
  112.95.225.158
  112.98.100.110
  112.98.104.30
+112.98.111.138
  112.98.126.100
  112.98.126.98
+112.98.97.222
  112.99.195.110
  1121312.000webhostapp.com
  1123351-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -18911,19 +17729,17 @@
  113.1.153.118
  113.1.165.147
  113.10.154.11
-113.10.156.128
-113.10.158.214
  113.10.207.50
  113.100.254.141
  113.100.254.178
  113.100.255.174
  113.100.255.205
  113.101.246.153
-113.101.96.45
  113.102.160.165
  113.102.160.200
  113.102.160.253
  113.102.161.126
+113.102.161.93
  113.102.163.168
  113.102.18.154
  113.102.18.238
@@ -18931,20 +17747,16 @@
  113.102.19.47
  113.102.19.73
  113.102.19.92
-113.103.226.52
+113.102.35.43
+113.102.36.185
  113.103.233.207
  113.103.57.113
-113.104.190.122
  113.104.204.38
  113.104.218.165
-113.104.219.55
-113.104.240.99
  113.104.242.172
-113.104.243.181
  113.105.137.241
  113.105.192.82
  113.105.8.58
-113.105.80.34
  113.105.94.66
  113.106.0.114
  113.106.11.107
@@ -18960,7 +17772,6 @@
  113.107.166.9
  113.107.215.28
  113.107.244.124
-113.107.4.198
  113.107.53.119
  113.108.126.1
  113.108.126.2
@@ -18971,7 +17782,6 @@
  113.108.126.29
  113.108.126.5
  113.108.127.1
-113.108.127.11
  113.108.127.16
  113.108.127.17
  113.108.127.18
@@ -18999,12 +17809,12 @@
  113.11.3.30
  113.11.34.129
  113.11.64.62
+113.110.165.146
  113.110.165.250
-113.110.166.55
  113.110.186.87
+113.110.192.16
  113.110.200.252
  113.110.201.139
-113.110.201.193
  113.110.214.146
  113.110.214.64
  113.110.214.84
@@ -19016,49 +17826,54 @@
  113.110.227.52
  113.110.228.205
  113.110.230.28
-113.110.236.177
  113.110.236.252
-113.110.245.147
  113.110.40.95
  113.110.42.19
  113.111.128.102
  113.111.35.144
  113.111.42.255
  113.111.43.21
-113.116.121.248
+113.116.10.85
  113.116.128.144
-113.116.145.188
+113.116.176.188
  113.116.177.211
+113.116.178.197
  113.116.182.252
-113.116.218.107
-113.116.218.156
-113.116.225.210
+113.116.192.248
+113.116.195.178
+113.116.216.241
+113.116.227.165
+113.116.245.178
+113.116.245.185
  113.116.247.126
-113.116.247.241
+113.116.33.49
  113.116.41.128
  113.116.41.191
  113.116.42.139
-113.116.58.149
+113.116.5.162
+113.116.56.239
+113.116.57.126
+113.116.72.98
  113.116.88.233
-113.116.90.235
-113.116.91.221
+113.116.88.93
+113.116.9.221
  113.116.91.38
  113.117.12.190
  113.117.13.15
  113.117.180.217
  113.117.180.229
  113.118.114.61
+113.118.121.147
  113.118.123.24
-113.118.134.2
-113.118.134.36
  113.118.16.128
-113.118.197.127
  113.118.24.185
  113.118.249.183
+113.118.25.31
  113.118.44.13
  113.118.46.119
  113.118.47.70
-113.119.199.106
+113.118.86.212
+113.119.164.30
  113.119.58.245
  113.119.58.89
  113.119.68.16
@@ -19070,25 +17885,16 @@
  113.12.76.131
  113.12.77.18
  113.12.81.116
+113.120.32.76
  113.120.46.121
  113.120.74.61
  113.121.76.222
  113.122.40.174
  113.123.140.95
-113.125.101.184
-113.125.117.48
  113.125.119.209
-113.125.120.149
-113.125.13.14
-113.125.132.53
-113.125.159.5
-113.125.178.204
  113.125.21.66
  113.125.44.66
-113.125.44.80
  113.125.67.184
-113.125.82.222
-113.125.98.206
  113.128.104.82
  113.128.128.128
  113.128.129.31
@@ -19173,6 +17979,7 @@
  113.131.183.10
  113.131.183.11
  113.131.183.12
+113.131.183.13
  113.131.183.15
  113.131.183.17
  113.131.183.18
@@ -19203,17 +18010,15 @@
  113.131.224.197
  113.133.176.204
  113.133.224.68
-113.133.227.153
+113.133.227.43
  113.134.203.6
  113.134.203.8
  113.134.211.242
  113.134.211.28
  113.134.211.42
  113.134.240.218
-113.137.36.187
  113.137.39.88
  113.138.208.127
-113.14.106.53
  113.14.110.79
  113.14.131.117
  113.14.180.207
@@ -19226,6 +18031,7 @@
  113.140.1.179
  113.140.17.6
  113.140.20.74
+113.140.212.96
  113.140.215.85
  113.140.22.98
  113.140.248.200
@@ -19233,10 +18039,8 @@
  113.140.29.46
  113.140.4.194
  113.140.48.82
-113.140.6.3
  113.140.80.174
  113.141.166.197
-113.141.166.40
  113.141.45.46
  113.141.64.146
  113.141.64.224
@@ -19246,7 +18050,6 @@
  113.141.65.61
  113.141.66.163
  113.141.66.18
-113.141.66.255
  113.141.66.96
  113.141.67.127
  113.141.67.162
@@ -19263,9 +18066,6 @@
  113.141.70.227
  113.141.70.240
  113.141.70.91
-113.142.134.193
-113.142.144.3
-113.142.54.175
  113.142.58.155
  113.142.72.118
  113.142.72.2
@@ -19276,6 +18076,7 @@
  113.15.178.10
  113.15.205.127
  113.15.230.68
+113.150.96.253
  113.16.152.229
  113.16.155.254
  113.16.157.98
@@ -19290,7 +18091,6 @@
  113.160.130.116
  113.160.130.13
  113.160.133.8
-113.160.142.10
  113.160.142.68
  113.160.158.39
  113.160.172.75
@@ -19303,11 +18103,11 @@
  113.160.219.221
  113.160.223.227
  113.160.224.196
-113.160.226.178
  113.160.234.147
  113.160.234.160
  113.160.235.194
  113.160.235.49
+113.160.244.144
  113.160.247.115
  113.160.247.166
  113.160.247.180
@@ -19315,6 +18115,7 @@
  113.160.247.207
  113.160.248.80
  113.160.251.246
+113.160.37.32
  113.160.54.78
  113.160.58.230
  113.161.0.206
@@ -19323,6 +18124,7 @@
  113.161.128.192
  113.161.128.28
  113.161.129.13
+113.161.130.234
  113.161.146.24
  113.161.148.81
  113.161.151.17
@@ -19341,12 +18143,9 @@
  113.161.234.101
  113.161.242.221
  113.161.31.221
-113.161.32.14
-113.161.39.205
  113.161.4.51
  113.161.44.87
  113.161.45.89
-113.161.49.121
  113.161.52.89
  113.161.53.147
  113.161.58.249
@@ -19364,6 +18163,7 @@
  113.161.88.252
  113.161.88.68
  113.161.92.91
+113.162.186.251
  113.162.37.191
  113.162.39.23
  113.162.55.133
@@ -19371,11 +18171,7 @@
  113.163.157.250
  113.163.161.77
  113.163.90.161
-113.164.229.67
-113.164.246.10
-113.164.246.6
  113.164.79.177
-113.165.123.202
  113.165.204.168
  113.165.36.187
  113.166.16.37
@@ -19384,22 +18180,19 @@
  113.167.107.167
  113.167.166.99
  113.167.167.251
-113.167.36.78
  113.168.196.217
-113.169.135.11
  113.169.25.105
  113.169.251.233
  113.169.39.16
  113.17.105.57
  113.17.35.73
  113.17.37.248
-113.170.106.150
  113.170.132.75
  113.170.146.90
  113.170.170.76
+113.170.172.4
  113.170.30.237
  113.170.36.88
-113.170.5.82
  113.172.100.95
  113.172.112.176
  113.172.115.228
@@ -19412,18 +18205,20 @@
  113.172.217.99
  113.172.224.166
  113.172.226.30
+113.172.231.11
  113.172.240.166
  113.172.244.130
  113.172.253.3
  113.172.76.168
-113.173.117.233
+113.173.101.180
  113.173.127.86
-113.173.155.171
  113.173.167.146
  113.173.169.103
+113.173.174.83
+113.173.181.83
  113.173.218.80
-113.173.233.138
  113.173.28.42
+113.173.57.139
  113.173.59.91
  113.173.67.103
  113.175.67.68
@@ -19432,6 +18227,7 @@
  113.176.195.107
  113.176.195.145
  113.176.61.244
+113.176.62.182
  113.176.81.46
  113.176.88.10
  113.176.88.18
@@ -19440,7 +18236,6 @@
  113.177.27.217
  113.178.176.149
  113.178.211.118
-113.179.156.155
  113.180.148.152
  113.180.28.130
  113.180.29.178
@@ -19453,12 +18248,9 @@
  113.183.134.63
  113.183.238.33
  113.184.149.136
-113.184.18.75
  113.186.180.10
  113.186.80.181
-113.187.151.135
  113.187.48.180
-113.187.77.60
  113.188.41.201
  113.188.51.219
  113.189.16.177
@@ -19467,7 +18259,7 @@
  113.190.107.84
  113.190.130.212
  113.190.145.233
-113.190.224.38
+113.190.212.16
  113.190.235.196
  113.190.235.28
  113.190.235.39
@@ -19478,27 +18270,23 @@
  113.190.254.180
  113.190.254.245
  113.190.255.114
-113.190.255.158
  113.190.40.199
  113.190.6.226
-113.190.61.34
-113.193.243.35
  113.193.30.171
  113.193.30.172
  113.193.30.174
  113.193.6.34
+113.194.128.22
  113.194.128.51
+113.194.129.157
  113.194.129.188
-113.194.131.125
-113.194.136.101
+113.194.137.244
  113.194.142.237
  113.195.133.247
  113.195.156.20
+113.195.163.172
  113.195.164.178
  113.195.164.222
-113.195.164.239
-113.195.166.25
-113.195.169.199
  113.195.170.82
  113.195.207.146
  113.195.243.178
@@ -19509,19 +18297,19 @@
  113.199.108.13
  113.199.146.137
  113.199.199.84
-113.199.41.211
  113.2.100.22
-113.2.165.250
  113.2.243.45
  113.20.106.129
+113.20.106.228
+113.20.106.3
  113.20.123.31
+113.20.123.72
  113.20.86.138
  113.200.100.211
  113.200.105.23
  113.200.156.180
  113.200.161.155
  113.200.201.29
-113.200.212.170
  113.200.219.2
  113.200.236.133
  113.200.51.222
@@ -19530,9 +18318,7 @@
  113.200.58.251
  113.200.60.74
  113.200.65.138
-113.201.50.17
  113.201.61.178
-113.203.221.206
  113.203.233.226
  113.203.234.66
  113.203.236.211
@@ -19541,13 +18327,11 @@
  113.203.240.87
  113.204.205.66
  113.204.228.66
-113.205.106.157
  113.205.51.241
  113.206.45.80
  113.207.26.159
  113.207.27.88
  113.207.43.18
-113.207.68.70
  113.207.68.87
  113.208.112.148
  113.208.119.154
@@ -19555,13 +18339,14 @@
  113.209.128.114
  113.209.128.30
  113.209.197.236
+113.21.112.236
  113.21.231.98
  113.21.64.23
  113.21.70.127
  113.21.73.168
  113.21.73.9
  113.21.74.199
-113.210.16.254
+113.210.97.56
  113.212.123.204
  113.212.127.35
  113.212.162.155
@@ -20126,8 +18911,6 @@
  113.22.93.217
  113.22.93.220
  113.22.95.180
-113.220.229.121
-113.220.57.111
  113.221.13.204
  113.221.50.64
  113.221.56.180
@@ -20151,21 +18934,21 @@
  113.226.215.73
  113.226.56.119
  113.227.14.78
-113.227.174.36
  113.227.202.180
  113.227.224.52
  113.227.42.149
  113.227.42.149bin.sh
  113.227.86.47
  113.227.90.169
+113.228.107.91
  113.228.181.110
  113.228.208.78
  113.228.221.103
  113.228.40.112
+113.228.59.180
  113.228.66.10
  113.228.80.5
  113.228.80.6
-113.229.0.5
  113.229.105.61
  113.229.185.186
  113.229.24.180
@@ -20205,18 +18988,17 @@
  113.230.209.47
  113.230.237.7
  113.231.110.183
-113.231.122.31
  113.231.131.211
  113.231.20.201
+113.231.237.140
+113.231.252.60
  113.231.48.125
  113.231.50.133
  113.231.93.168
  113.232.165.16
  113.232.227.122
-113.232.232.144
  113.232.24.155
  113.232.241.144
-113.232.242.101
  113.232.26.204
  113.232.29.158
  113.233.114.175
@@ -20229,13 +19011,13 @@
  113.234.47.2
  113.235.104.232
  113.235.115.57
-113.235.123.212
  113.235.161.246
  113.235.163.252
  113.235.194.46
  113.235.199.68
  113.235.203.249
  113.235.203.34
+113.235.204.10
  113.235.28.132
  113.235.8.129
  113.235.99.92
@@ -20243,7 +19025,6 @@
  113.236.150.46
  113.236.166.68
  113.236.176.223
-113.236.225.63
  113.236.64.106
  113.236.64.8
  113.236.66.41
@@ -20260,7 +19041,6 @@
  113.238.15.216
  113.239.127.134
  113.239.189.201
-113.239.192.154
  113.239.215.200
  113.239.29.29
  113.239.7.94
@@ -20273,14 +19053,13 @@
  113.242.223.181
  113.243.130.13
  113.245.184.136
+113.245.188.247
  113.245.191.254
  113.246.243.65
  113.247.233.22
  113.247.238.163
-113.247.250.238
  113.248.192.30
  113.250.0.149
-113.250.229.236
  113.251.27.82
  113.252.103.136
  113.252.105.252
@@ -20288,7 +19067,6 @@
  113.252.222.73
  113.252.225.116
  113.252.23.104
-113.252.231.228
  113.252.249.104
  113.252.8.114
  113.252.87.214
@@ -20298,7 +19076,7 @@
  113.253.226.112
  113.253.229.211
  113.253.26.98
-113.253.62.152
+113.253.5.120
  113.254.114.93
  113.254.178.224
  113.254.178.73
@@ -20318,7 +19096,6 @@
  113.255.245.11
  113.255.246.244
  113.255.247.221
-113.255.76.253
  113.255.78.197
  113.26.251.153
  113.28.254.132
@@ -20332,25 +19109,20 @@
  113.31.104.89
  113.31.105.250
  113.31.107.34
-113.31.107.57
-113.31.108.14
  113.31.109.63
  113.31.110.101
-113.31.110.31
  113.31.114.207
  113.31.115.137
  113.31.117.68
  113.31.118.80
  113.31.125.11
  113.31.125.177
-113.31.126.61
  113.31.147.54
  113.4.124.82
  113.4.131.194
  113.4.20.33
  113.4.233.150
  113.4.250.58
-113.4.252.163
  113.4.4.118
  113.4.4.16
  113.4.83.92
@@ -20362,13 +19134,13 @@
  113.52.135.125
  113.52.197.22
  113.53.112.167
+113.53.12.39
  113.53.121.31
+113.53.136.253
  113.53.150.8
  113.53.157.85
  113.53.162.70
-113.53.172.56
  113.53.185.252
-113.53.190.73
  113.53.208.213
  113.53.21.68
  113.53.212.217
@@ -20376,7 +19148,6 @@
  113.53.231.34
  113.53.238.195
  113.53.255.222
-113.53.29.172
  113.53.29.185
  113.53.29.218
  113.53.29.228
@@ -20394,8 +19165,8 @@
  113.53.85.43
  113.53.91.12
  113.53.91.214
+113.53.94.213
  113.53.94.235
-113.54.156.94
  113.54.216.116
  113.56.107.67
  113.56.119.118
@@ -20408,19 +19179,20 @@
  113.57.166.210
  113.57.170.50
  113.57.222.88
-113.57.222.97
  113.57.252.72
  113.58.177.147
  113.58.228.48
  113.59.136.39
  113.59.144.42
  113.59.144.68
+113.59.145.2
  113.59.151.110
  113.59.153.6
  113.59.154.15
  113.59.155.11
  113.59.156.167
  113.59.156.244
+113.59.156.77
  113.59.160.42
  113.59.164.135
  113.59.164.137
@@ -20431,7 +19203,9 @@
  113.59.166.77
  113.59.168.103
  113.59.168.113
+113.59.174.108
  113.59.176.34
+113.59.181.6
  113.59.181.79
  113.59.187.154
  113.59.189.90
@@ -20450,14 +19224,16 @@
  113.61.204.190
  113.61.205.26
  113.61.206.35
+113.61.206.40
  113.61.249.11
  113.61.66.94
  113.62.127.218
  113.62.180.132
+113.65.160.34
  113.65.21.108
-113.65.8.221
  113.66.228.13
  113.66.254.100
+113.66.254.107
  113.66.254.193
  113.66.254.213
  113.66.254.78
@@ -20465,11 +19241,10 @@
  113.66.255.200
  113.66.255.72
  113.67.166.123
-113.67.18.40
+113.67.18.130
  113.67.18.74
  113.67.29.29
  113.67.29.66
-113.68.151.99
  113.68.193.55
  113.69.130.22
  113.69.131.223
@@ -20478,7 +19253,10 @@
  113.7.40.165
  113.7.63.23
  113.70.133.250
+113.70.147.28
+113.70.240.83
  113.70.36.230
+113.70.57.159
  113.70.59.199
  113.70.59.29
  113.70.59.98
@@ -20495,9 +19273,8 @@
  113.71.210.249
  113.71.210.42
  113.71.211.53
-113.71.61.228
  113.72.120.212
-113.72.123.98
+113.72.123.36
  113.72.20.241
  113.72.204.24
  113.72.204.255
@@ -20506,10 +19283,8 @@
  113.72.21.250
  113.72.23.92
  113.74.26.114
-113.75.14.3
  113.76.151.113
  113.76.151.185
-113.76.88.166
  113.77.100.21
  113.77.24.189
  113.77.25.15
@@ -20517,7 +19292,6 @@
  113.77.25.46
  113.77.26.141
  113.77.26.72
-113.78.66.199
  113.78.66.42
  113.78.66.69
  113.8.124.148
@@ -20528,14 +19302,14 @@
  113.8.237.151
  113.8.239.30
  113.80.226.252
-113.81.199.232
+113.81.209.55
  113.81.210.236
+113.81.234.98
  113.81.60.123
  113.81.60.163
  113.81.60.188
  113.81.60.62
  113.81.60.78
-113.83.148.186
  113.83.150.106
  113.83.151.196
  113.83.151.246
@@ -20544,70 +19318,71 @@
  113.85.254.163
  113.86.205.107
  113.87.103.48
+113.87.145.103
  113.87.163.135
-113.87.165.124
  113.87.175.3
-113.87.193.50
+113.87.193.244
  113.87.201.38
-113.87.203.18
-113.87.248.15
+113.87.225.171
  113.87.32.101
  113.87.32.54
-113.87.88.122
-113.88.105.203
-113.88.12.252
+113.88.107.105
+113.88.115.172
  113.88.13.201
-113.88.142.43
-113.88.164.108
+113.88.154.204
+113.88.154.228
  113.88.164.96
-113.88.165.198
  113.88.165.72
-113.88.165.92
  113.88.166.197
+113.88.167.92
  113.88.208.190
  113.88.209.235
-113.88.210.2
+113.88.209.9
+113.88.210.239
  113.88.210.82
  113.88.211.191
  113.88.228.13
-113.88.243.107
  113.88.249.4
  113.88.80.19
  113.88.81.189
-113.89.246.61
  113.89.247.143
-113.89.34.216
+113.89.32.238
+113.89.32.66
  113.89.34.251
  113.89.34.252
+113.89.34.253
  113.89.34.254
  113.89.34.91
+113.89.40.61
  113.89.43.215
  113.89.52.182
+113.89.53.30
  113.89.53.39
  113.89.53.86
-113.89.55.195
  113.89.55.229
-113.89.71.102
  113.89.71.238
+113.9.104.32
  113.9.19.122
  113.9.19.147
  113.9.233.14
+113.90.177.142
+113.90.177.251
+113.90.238.241
  113.90.245.165
  113.90.246.167
  113.90.246.92
  113.90.92.2
  113.91.208.107
-113.91.208.189
  113.91.209.136
  113.91.209.8
  113.91.210.104
  113.91.211.101
  113.91.211.255
-113.91.32.182
+113.92.222.98
  113.92.223.182
+113.92.223.27
  113.92.223.6
  113.93.224.56
-113.93.240.143
  113.93.241.250
  113.93.241.94
  113.94.137.170
@@ -20617,7 +19392,6 @@
  113.94.193.201
  113.94.193.206
  113.95.154.112
-113.95.155.60
  113.96.154.17
  113.96.154.24
  113.96.154.26
@@ -20625,7 +19399,6 @@
  113.96.83.20
  113.96.83.25
  113.98.116.170
-113.98.116.196
  113.98.193.58
  113.98.194.2
  113.99.218.208
@@ -20635,21 +19408,20 @@
  114.100.99.98
  114.103.21.67
  114.103.88.44
+114.104.136.194
  114.104.139.177
  114.104.151.53
  114.104.164.233
  114.104.189.119
-114.106.136.147
-114.106.136.203
+114.104.227.184
  114.106.195.108
  114.108.130.135
  114.108.140.37
  114.108.150.156
-114.108.167.109
  114.108.177.104
  114.108.177.125
  114.108.177.176
-114.108.181.139
+114.108.202.208
  114.108.47.171
  114.108.67.230
  114.109.172.105
@@ -20673,13 +19445,14 @@
  114.113.127.182
  114.113.237.67
  114.113.238.22
-114.113.68.112
  114.115.142.158
  114.115.153.140
  114.115.186.58
  114.115.186.74
  114.115.237.169
  114.116.13.215
+114.116.133.77
+114.116.17.42
  114.116.195.106
  114.116.198.143
  114.116.199.175
@@ -20702,11 +19475,8 @@
  114.118.16.78
  114.118.5.130
  114.118.5.243
-114.118.7.134
-114.118.7.153
  114.118.97.195
  114.124.130.41
-114.124.193.6
  114.124.210.32
  114.129.17.51
  114.129.219.63
@@ -20720,6 +19490,7 @@
  114.134.186.59
  114.134.187.130
  114.134.187.236
+114.134.188.29
  114.134.191.194
  114.134.93.202
  114.139.194.251
@@ -20743,7 +19514,6 @@
  114.142.232.28
  114.143.100.102
  114.143.123.198
-114.143.141.98
  114.143.184.210
  114.143.230.186
  114.143.240.150
@@ -20753,7 +19523,6 @@
  114.151.120.4
  114.151.50.223
  114.151.83.202
-114.152.172.96
  114.156.234.88
  114.157.141.91
  114.160.83.4
@@ -20763,12 +19532,10 @@
  114.179.13.180
  114.179.40.155
  114.182.181.139
-114.186.212.244
  114.189.209.72
  114.198.172.213
  114.198.172.29
  114.199.111.162
-114.199.112.138
  114.199.113.38
  114.199.113.78
  114.199.116.9
@@ -20782,15 +19549,11 @@
  114.199.176.230
  114.199.192.103
  114.199.194.36
-114.199.195.51
-114.199.200.89
-114.199.204.204
  114.199.204.37
+114.199.204.91
  114.199.215.31
-114.199.223.250
  114.199.232.166
  114.199.241.41
-114.199.247.45
  114.199.251.156
  114.199.253.235
  114.199.37.43
@@ -20804,6 +19567,7 @@
  114.204.214.32
  114.204.218.154
  114.205.154.67
+114.205.201.125
  114.205.36.141
  114.206.60.98
  114.207.139.203
@@ -20813,11 +19577,9 @@
  114.216.155.235
  114.216.181.201
  114.216.46.217
-114.218.11.15
  114.218.141.108
  114.218.17.116
  114.218.200.143
-114.218.229.152
  114.218.57.215
  114.218.91.66
  114.219.127.116
@@ -20826,21 +19588,19 @@
  114.219.18.147
  114.219.191.157
  114.220.126.80
-114.220.238.72
  114.220.63.219
  114.220.74.62
  114.220.76.22
  114.220.76.79
  114.221.23.73
  114.221.238.254
-114.222.246.206
+114.222.25.112
  114.223.48.158
  114.223.85.115
  114.224.212.99
  114.225.69.129
  114.226.129.99
  114.226.139.37
-114.226.151.246
  114.226.172.49
  114.226.2.114
  114.226.214.168
@@ -20851,15 +19611,11 @@
  114.226.233.227
  114.226.234.139
  114.226.234.153
-114.226.244.223
-114.226.244.230
  114.226.249.233
  114.226.249.248
  114.226.255.129
  114.226.26.52
  114.226.26.86
-114.226.35.142
-114.226.35.160
  114.226.55.242
  114.226.78.244
  114.226.80.165
@@ -20874,11 +19630,6 @@
  114.226.89.79
  114.227.0.27
  114.227.1.22
-114.227.111.101
-114.227.111.136
-114.227.111.202
-114.227.116.158
-114.227.159.191
  114.227.26.138
  114.227.28.178
  114.227.30.70
@@ -20886,6 +19637,7 @@
  114.227.65.155
  114.228.106.52
  114.228.133.159
+114.228.137.213
  114.228.141.252
  114.228.141.53
  114.228.142.27
@@ -20894,6 +19646,7 @@
  114.228.193.175
  114.228.201.102
  114.228.205.209
+114.228.225.171
  114.228.248.85
  114.228.25.10
  114.228.25.197
@@ -20917,40 +19670,45 @@
  114.229.46.142
  114.229.47.36
  114.23.109.123
-114.23.122.174
-114.23.225.240
  114.23.246.137
  114.23.254.130
+114.230.120.66
  114.230.177.137
  114.230.177.227
  114.231.104.29
-114.231.105.117
  114.231.105.203
-114.231.108.24
+114.231.107.251
+114.231.107.69
  114.231.111.199
  114.231.111.66
  114.231.186.90
  114.231.243.176
-114.231.30.34
  114.231.41.109
-114.231.41.117
+114.231.41.198
  114.231.41.22
-114.231.41.239
+114.231.41.245
  114.231.41.252
+114.231.42.159
  114.231.42.223
  114.231.44.155
+114.231.45.101
  114.231.45.165
  114.231.45.223
  114.231.46.193
-114.231.46.221
-114.231.46.50
-114.231.8.195
-114.231.8.37
+114.231.46.20
+114.231.46.225
+114.231.46.75
+114.231.46.95
+114.231.8.101
+114.231.8.147
+114.231.8.205
  114.231.8.83
-114.231.82.219
+114.232.109.108
+114.232.109.18
  114.232.109.211
-114.232.109.240
+114.232.109.215
  114.232.110.221
+114.232.110.25
  114.232.127.63
  114.232.161.200
  114.232.176.199
@@ -20990,8 +19748,8 @@
  114.234.166.171
  114.234.166.30
  114.234.167.0
+114.234.178.249
  114.234.180.59
-114.234.185.15
  114.234.19.216
  114.234.192.49
  114.234.193.2
@@ -21021,7 +19779,6 @@
  114.235.0.140
  114.235.114.16
  114.235.122.197
-114.235.129.134
  114.235.13.0
  114.235.13.137
  114.235.13.34
@@ -21043,7 +19800,6 @@
  114.235.231.214
  114.235.24.79
  114.235.248.241
-114.235.250.58
  114.235.251.63
  114.235.252.140
  114.235.253.8
@@ -21072,8 +19828,6 @@
  114.236.73.95
  114.236.93.187
  114.237.134.170
-114.237.138.49
-114.237.140.244
  114.237.17.160
  114.237.63.85
  114.238.101.231
@@ -21088,7 +19842,6 @@
  114.239.104.201
  114.239.107.105
  114.239.108.104
-114.239.108.127
  114.239.109.24
  114.239.111.175
  114.239.112.118
@@ -21106,6 +19859,7 @@
  114.239.175.88
  114.239.192.98
  114.239.195.13
+114.239.2.53
  114.239.209.28
  114.239.214.102
  114.239.222.2
@@ -21135,11 +19889,8 @@
  114.240.96.162
  114.241.252.247
  114.242.113.242
-114.242.117.12
  114.242.125.163
  114.242.125.190
-114.242.139.19
-114.242.153.10
  114.242.153.3
  114.242.16.32
  114.242.185.164
@@ -21155,21 +19906,23 @@
  114.246.34.150
  114.246.34.152
  114.246.35.161
+114.246.70.114
  114.246.9.18
  114.247.215.219
  114.247.226.19
  114.247.25.18
  114.247.39.51
-114.247.63.190
  114.247.79.179
  114.248.58.93
  114.249.184.19
  114.25.133.159
-114.25.137.164
  114.25.137.17
  114.25.156.250
  114.25.158.69
+114.25.160.245
+114.25.161.61
  114.25.30.185
+114.25.31.20
  114.25.36.43
  114.250.162.108
  114.250.24.122
@@ -21188,15 +19941,14 @@
  114.255.216.123
  114.255.246.203
  114.255.90.162
+114.27.131.58
  114.27.160.69
-114.27.208.215
  114.27.236.200
  114.27.243.61
  114.27.32.223
  114.27.6.96
  114.29.120.71
  114.29.236.136
-114.29.237.172
  114.29.237.220
  114.29.238.53
  114.29.243.102
@@ -21239,6 +19991,7 @@
  114.32.164.76
  114.32.170.66
  114.32.177.142
+114.32.180.176
  114.32.180.21
  114.32.184.236
  114.32.184.76
@@ -21261,6 +20014,7 @@
  114.32.204.140
  114.32.204.17
  114.32.205.167
+114.32.209.226
  114.32.209.239
  114.32.21.95
  114.32.212.10
@@ -21270,6 +20024,7 @@
  114.32.213.34
  114.32.215.108
  114.32.215.112
+114.32.215.113
  114.32.217.189
  114.32.217.33
  114.32.218.125
@@ -21277,7 +20032,6 @@
  114.32.218.233
  114.32.219.163
  114.32.219.76
-114.32.22.131
  114.32.224.5
  114.32.225.4
  114.32.226.14
@@ -21359,6 +20113,7 @@
  114.32.96.161
  114.32.98.165
  114.32.98.252
+114.32.98.33
  114.32.98.47
  114.33.0.147
  114.33.10.129
@@ -21386,7 +20141,6 @@
  114.33.115.38
  114.33.118.147
  114.33.119.227
-114.33.119.253
  114.33.12.185
  114.33.120.115
  114.33.120.213
@@ -21394,7 +20148,6 @@
  114.33.121.76
  114.33.122.99
  114.33.123.146
-114.33.123.198
  114.33.123.205
  114.33.123.233
  114.33.124.125
@@ -21425,7 +20178,6 @@
  114.33.151.224
  114.33.151.248
  114.33.152.115
-114.33.153.185
  114.33.153.244
  114.33.153.246
  114.33.154.33
@@ -21438,13 +20190,13 @@
  114.33.163.100
  114.33.163.184
  114.33.165.64
-114.33.167.191
  114.33.168.48
  114.33.169.167
  114.33.169.229
  114.33.170.134
  114.33.170.143
  114.33.170.89
+114.33.171.182
  114.33.172.131
  114.33.172.244
  114.33.172.9
@@ -21467,7 +20219,6 @@
  114.33.186.136
  114.33.186.141
  114.33.186.51
-114.33.189.37
  114.33.19.116
  114.33.191.205
  114.33.192.101
@@ -21530,7 +20281,6 @@
  114.33.237.11
  114.33.237.155
  114.33.239.90
-114.33.24.101
  114.33.241.66
  114.33.243.109
  114.33.243.246
@@ -21550,9 +20300,9 @@
  114.33.252.57
  114.33.253.140
  114.33.254.248
+114.33.27.1
  114.33.27.135
  114.33.28.179
-114.33.28.236
  114.33.29.113
  114.33.3.132
  114.33.30.105
@@ -21561,7 +20311,6 @@
  114.33.34.142
  114.33.34.217
  114.33.34.82
-114.33.35.22
  114.33.37.45
  114.33.40.121
  114.33.41.115
@@ -21646,7 +20395,6 @@
  114.34.142.145
  114.34.143.149
  114.34.147.2
-114.34.156.139
  114.34.156.240
  114.34.158.79
  114.34.159.215
@@ -21705,6 +20453,7 @@
  114.34.25.245
  114.34.254.156
  114.34.26.33
+114.34.26.49
  114.34.33.90
  114.34.37.56
  114.34.38.230
@@ -21719,7 +20468,6 @@
  114.34.47.110
  114.34.47.232
  114.34.49.208
-114.34.5.245
  114.34.50.84
  114.34.52.3
  114.34.53.142
@@ -21735,7 +20483,6 @@
  114.34.58.9
  114.34.59.121
  114.34.59.35
-114.34.59.54
  114.34.73.176
  114.34.74.116
  114.34.74.23
@@ -21789,7 +20536,6 @@
  114.35.118.198
  114.35.118.93
  114.35.119.31
-114.35.12.174
  114.35.12.74
  114.35.120.213
  114.35.125.49
@@ -21878,6 +20624,7 @@
  114.35.182.83
  114.35.186.108
  114.35.188.117
+114.35.19.102
  114.35.19.141
  114.35.19.149
  114.35.191.203
@@ -21958,7 +20705,6 @@
  114.35.249.1
  114.35.250.205
  114.35.252.193
-114.35.253.42
  114.35.253.71
  114.35.26.147
  114.35.26.209
@@ -22023,6 +20769,7 @@
  114.35.72.120
  114.35.73.16
  114.35.74.193
+114.35.74.60
  114.35.75.178
  114.35.77.204
  114.35.77.50
@@ -22036,7 +20783,6 @@
  114.35.80.11
  114.35.80.160
  114.35.80.43
-114.35.80.75
  114.35.82.249
  114.35.83.220
  114.35.84.236
@@ -22071,6 +20817,7 @@
  114.38.140.219
  114.39.20.56
  114.39.217.62
+114.39.29.65
  114.39.62.50
  114.4.192.17
  114.4.227.194
@@ -22096,8 +20843,6 @@
  114.41.211.35
  114.41.98.181
  114.42.167.125
-114.42.169.184
-114.42.177.169
  114.42.18.174
  114.42.18.251
  114.42.182.52
@@ -22105,7 +20850,6 @@
  114.42.200.145
  114.42.22.41
  114.42.225.19
-114.42.234.6
  114.43.106.70
  114.43.133.147
  114.43.190.186
@@ -22128,7 +20872,6 @@
  114.47.3.149
  114.47.67.239
  114.47.71.79
-114.47.97.210
  114.47.98.194
  114.47.98.235
  114.47.98.87
@@ -22143,7 +20886,6 @@
  114.5.36.243
  114.5.64.49
  114.5.98.30
-114.55.92.167
  114.57.185.12
  114.57.189.130
  114.57.33.222
@@ -22151,34 +20893,25 @@
  114.6.227.28
  114.6.29.30
  114.6.34.194
-114.6.41.68
  114.6.41.72
-114.6.57.130
  114.6.74.102
  114.6.87.177
  114.6.88.238
  114.6.94.94
  114.64.253.153
  114.64.253.154
-114.67.102.123
-114.67.102.54
  114.67.103.151
  114.67.103.250
  114.67.104.176
-114.67.104.35
  114.67.104.59
  114.67.105.220
-114.67.106.137
  114.67.107.234
  114.67.108.60
  114.67.110.126
-114.67.110.143
  114.67.110.227
-114.67.110.240
  114.67.110.58
  114.67.113.90
  114.67.117.219
-114.67.120.110
  114.67.123.3
  114.67.125.253
  114.67.127.162
@@ -22187,61 +20920,35 @@
  114.67.168.173
  114.67.168.255
  114.67.171.58
-114.67.176.63
  114.67.179.254
  114.67.180.177
-114.67.203.30
-114.67.205.189
+114.67.200.2
  114.67.212.197
  114.67.219.159
  114.67.224.239
-114.67.229.131
  114.67.229.212
-114.67.230.163
  114.67.231.39
-114.67.233.74
-114.67.239.220
  114.67.239.47
-114.67.242.46
-114.67.243.136
-114.67.250.216
  114.67.250.30
  114.67.253.227
-114.67.253.68
  114.67.254.244
-114.67.65.66
-114.67.66.199
  114.67.66.26
  114.67.67.11
  114.67.67.148
-114.67.67.41
  114.67.68.255
  114.67.69.0
  114.67.69.200
  114.67.72.164
-114.67.73.165
-114.67.73.66
-114.67.73.71
-114.67.74.139
-114.67.74.5
-114.67.74.91
  114.67.77.148
-114.67.77.159
  114.67.77.183
  114.67.80.134
-114.67.80.209
-114.67.80.217
-114.67.80.40
  114.67.82.217
  114.67.85.74
  114.67.87.218
  114.67.87.255
  114.67.88.223
-114.67.88.76
-114.67.90.149
  114.67.95.121
  114.67.95.61
-114.69.147.175
  114.69.232.101
  114.69.232.121
  114.69.232.125
@@ -22278,7 +20985,6 @@
  114.69.249.145
  114.69.249.161
  114.69.249.194
-114.7.112.106
  114.7.112.118
  114.7.120.194
  114.7.15.146
@@ -22286,7 +20992,6 @@
  114.7.162.6
  114.7.163.198
  114.7.164.170
-114.7.164.250
  114.7.192.254
  114.7.194.132
  114.7.96.177
@@ -22295,19 +21000,18 @@
  114.70.235.64
  114.74.101.107
  114.74.88.199
+114.79.136.69
  114.79.151.157
  114.79.173.41
  114.80.108.158
  114.80.118.153
  114.80.156.113
-114.80.156.65
  114.80.210.93
  114.80.222.226
  114.80.246.172
  114.80.246.179
  114.80.55.163
  114.80.62.205
-114.80.94.228
  114.80.96.138
  114.83.175.255
  114.83.210.96
@@ -22318,12 +21022,10 @@
  114.84.67.84
  114.84.81.121
  114.86.128.145
-114.86.133.215
  114.86.189.233
  114.86.191.214
  114.86.247.231
  114.88.100.86
-114.88.154.153
  114.88.154.55
  114.88.164.116
  114.88.176.166
@@ -22331,25 +21033,22 @@
  114.88.182.85
  114.88.93.48
  114.92.249.74
-114.92.54.206
  114.93.200.181
-114.93.223.247
  114.93.36.232
  114.93.75.129
  114.95.100.151
-114.95.168.21
  114.95.173.150
  114.95.175.83
  114.96.16.160
  114.96.16.198
  114.96.16.215
-114.96.168.208
  114.96.17.135
  114.96.17.223
  114.96.17.244
  114.96.17.248
  114.96.17.75
-114.96.171.196
+114.96.170.71
+114.96.171.194
  114.96.18.117
  114.96.18.174
  114.96.18.19
@@ -22372,16 +21071,11 @@
  114.97.141.249
  114.97.238.19
  114.97.240.15
-114.97.241.47
  114.97.243.25
-114.98.126.14
-114.98.225.210
-114.98.231.143
-114.98.234.247
-114.98.236.124
-114.98.238.21
+114.99.11.133
  114.99.12.8
  114.99.127.202
+114.99.255.199
  114.99.8.153
  1147.org
  114oldest.com
@@ -22389,27 +21083,22 @@
  115.111.129.202
  115.111.91.67
  115.112.129.211
-115.112.62.88
  115.112.71.106
  115.12.56.16
  115.124.102.10
  115.124.111.97
  115.124.45.59
  115.124.64.114
-115.124.64.126
  115.124.64.234
  115.124.64.78
  115.124.66.82
  115.124.69.162
  115.124.71.110
  115.124.71.26
-115.124.72.81
  115.124.75.225
  115.124.75.86
  115.124.78.54
  115.124.86.169
-115.126.12.5
-115.126.12.55
  115.126.214.44
  115.126.214.50
  115.127.103.122
@@ -22419,7 +21108,6 @@
  115.127.115.226
  115.127.16.89
  115.127.23.165
-115.127.36.92
  115.127.65.66
  115.127.65.69
  115.127.65.70
@@ -22428,28 +21116,21 @@
  115.127.78.138
  115.127.92.179
  115.129.13.223
-115.132.132.211
-115.132.160.110
  115.132.39.120
  115.132.49.216
  115.132.58.78
  115.132.91.0
-115.133.128.125
  115.133.152.149
  115.133.255.83
  115.133.34.192
  115.134.124.23
-115.134.128.90
  115.134.130.53
  115.134.147.239
  115.134.194.216
  115.134.194.220
  115.134.96.138
  115.134.97.210
-115.135.0.35
  115.135.119.179
-115.135.177.186
-115.135.50.145
  115.135.78.64
  115.137.112.89
  115.140.9.158
@@ -22459,12 +21140,10 @@
  115.144.238.94
  115.144.26.3
  115.144.69.105
-115.146.121.79
  115.146.122.156
  115.146.122.237
  115.146.123.112
  115.146.126.209
-115.148.235.31
  115.148.80.189
  115.148.82.102
  115.149.138.108
@@ -22480,32 +21159,26 @@
  115.152.253.34
  115.152.253.35
  115.152.99.77
-115.153.143.28
-115.153.8.95
+115.153.10.86
  115.159.102.123
  115.159.105.200
  115.159.106.132
  115.159.109.101
+115.159.112.224
  115.159.115.17
-115.159.115.69
  115.159.117.250
-115.159.119.35
  115.159.124.199
  115.159.126.215
+115.159.148.174
  115.159.151.171
  115.159.152.188
  115.159.153.180
  115.159.155.22
  115.159.155.25
-115.159.157.103
  115.159.157.154
-115.159.185.71
-115.159.196.214
  115.159.197.34
-115.159.198.41
  115.159.2.165
  115.159.201.15
-115.159.203.224
  115.159.206.137
  115.159.213.101
  115.159.214.200
@@ -22514,13 +21187,11 @@
  115.159.222.221
  115.159.226.53
  115.159.25.145
-115.159.25.60
  115.159.3.147
  115.159.3.211
  115.159.33.215
  115.159.40.251
  115.159.42.232
-115.159.44.32
  115.159.53.215
  115.159.54.212
  115.159.64.121
@@ -22528,8 +21199,6 @@
  115.159.71.202
  115.159.71.95
  115.159.83.182
-115.159.86.75
-115.159.91.202
  115.159.93.221
  115.159.93.53
  115.159.93.67
@@ -22538,11 +21207,9 @@
  115.159.97.63
  115.160.104.73
  115.160.142.169
-115.160.167.254
  115.161.243.249
-115.164.51.220
  115.165.166.169
-115.165.166.193
+115.165.199.81
  115.165.200.200
  115.165.205.190
  115.165.207.106
@@ -22552,6 +21219,7 @@
  115.165.212.231
  115.165.213.145
  115.165.213.216
+115.165.213.31
  115.165.214.94
  115.165.217.207
  115.165.217.51
@@ -22563,7 +21231,6 @@
  115.176.148.20
  115.177.188.104
  115.178.119.110
-115.178.48.38
  115.178.49.238
  115.178.98.62
  115.182.105.68
@@ -22574,13 +21241,9 @@
  115.183.2.40
  115.186.139.46
  115.186.149.166
-115.186.172.179
  115.186.187.249
  115.186.187.48
-115.186.188.53
  115.186.30.38
-115.186.87.191
-115.187.46.72
  115.192.2.141
  115.192.234.142
  115.192.238.67
@@ -22590,8 +21253,6 @@
  115.193.163.81
  115.193.166.211
  115.193.169.13
-115.193.170.21
-115.193.177.81
  115.193.19.150
  115.193.23.117
  115.193.73.86
@@ -22599,9 +21260,8 @@
  115.195.172.67
  115.195.174.137
  115.195.214.241
-115.195.51.153
-115.195.73.245
-115.195.74.97
+115.195.74.108
+115.195.74.172
  115.195.75.89
  115.195.84.229
  115.195.91.43
@@ -22611,10 +21271,13 @@
  115.197.173.196
  115.197.19.77
  115.197.245.171
+115.197.45.41
  115.197.83.141
  115.198.225.164
+115.198.229.1
  115.198.36.80
  115.199.106.191
+115.199.126.246
  115.199.128.70
  115.199.66.154
  115.20.174.59
@@ -22633,14 +21296,14 @@
  115.202.237.182
  115.203.129.234
  115.203.132.235
-115.204.127.184
+115.204.120.167
+115.204.121.27
+115.204.121.90
  115.204.201.240
  115.204.209.64
-115.204.98.212
  115.205.12.106
  115.205.127.125
  115.205.131.232
-115.205.146.229
  115.205.163.253
  115.205.18.152
  115.205.68.244
@@ -22653,9 +21316,7 @@
  115.207.234.184
  115.207.252.184
  115.207.255.30
-115.207.4.205
  115.207.52.146
-115.207.72.55
  115.207.9.109
  115.208.100.88
  115.208.102.2
@@ -22666,7 +21327,6 @@
  115.208.123.133
  115.208.126.111
  115.208.134.3
-115.208.177.22
  115.208.192.204
  115.208.203.194
  115.208.204.5
@@ -22675,16 +21335,12 @@
  115.208.50.106
  115.208.59.220
  115.208.61.7
-115.209.30.246
  115.21.29.160
-115.210.10.120
+115.21.89.222
  115.210.214.66
-115.211.147.232
-115.211.149.190
-115.211.225.43
+115.212.130.58
  115.212.178.145
  115.212.181.250
-115.212.60.26
  115.212.9.21
  115.212.96.119
  115.213.128.170
@@ -22695,12 +21351,17 @@
  115.214.237.182
  115.214.238.68
  115.214.239.10
-115.215.120.129
+115.215.108.143
  115.215.132.232
+115.215.220.174
  115.215.223.68
-115.216.112.180
-115.216.114.36
-115.216.116.97
+115.216.113.21
+115.216.113.212
+115.216.115.151
+115.216.115.52
+115.216.116.224
+115.216.116.44
+115.216.117.114
  115.216.24.38
  115.216.247.191
  115.216.25.110
@@ -22709,24 +21370,25 @@
  115.216.42.212
  115.217.195.121
  115.217.250.197
+115.217.252.59
  115.217.254.17
  115.217.254.78
  115.217.33.95
  115.218.114.78
  115.218.114.89
+115.218.119.33
+115.218.119.46
  115.218.121.244
  115.218.122.19
  115.218.123.158
  115.218.128.135
-115.218.134.183
  115.218.96.13
  115.218.96.149
  115.218.96.17
  115.218.98.50
-115.218.98.98
-115.219.0.29
+115.219.0.126
+115.219.4.17
  115.219.7.100
-115.219.7.254
  115.219.86.76
  115.219.89.23
  115.219.93.234
@@ -22734,40 +21396,42 @@
  115.22.117.80
  115.22.121.34
  115.22.139.177
+115.22.139.202
  115.22.160.22
  115.22.160.29
  115.22.167.173
  115.22.182.182
+115.22.193.95
  115.22.244.111
  115.22.244.180
  115.22.33.26
  115.22.53.146
  115.22.53.147
  115.22.64.144
-115.220.1.233
+115.22.66.98
  115.220.10.112
  115.220.2.102
  115.220.2.163
+115.220.210.27
  115.220.237.5
  115.220.59.32
+115.220.9.216
  115.221.12.125
  115.221.13.2
  115.221.15.72
  115.221.242.189
  115.221.247.209
-115.221.247.96
  115.221.28.118
-115.222.105.72
+115.222.102.7
  115.223.34.141
  115.223.7.110
+115.224.116.96
+115.224.119.52
  115.224.21.22
  115.224.88.245
  115.226.119.144
-115.226.149.102
-115.226.152.9
  115.226.219.216
-115.227.176.243
-115.227.177.216
+115.227.176.54
  115.229.11.214
  115.229.249.129
  115.23.112.218
@@ -22785,13 +21449,14 @@
  115.23.223.71
  115.23.223.72
  115.23.223.74
-115.23.223.75
  115.23.223.76
  115.23.223.8
  115.23.223.9
+115.23.224.52
  115.23.31.133
  115.23.49.133
  115.23.65.167
+115.23.68.166
  115.23.73.166
  115.230.124.100
  115.230.124.104
@@ -22808,7 +21473,6 @@
  115.231.144.38
  115.231.163.85
  115.231.176.170
-115.231.181.90
  115.231.19.187
  115.231.19.191
  115.231.192.134
@@ -22834,14 +21498,12 @@
  115.236.119.135
  115.236.119.139
  115.236.13.186
-115.236.167.108
  115.236.174.43
  115.236.182.133
  115.236.182.186
  115.236.185.227
  115.236.19.35
  115.236.24.86
-115.236.32.130
  115.236.38.120
  115.236.50.98
  115.236.52.28
@@ -22850,7 +21512,6 @@
  115.236.66.2
  115.236.67.42
  115.236.79.54
-115.236.8.152
  115.236.83.114
  115.236.87.26
  115.238.133.210
@@ -22859,11 +21520,9 @@
  115.238.164.123
  115.238.175.90
  115.238.181.22
-115.238.186.104
  115.238.191.219
  115.238.238.16
-115.238.36.162
-115.238.44.237
+115.238.247.228
  115.238.46.69
  115.238.49.107
  115.238.61.222
@@ -22887,14 +21546,15 @@
  115.240.115.210
  115.241.164.10
  115.242.8.153
-115.243.35.98
  115.248.28.145
  115.249.31.3
  115.254.63.50
  115.28.156.119
  115.28.186.180
  115.28.36.14
+115.29.141.60
  115.29.151.56
+115.29.198.37
  115.29.246.243
  115.29.5.153
  115.29.7.25
@@ -22906,228 +21566,217 @@
  115.37.196.148
  115.38.173.209
  115.38.178.51
+115.4.56.5
  115.40.112.138
  115.40.80.163
  115.40.81.106
  115.41.165.38
  115.41.28.249
-115.41.57.249
  115.42.127.133
  115.42.151.75
  115.42.19.249
  115.42.32.106
  115.42.44.94
+115.42.47.36
  115.43.9.20
  115.44.104.178
+115.44.105.0
  115.44.109.32
  115.44.80.25
  115.45.102.227
  115.45.104.103
  115.47.53.34
-115.48.11.52
+115.48.11.193
  115.48.124.6
+115.48.128.239
  115.48.130.197
  115.48.131.146
-115.48.131.251
  115.48.132.136
  115.48.142.139
-115.48.147.240
+115.48.144.238
+115.48.146.181
  115.48.148.116
-115.48.149.53
+115.48.149.238
  115.48.149.59
-115.48.149.92
-115.48.151.101
-115.48.156.223
-115.48.157.45
-115.48.181.202
+115.48.152.59
+115.48.154.135
+115.48.162.144
+115.48.177.165
+115.48.181.95
+115.48.183.104
  115.48.183.26
-115.48.190.165
-115.48.196.159
+115.48.190.19
  115.48.197.63
-115.48.200.199
-115.48.201.150
+115.48.200.211
+115.48.201.13
+115.48.203.126
  115.48.203.236
-115.48.207.211
-115.48.208.19
+115.48.204.35
+115.48.21.204
+115.48.211.12
  115.48.212.139
+115.48.212.200
  115.48.228.241
-115.48.230.131
-115.48.235.210
-115.48.35.117
+115.48.229.234
+115.48.231.175
+115.48.231.177
  115.48.46.61
-115.48.49.36
+115.48.48.254
  115.48.54.224
-115.49.127.46
+115.48.84.153
+115.49.100.150
+115.49.124.73
  115.49.131.131
+115.49.133.127
  115.49.154.168
  115.49.19.82
-115.49.197.246
-115.49.21.207
  115.49.210.221
  115.49.211.89
  115.49.215.114
  115.49.227.139
-115.49.235.111
  115.49.235.148
-115.49.253.253
+115.49.24.186
  115.49.30.197
-115.49.36.16
+115.49.36.138
  115.49.36.30
  115.49.37.204bin.sh
-115.49.59.213
+115.49.4.227
+115.49.46.121
  115.49.72.11
  115.49.72.68
  115.49.75.165
  115.49.76.183
-115.49.76.212
+115.49.77.88
  115.49.78.108
  115.49.78.51
  115.49.78.53
-115.49.79.75
  115.49.96.91
  115.49.97.229
  115.49.97.55
  115.50.0.131
-115.50.0.8
+115.50.100.226
  115.50.102.226
+115.50.102.90
  115.50.105.199
-115.50.108.154
-115.50.108.48
+115.50.11.176
  115.50.121.218
  115.50.14.78
+115.50.146.10
  115.50.149.248
+115.50.153.157
  115.50.158.179
-115.50.159.110
+115.50.158.245
  115.50.160.53
-115.50.160.71
+115.50.163.51
  115.50.164.216
  115.50.167.127
-115.50.169.104
  115.50.169.221
  115.50.170.126
-115.50.173.14
+115.50.172.33
  115.50.173.80
-115.50.173.88
-115.50.174.23
+115.50.18.83
  115.50.187.9
-115.50.189.9
-115.50.2.182
-115.50.20.183
+115.50.19.53
+115.50.200.143
  115.50.205.237
  115.50.207.184
-115.50.210.102
+115.50.209.5
+115.50.21.54
+115.50.21.81
  115.50.210.97
-115.50.213.38
  115.50.215.95
-115.50.217.223
  115.50.219.28
-115.50.22.255
-115.50.220.135
-115.50.220.226
-115.50.223.26
-115.50.225.77
  115.50.226.83
-115.50.229.124
-115.50.230.254
+115.50.227.110
  115.50.231.191
-115.50.231.81
  115.50.232.133
  115.50.232.54
-115.50.235.135
+115.50.239.146
  115.50.243.204
-115.50.244.5
  115.50.247.130
  115.50.3.84
-115.50.32.13
  115.50.33.224
  115.50.35.69
-115.50.38.175
-115.50.39.3
-115.50.41.87
-115.50.43.14
+115.50.4.186
  115.50.45.90
+115.50.47.142
  115.50.5.130
-115.50.56.37
+115.50.5.26
+115.50.53.123
+115.50.53.184
  115.50.56.92
-115.50.60.43
-115.50.64.171
-115.50.64.179
-115.50.65.52
-115.50.65.70
+115.50.61.103
+115.50.63.63
+115.50.64.93
+115.50.65.51
  115.50.67.216
-115.50.67.220
  115.50.68.184
  115.50.7.76
  115.50.70.91
  115.50.71.17
-115.50.71.187
-115.50.71.237
  115.50.80.154
  115.50.81.156
-115.50.83.0
  115.50.89.151
+115.50.91.201
+115.50.92.27
  115.50.93.62
  115.50.94.19
-115.50.94.21
-115.50.95.224
  115.51.105.214
-115.51.109.10
+115.51.107.183
  115.51.109.21
  115.51.110.122
-115.51.122.161
+115.51.110.250
+115.51.121.108
+115.51.121.206
  115.51.122.174
  115.51.122.255
  115.51.193.203
  115.51.46.201
  115.51.47.80
-115.51.88.85
+115.51.90.188
  115.51.92.114
-115.51.95.173
+115.52.107.189
  115.52.111.190
-115.52.111.3
-115.52.111.76
  115.52.12.28
  115.52.122.8
-115.52.159.63
-115.52.160.51
  115.52.17.210
  115.52.172.12
  115.52.172.91
  115.52.18.222
-115.52.18.53
  115.52.190.53
-115.52.224.91
  115.52.225.26
  115.52.226.195
  115.52.227.89
+115.52.234.66
  115.52.236.171
+115.52.237.248
  115.52.244.73
  115.52.58.160
  115.52.59.41
  115.52.91.60
  115.53.131.204
  115.53.134.16
-115.53.201.165
+115.53.200.227
  115.53.201.53
-115.53.203.58
  115.53.225.220
-115.53.226.164
-115.53.238.115
+115.53.248.156
  115.53.248.17
-115.53.252.116
+115.53.252.171
  115.53.253.194
  115.53.254.48
+115.53.254.74
  115.53.61.40
  115.53.77.89
  115.53.78.87
-115.53.88.254
  115.54.129.10
  115.54.152.176
-115.54.158.255
  115.54.183.113
  115.54.194.144
+115.54.198.21
  115.54.200.181
  115.54.200.55
+115.54.204.205
+115.54.205.249
  115.54.205.92
  115.54.207.55
  115.54.208.175
@@ -23135,67 +21784,71 @@
  115.54.212.17
  115.54.214.123
  115.54.214.163
-115.54.238.187
  115.54.239.57
-115.54.242.159
-115.54.74.7
+115.54.64.46
  115.54.78.223
  115.55.104.20
+115.55.109.127
  115.55.109.46
-115.55.110.67
  115.55.116.137
-115.55.124.10
-115.55.124.152
+115.55.119.96
+115.55.120.151
+115.55.128.187
  115.55.128.7
  115.55.129.241
+115.55.129.51
  115.55.130.195
  115.55.130.55
  115.55.131.30
-115.55.136.98
-115.55.137.126
+115.55.132.65
+115.55.133.17
+115.55.137.12
  115.55.137.26
-115.55.137.76
-115.55.140.106
+115.55.138.170
+115.55.138.4
  115.55.144.195
-115.55.144.69
-115.55.145.134
+115.55.144.27
  115.55.145.253
+115.55.146.180
  115.55.146.3
+115.55.146.86
  115.55.147.171
-115.55.147.218
  115.55.149.192
  115.55.149.197
  115.55.149.206
  115.55.149.253
-115.55.149.68
-115.55.150.117
  115.55.150.245
-115.55.151.110
-115.55.153.185
+115.55.152.135
  115.55.153.83
  115.55.154.143
+115.55.154.178
  115.55.154.201
  115.55.154.219
-115.55.155.56
  115.55.155.58
+115.55.156.112
+115.55.156.195
  115.55.156.206
  115.55.156.210
  115.55.157.2
  115.55.157.45
  115.55.157.5
-115.55.158.20
  115.55.158.52
  115.55.158.52bin.sh
-115.55.159.104
  115.55.159.46
  115.55.159.76
+115.55.159.77
  115.55.161.184
-115.55.166.119
-115.55.173.158
+115.55.175.4
  115.55.180.53
+115.55.182.222
+115.55.187.156
+115.55.188.110
  115.55.188.221
-115.55.190.64
-115.55.198.34
+115.55.189.29
+115.55.190.174
+115.55.193.209
+115.55.20.38
+115.55.202.130
  115.55.202.175
  115.55.208.186
  115.55.211.90
@@ -23204,20 +21857,15 @@
  115.55.29.22
  115.55.32.190
  115.55.41.246
-115.55.58.112
  115.55.59.142
-115.55.89.110
  115.55.90.41
-115.55.90.84
+115.56.112.120
  115.56.113.29
  115.56.114.233
  115.56.115.248
-115.56.124.205
  115.56.128.237
  115.56.128.67
  115.56.129.141
-115.56.129.40
-115.56.130.141
  115.56.130.85
  115.56.130.91
  115.56.131.121
@@ -23231,60 +21879,61 @@
  115.56.134.81
  115.56.135.103bin.sh
  115.56.135.127
-115.56.135.188
  115.56.135.247
  115.56.135.7
  115.56.137.196
  115.56.137.47
+115.56.138.17
  115.56.138.28
  115.56.139.193
-115.56.140.181
  115.56.140.189
  115.56.140.227
  115.56.140.235
  115.56.140.64
+115.56.141.145
  115.56.141.160
  115.56.142.221
-115.56.142.93
  115.56.143.125
  115.56.143.13
-115.56.145.1
-115.56.145.249
+115.56.143.46
  115.56.146.213
  115.56.147.73
+115.56.148.221
  115.56.148.50
  115.56.150.184
-115.56.151.90
+115.56.152.129
  115.56.153.210bin.sh
-115.56.153.3
+115.56.154.137
+115.56.155.216
  115.56.156.200
-115.56.156.253
  115.56.157.7
  115.56.159.190
  115.56.161.84
+115.56.162.141
  115.56.177.182
-115.56.178.43
  115.56.181.237
  115.56.182.48
  115.56.182.87
-115.56.183.63
-115.56.187.57
+115.56.183.55
+115.56.185.12
+115.56.187.226
+115.56.188.46
+115.56.188.49
  115.56.189.100
  115.56.189.174
-115.56.191.126
-115.56.196.201
+115.56.191.246
  115.56.197.113
-115.56.197.52
-115.56.199.179
-115.56.202.127
-115.56.216.129
+115.56.197.127
  115.56.216.168
-115.56.218.48
-115.56.24.32
  115.56.24.68
  115.56.26.132
+115.56.59.145
  115.56.80.32
+115.56.96.198
  115.58.10.64
+115.58.100.64
+115.58.109.76
+115.58.11.236
  115.58.12.69
  115.58.132.130
  115.58.132.212
@@ -23294,89 +21943,97 @@
  115.58.132.6
  115.58.133.121
  115.58.133.17
+115.58.133.185
  115.58.133.206
  115.58.133.25
  115.58.133.59
  115.58.134.105
  115.58.134.121
+115.58.134.19
  115.58.135.132
  115.58.135.162
  115.58.135.179
  115.58.135.221
+115.58.139.45
  115.58.141.145
+115.58.142.154
+115.58.142.208
  115.58.153.154
  115.58.155.63
  115.58.162.230
-115.58.175.98
-115.58.19.80
+115.58.164.239
+115.58.166.2
+115.58.173.152
  115.58.2.34
  115.58.20.199
  115.58.209.70
-115.58.21.121
-115.58.41.12
-115.58.42.150
-115.58.66.88
-115.58.67.103
-115.58.69.11
-115.58.79.233
-115.58.84.77
+115.58.65.48
+115.58.70.28
+115.58.82.70
  115.58.9.115
  115.58.9.66
-115.58.95.37
  115.58.95.88
+115.59.10.150
  115.59.100.199
  115.59.101.241
  115.59.101.26
  115.59.101.91
+115.59.103.21
+115.59.117.122
+115.59.117.182
  115.59.117.92
  115.59.145.236
  115.59.17.171
-115.59.192.72
  115.59.193.200
  115.59.196.230
+115.59.199.204
  115.59.199.35
  115.59.20.184
-115.59.202.243
-115.59.208.81
+115.59.203.43
+115.59.209.69
  115.59.210.230
-115.59.211.70
+115.59.211.29
+115.59.214.148
+115.59.215.174
+115.59.215.229
+115.59.218.79
  115.59.218.92
+115.59.219.207
  115.59.219.62
  115.59.22.48
-115.59.221.40
-115.59.222.167
+115.59.222.150
+115.59.223.158
  115.59.225.137
  115.59.225.37
-115.59.226.132
  115.59.229.173
+115.59.229.251
  115.59.230.79
-115.59.231.216
+115.59.233.179
  115.59.234.162
-115.59.242.221
+115.59.254.123
  115.59.255.14
-115.59.255.217
+115.59.255.4
  115.59.255.40
  115.59.54.194
+115.59.57.201
  115.59.76.195
  115.59.80.145
  115.59.81.96
  115.59.82.114
-115.59.90.155
-115.59.94.135
+115.59.83.23
  115.59.97.97
+115.59.98.81
  115.60.201.21
-115.60.59.121
  115.60.59.194
+115.60.62.236
  115.61.10.132
  115.61.102.159
  115.61.102.167
-115.61.102.193
-115.61.104.17
  115.61.106.222
+115.61.108.176
  115.61.110.154
-115.61.110.201
  115.61.111.225
-115.61.111.31
+115.61.111.63
  115.61.120.103
  115.61.120.180
  115.61.120.84
@@ -23389,84 +22046,81 @@
  115.61.122.244
  115.61.122.68
  115.61.124.61
-115.61.126.151
-115.61.129.229
+115.61.127.66
+115.61.128.14
  115.61.129.7
  115.61.136.123
+115.61.136.64
  115.61.137.57
-115.61.138.128
+115.61.138.93
  115.61.14.175
  115.61.144.170
  115.61.144.184
  115.61.144.220
  115.61.160.137
  115.61.160.2
-115.61.160.86
-115.61.166.105
  115.61.171.172
-115.61.173.163
  115.61.173.179
-115.61.173.22
  115.61.175.242
+115.61.185.53
  115.61.192.106
  115.61.195.198
  115.61.254.248
  115.61.3.206
-115.61.54.237
+115.61.37.244
  115.61.72.93
  115.61.78.142
  115.61.96.221
-115.61.97.141
  115.61.98.191
  115.62.104.113
-115.62.11.45
  115.62.134.206
  115.62.144.135
-115.62.146.51
-115.62.149.103
+115.62.26.81
  115.62.36.237
+115.62.44.121
+115.63.100.68
  115.63.101.79
-115.63.129.139
+115.63.128.107
  115.63.129.47
-115.63.130.63
+115.63.134.112
  115.63.134.192
-115.63.135.3
  115.63.139.110
  115.63.139.114
-115.63.139.229
+115.63.139.97
+115.63.140.94
  115.63.142.27
-115.63.176.20
+115.63.177.143
  115.63.177.82
-115.63.179.109
  115.63.179.18
  115.63.179.227
-115.63.183.192
+115.63.180.21
+115.63.181.212
+115.63.182.94
+115.63.183.221
  115.63.186.148
  115.63.188.143
  115.63.189.176
  115.63.19.124
+115.63.200.123
+115.63.200.149
  115.63.201.175
-115.63.254.24
  115.63.255.69
-115.63.32.161
+115.63.27.174
+115.63.27.20
  115.63.37.173
-115.63.38.110
  115.63.38.184
-115.63.38.225
+115.63.38.243
  115.63.38.62
  115.63.38.96
-115.63.58.125
-115.63.58.189
  115.63.66.157
-115.63.67.69
  115.63.68.165
-115.63.71.122
  115.63.83.222
  115.63.89.9
  115.64.139.76
  115.64.200.155
  115.64.218.1
  115.66.0.78
+115.66.110.55
  115.66.138.57
  115.66.146.234
  115.66.184.69
@@ -23474,20 +22128,17 @@
  115.66.232.194
  115.68.1.14
  115.68.109.9
-115.68.164.10
  115.68.179.219
  115.68.182.197
  115.68.184.88
  115.68.190.124
  115.68.2.144
-115.68.218.48
  115.68.226.124
  115.68.232.221
  115.68.232.45
  115.68.45.169
  115.68.52.240
  115.69.106.118
-115.69.106.214
  115.69.106.28
  115.69.106.48
  115.69.107.253
@@ -23504,7 +22155,6 @@
  115.71.236.98
  115.71.237.56
  115.71.238.18
-115.71.239.155
  115.71.239.208
  115.72.121.39
  115.72.19.111
@@ -23513,17 +22163,15 @@
  115.72.247.160
  115.72.248.72
  115.72.253.228
-115.72.34.13
+115.72.3.152
  115.72.34.215
  115.72.39.37
  115.72.6.217
  115.73.10.77
-115.73.13.184
  115.73.139.81
  115.73.161.247
  115.73.213.182
  115.73.213.31
-115.73.239.209
  115.73.3.94
  115.73.39.163
  115.73.43.186
@@ -23548,15 +22196,14 @@
  115.75.123.94
  115.75.181.168
  115.75.2.213
-115.75.242.252
  115.75.3.137
  115.75.5.17
  115.75.54.24
+115.75.58.153
  115.75.72.92
  115.76.114.164
  115.76.152.55
  115.76.155.107
-115.76.157.201
  115.76.157.232
  115.76.158.87
  115.76.166.190
@@ -23573,14 +22220,14 @@
  115.77.187.194
  115.77.188.228
  115.77.19.34
-115.77.191.180
+115.77.190.164
  115.77.23.49
  115.77.235.187
  115.77.240.222
  115.77.242.81
  115.77.29.96
+115.77.50.66
  115.77.82.160
-115.78.1.103
  115.78.1.222
  115.78.118.58
  115.78.125.119
@@ -23589,14 +22236,11 @@
  115.78.4.219
  115.78.93.4
  115.79.103.119
-115.79.125.238
-115.79.138.163
  115.79.179.155
  115.79.193.105
  115.79.193.109
  115.79.193.113
  115.79.195.246
-115.79.208.117
  115.79.208.56
  115.79.209.221
  115.79.214.222
@@ -23612,15 +22256,12 @@
  115.79.78.65
  115.79.94.63
  115.84.101.78
-115.84.112.138
+115.84.107.186
  115.84.178.112
  115.84.235.77
-115.84.253.162
  115.84.91.211
-115.84.91.63
  115.84.92.149
  115.84.92.214
-115.84.92.243
  115.84.92.51
  115.84.92.92
  115.84.99.182
@@ -23647,6 +22288,7 @@
  115.86.57.3
  115.86.6.14
  115.86.60.50
+115.86.69.30
  115.86.98.11
  115.87.154.4
  115.87.197.108
@@ -23658,11 +22300,13 @@
  115.90.126.171
  115.90.147.170
  115.90.219.181
+115.90.25.107
  115.91.117.66
  115.91.39.126
  115.91.83.42
  115.92.100.144
  115.92.118.52
+115.92.129.149
  115.92.174.231
  115.93.146.76
  115.93.207.110
@@ -23673,6 +22317,7 @@
  115.96.119.225
  115.96.121.13
  115.96.127.57
+115.96.134.1
  115.96.135.5
  115.96.136.28
  115.96.138.99
@@ -23690,10 +22335,8 @@
  115.97.31.199
  115.97.83.137
  115.98.0.71
-115.98.231.25
  115.98.71.54
  115.99.115.105
-115.99.12.30
  115.99.148.82
  115.99.191.95
  11515-dot-phonic-obelisk-274214.uk.r.appspot.com
@@ -23714,6 +22357,7 @@
  116.1.148.182
  116.1.148.184
  116.1.149.196
+116.1.18.153
  116.1.180.22
  116.1.30.135
  116.1.55.194
@@ -23724,19 +22368,19 @@
  116.10.184.130
  116.10.189.116
  116.10.189.21
-116.100.112.255
  116.100.120.243
  116.100.124.188
  116.100.154.157
  116.100.159.116
  116.100.173.209
+116.100.252.175
  116.100.254.53
-116.100.40.172
  116.100.44.17
  116.100.57.20
  116.100.69.27
  116.101.49.40
  116.102.1.121
+116.102.119.86
  116.102.123.201
  116.102.135.222
  116.102.137.62
@@ -23751,7 +22395,6 @@
  116.102.46.56
  116.102.9.245
  116.103.210.14
-116.103.43.49
  116.103.78.161
  116.104.138.244
  116.104.138.79
@@ -23761,11 +22404,11 @@
  116.105.9.168
  116.106.137.96
  116.106.140.50
-116.106.148.158
  116.106.154.203
  116.106.155.10
  116.106.22.200
  116.106.23.124
+116.107.114.208
  116.107.161.75
  116.107.162.125
  116.107.162.230
@@ -23782,7 +22425,6 @@
  116.108.180.221
  116.108.232.105
  116.108.29.189
-116.108.71.31
  116.108.71.5
  116.108.97.58
  116.109.105.230
@@ -23791,6 +22433,7 @@
  116.109.142.179
  116.109.168.219
  116.109.179.254
+116.109.197.104
  116.109.197.64
  116.109.21.194
  116.109.234.145
@@ -23801,6 +22444,8 @@
  116.11.20.42
  116.110.0.103
  116.110.144.27
+116.110.182.142
+116.110.4.183
  116.110.88.25
  116.111.119.118
  116.111.177.48
@@ -23819,6 +22464,7 @@
  116.114.19.211
  116.114.210.64
  116.114.212.60
+116.114.88.68
  116.114.95.100
  116.114.95.104
  116.114.95.108
@@ -23869,6 +22515,7 @@
  116.114.95.92
  116.114.95.94
  116.114.95.98
+116.115.104.75
  116.116.108.101
  116.116.109.84
  116.116fddw.top
@@ -23878,17 +22525,14 @@
  116.117.251.43
  116.118.10.20
  116.118.112.115
-116.118.112.34
  116.118.119.218
  116.118.228.47
  116.12.212.244
  116.12.226.222
-116.12.251.132
  116.12.51.206
  116.12.52.141
  116.120.108.26
  116.121.119.103
-116.121.160.69
  116.122.158.207
  116.122.36.61
  116.122.38.203
@@ -23905,7 +22549,9 @@
  116.127.121.39
  116.131.195.238
  116.131.212.180
+116.131.222.189
  116.131.225.125
+116.132.198.57
  116.132.47.50
  116.132.58.234
  116.138.123.192
@@ -23914,21 +22560,21 @@
  116.138.14.95
  116.138.15.37
  116.138.29.132
-116.138.49.157
  116.138.51.45
  116.138.55.68
  116.138.82.117
  116.138.83.224
  116.138.87.254
  116.138.93.92
+116.138.94.95
  116.138.96.104
  116.139.111.89
  116.139.112.113
  116.139.112.136
+116.139.123.136
  116.139.199.62
  116.139.2.110
  116.139.255.208
-116.139.76.156
  116.139.9.15
  116.14.113.96
  116.14.122.110
@@ -23940,10 +22586,12 @@
  116.14.227.211
  116.14.228.23
  116.14.33.43
+116.14.38.41
  116.14.49.49
  116.14.5.223
  116.14.61.160
  116.14.66.240
+116.14.68.85
  116.14.89.27
  116.140.100.121
  116.140.133.100
@@ -23957,6 +22605,7 @@
  116.140.76.110
  116.140.80.19
  116.140.81.165
+116.147.2.94
  116.149.119.209
  116.149.195.56bin.sh
  116.149.201.215bin.sh
@@ -23976,60 +22625,45 @@
  116.15.217.65
  116.15.24.24
  116.15.34.152
-116.15.8.200
+116.15.71.245
  116.15.9.158
  116.153.38.247
  116.153.43.156
  116.154.17.194
  116.154.20.15
-116.154.23.165
  116.154.5.240
  116.16.12.51
+116.17.199.219
  116.177.10.105
+116.177.10.124
  116.177.178.206
  116.177.179.202
  116.177.179.85
  116.177.181.195
  116.177.181.237
  116.177.20.50
-116.177.233.5
  116.177.248.202
  116.178.28.2
-116.179.138.231
+116.179.130.24
  116.179.139.142
  116.179.149.121
-116.179.32.132
-116.179.32.136
-116.179.32.139
-116.179.32.146
-116.179.32.150
-116.179.32.157
-116.179.32.169
-116.179.32.179
+116.179.32.137
+116.179.32.147
  116.179.32.18
-116.179.32.20
  116.179.32.202
-116.179.32.229
-116.179.32.230
+116.179.32.216
  116.179.32.232
-116.179.32.241
+116.179.32.240
  116.179.32.242
-116.179.32.30
-116.179.32.31
-116.179.32.34
-116.179.32.43
-116.179.32.47
+116.179.32.41
  116.179.32.49
-116.179.32.67
-116.179.32.68
  116.179.32.78
-116.179.32.80
-116.179.32.82
  116.179.65.62
  116.179.95.59
  116.18.228.63
  116.18.229.222
  116.18.229.42
+116.19.124.196
  116.193.133.12
  116.193.152.7
  116.193.159.66
@@ -24042,32 +22676,19 @@
  116.193.219.251
  116.196.101.168
  116.196.105.232
-116.196.107.128
  116.196.108.9
-116.196.117.97
  116.196.119.146
-116.196.124.159
  116.196.124.172
  116.196.15.69
  116.196.65.134
-116.196.73.159
  116.196.74.197
  116.196.75.171
-116.196.80.104
-116.196.81.216
-116.196.83.180
  116.196.85.150
  116.196.85.166
  116.196.88.72
-116.196.89.78
-116.196.90.116
  116.196.90.254
-116.196.93.81
  116.196.94.108
-116.196.94.211
  116.196.97.240
-116.196.99.196
-116.197.129.243
  116.197.131.18
  116.197.132.33
  116.197.133.146
@@ -24083,10 +22704,8 @@
  116.199.172.213
  116.199.172.29
  116.199.174.1
-116.2.173.76
  116.2.228.250
  116.2.64.96
-116.2.76.135
  116.2.84.71
  116.20.21.119
  116.20.21.121
@@ -24094,6 +22713,7 @@
  116.20.21.199
  116.20.21.245
  116.20.21.54
+116.20.21.86
  116.20.21.90
  116.20.21.97
  116.202.0.237
@@ -24116,29 +22736,22 @@
  116.202.245.89
  116.202.25.235
  116.202.251.195
-116.202.255.120
  116.202.35.157
  116.202.51.11
  116.202.51.176
  116.202.82.177
  116.202.85.108
  116.202.89.132
-116.202.97.111
-116.202.97.115
  116.203.103.227
  116.203.112.73
-116.203.114.220
  116.203.117.76
  116.203.128.117
-116.203.136.157
  116.203.143.6
  116.203.151.175
  116.203.152.66
  116.203.185.207
-116.203.191.62
  116.203.200.229
  116.203.203.28
-116.203.211.9
  116.203.216.205
  116.203.221.74
  116.203.230.250
@@ -24149,20 +22762,15 @@
  116.203.25.244
  116.203.29.242
  116.203.42.21
-116.203.43.110
  116.203.47.157
  116.203.60.216
  116.203.61.61
  116.203.75.230
  116.203.92.131
-116.203.93.76
  116.204.171.107
-116.204.182.240
  116.204.254.1
  116.204.254.13
  116.204.254.242
-116.206.165.36
-116.206.196.125
  116.206.233.10
  116.206.233.130
  116.206.235.2
@@ -24177,12 +22785,11 @@
  116.206.61.225
  116.206.61.33
  116.206.94.26
-116.209.26.239
+116.207.131.12
  116.209.52.168
  116.209.52.241
-116.209.55.118
-116.209.56.156
  116.209.62.0
+116.21.31.58
  116.211.118.242
  116.211.118.246
  116.211.118.247
@@ -24202,17 +22809,12 @@
  116.212.131.174
  116.212.152.30
  116.212.66.214
-116.213.43.147
  116.213.43.172
  116.213.43.42
  116.213.52.200
-116.213.52.205
  116.213.52.252
-116.218.131.209
-116.22.164.32
  116.22.196.145
  116.22.23.152
-116.22.44.225
  116.22.44.63
  116.22.59.211
  116.22.6.219
@@ -24221,10 +22823,8 @@
  116.226.131.41
  116.227.212.72
  116.227.96.120
-116.227.98.99
  116.228.113.2
  116.228.114.182
-116.228.122.188
  116.228.160.22
  116.228.161.195
  116.228.196.210
@@ -24236,11 +22836,11 @@
  116.228.53.177
  116.228.53.227
  116.228.98.42
+116.230.158.16
  116.230.60.185
  116.230.93.137
  116.231.80.148
  116.232.102.168
-116.232.159.137
  116.232.77.136
  116.232.85.114
  116.233.19.80
@@ -24250,18 +22850,12 @@
  116.235.56.162
  116.236.121.78
  116.236.145.14
-116.236.147.38
-116.236.15.171
-116.236.168.141
  116.236.17.59
-116.236.189.134
-116.236.200.254
  116.236.218.66
  116.236.222.106
  116.236.225.218
  116.236.240.102
  116.236.243.130
-116.236.251.214
  116.236.30.222
  116.236.32.222
  116.236.60.114
@@ -24272,23 +22866,29 @@
  116.237.88.199
  116.238.157.171
  116.238.253.26
+116.238.27.68
  116.239.13.149
  116.239.15.26
  116.239.27.145
  116.239.4.130
+116.24.100.10
+116.24.104.17
  116.24.106.188
  116.24.106.190
-116.24.188.50
-116.24.188.6
+116.24.153.243
  116.24.190.60
-116.24.64.220
+116.24.191.201
  116.24.65.123
+116.24.65.42
  116.24.65.45
  116.24.67.121
  116.24.67.50
-116.24.83.200
+116.24.82.42
+116.240.199.84
+116.241.102.247
  116.241.108.189
  116.241.123.91
+116.241.176.182
  116.241.191.122
  116.241.21.72
  116.241.219.248
@@ -24310,16 +22910,14 @@
  116.248.172.43
  116.248.88.225
  116.249.127.46
-116.25.133.45
-116.25.135.202
+116.249.249.171
  116.25.224.123
-116.25.225.246
+116.25.226.90
  116.25.36.182
  116.25.39.184
  116.252.134.40
  116.252.204.88
  116.252.208.123
-116.252.209.27
  116.252.211.33
  116.252.246.98
  116.252.247.27
@@ -24329,7 +22927,6 @@
  116.252.54.230
  116.252.80.130
  116.252.80.181
-116.253.209.88
  116.254.100.165
  116.254.101.173
  116.254.103.181
@@ -24337,10 +22934,7 @@
  116.254.116.99
  116.254.124.110
  116.255.106.89
-116.255.131.142
  116.255.131.3
-116.255.139.162
-116.255.139.236
  116.255.140.18
  116.255.142.147
  116.255.161.148
@@ -24353,7 +22947,6 @@
  116.255.175.72
  116.255.190.176
  116.255.193.51
-116.255.196.135
  116.255.198.57
  116.255.213.176
  116.255.215.142
@@ -24361,13 +22954,11 @@
  116.255.220.8
  116.255.222.168
  116.255.232.130
-116.255.240.3
  116.255.241.168
  116.255.248.139
  116.255.69.236
  116.255.80.194
  116.255.88.60
-116.26.10.221
  116.26.113.138
  116.26.114.4
  116.26.114.6
@@ -24378,31 +22969,24 @@
  116.26.40.98
  116.27.96.18
  116.28.53.13
+116.28.63.212
  116.29.89.139
  116.3.102.225
  116.3.109.131
-116.3.195.76
-116.3.198.225
  116.3.203.192
-116.3.203.197
  116.3.210.205
-116.30.195.179
-116.30.196.111
  116.30.222.153
-116.30.223.10
  116.30.223.104
  116.30.223.178
  116.30.250.73
-116.30.251.86
+116.30.251.249
  116.31.102.81
-116.31.102.82
  116.31.119.129
  116.31.140.21
  116.31.16.65
  116.31.18.155
  116.31.75.162
  116.33.43.41
-116.34.189.55
  116.36.195.112
  116.4.96.10
  116.4.96.132
@@ -24415,6 +22999,7 @@
  116.4.96.227
  116.4.96.240
  116.4.96.243
+116.4.96.83
  116.4.96.95
  116.4.97.117
  116.4.97.149
@@ -24445,6 +23030,7 @@
  116.48.38.134
  116.48.38.24
  116.48.39.240
+116.48.57.202
  116.48.66.104
  116.48.96.130
  116.48.97.219
@@ -24461,17 +23047,16 @@
  116.52.10.198
  116.52.128.192
  116.52.144.172
-116.52.164.10
  116.52.168.20
+116.52.242.45
  116.52.34.19
-116.52.86.112
+116.52.9.220
  116.52.9.90
  116.53.18.134
  116.53.196.78
  116.53.22.14
  116.53.42.122
  116.53.65.169
-116.54.33.84
  116.54.59.197
  116.54.59.238
  116.55.101.228
@@ -24488,21 +23073,24 @@
  116.58.171.67
  116.58.179.3
  116.58.224.56
-116.58.226.31
  116.58.226.78
  116.58.227.40
+116.58.228.124
+116.58.229.125
  116.58.229.173
  116.58.229.21
  116.58.229.80
+116.58.232.114
  116.58.232.116
  116.58.232.127
  116.58.232.135
+116.58.232.148
  116.58.232.155
  116.58.232.161
  116.58.232.162
  116.58.232.19
-116.58.232.55
-116.58.232.8
+116.58.232.236
+116.58.232.240
  116.58.233.29
  116.58.235.18
  116.58.235.69
@@ -24515,7 +23103,7 @@
  116.58.244.53
  116.58.247.12
  116.58.247.27
-116.58.247.68
+116.58.251.214
  116.58.251.85
  116.58.254.196
  116.58.254.205
@@ -24539,7 +23127,6 @@
  116.6.195.86
  116.6.216.50
  116.6.217.140
-116.6.234.145
  116.6.77.82
  116.6.84.186
  116.62.11.138
@@ -24547,6 +23134,7 @@
  116.62.229.19
  116.62.51.6
  116.63.160.13
+116.63.168.75
  116.63.40.181
  116.63.47.225
  116.66.191.161
@@ -24556,13 +23144,11 @@
  116.66.198.59
  116.66.207.53
  116.68.160.114
-116.68.160.214
  116.68.162.105
  116.68.162.86
  116.68.162.99
  116.68.170.218
  116.68.192.130
-116.7.11.251
  116.7.136.182
  116.7.226.66
  116.7.245.182
@@ -24580,13 +23166,13 @@
  116.72.136.91
  116.72.17.122
  116.72.18.85
-116.72.200.146
-116.72.242.182
+116.72.201.104
+116.72.201.182
+116.72.202.235
  116.72.36.155
  116.73.204.181
  116.73.24.9
  116.73.26.238
-116.73.52.136
  116.73.65.223
  116.73.66.179
  116.74.111.230
@@ -24596,14 +23182,11 @@
  116.75.103.58
  116.75.117.40bin.sh
  116.75.194.101
-116.75.198.64
-116.75.212.148
-116.75.213.215
+116.75.199.174
  116.75.34.61
  116.76.60.119
  116.76.60.48
  116.77.219.64
-116.8.106.194
  116.8.32.70
  116.8.36.153
  116.8.37.69
@@ -24618,10 +23201,9 @@
  116.85.56.252
  116.85.59.252
  116.85.60.152
-116.85.64.100
  116.85.66.176
-116.85.66.34
  116.85.71.133
+116.85.72.109
  116.86.123.187
  116.86.130.105
  116.86.133.115
@@ -24651,6 +23233,7 @@
  116.87.22.43
  116.87.29.117
  116.87.36.209
+116.87.41.213
  116.87.48.52
  116.87.71.1
  116.87.72.53
@@ -24659,9 +23242,11 @@
  116.87.78.203
  116.87.9.76
  116.87.94.34
+116.88.1.123
  116.88.101.211
  116.88.114.82
  116.88.128.116
+116.88.13.236
  116.88.130.244
  116.88.132.194
  116.88.140.247
@@ -24692,7 +23277,6 @@
  116.9.154.35
  116.9.154.54
  116.9.228.7
-116.90.1.141
  116.90.118.1
  116.90.165.26
  116.90.225.58
@@ -24701,6 +23285,7 @@
  116.90.229.186
  116.90.230.243
  116.90.237.125
+116.90.238.251
  116.90.59.223
  116.90.82.181
  116.90.82.184
@@ -24709,6 +23294,7 @@
  116.90.87.11
  116.90.87.210
  116.91.189.208
+116.91.93.206
  116.92.213.114
  116.92.219.162
  116.93.119.42
@@ -24721,6 +23307,7 @@
  116.98.140.102
  116.98.142.192
  116.98.167.31
+116.98.169.139
  116.98.246.214
  116.98.254.156
  116.98.76.25
@@ -24741,12 +23328,9 @@
  117.1.123.132
  117.1.127.91
  117.1.16.131
-117.1.20.33
-117.1.94.91
  117.10.100.120
  117.10.211.26
  117.10.31.167
-117.10.55.160
  117.10.93.150
  117.102.102.155
  117.102.104.44
@@ -24761,8 +23345,8 @@
  117.102.127.130
  117.102.16.22
  117.102.224.38
+117.102.230.134
  117.102.26.6
-117.102.76.182
  117.102.77.2
  117.102.77.204
  117.102.82.42
@@ -24772,8 +23356,6 @@
  117.102.86.174
  117.102.87.138
  117.102.92.13
-117.103.155.138
-117.103.168.204
  117.103.2.106
  117.103.2.114
  117.103.5.186
@@ -24781,7 +23363,6 @@
  117.103.86.62
  117.104.181.164
  117.107.137.162
-117.107.163.240
  117.107.193.98
  117.107.21.196
  117.107.213.244
@@ -24790,7 +23371,6 @@
  117.107.213.251
  117.107.216.67
  117.109.19.147
-117.109.92.164
  117.11.222.228
  117.11.92.184
  117.114.138.246
@@ -24811,7 +23391,8 @@
  117.12.193.25
  117.12.194.254
  117.12.211.218
-117.12.48.66
+117.12.58.163
+117.12.66.98
  117.120.58.1
  117.120.58.129
  117.120.58.250
@@ -24820,9 +23401,6 @@
  117.121.0.81
  117.121.100.11
  117.121.204.80
-117.121.213.10
-117.121.213.107
-117.121.213.128
  117.121.213.63
  117.121.215.101
  117.121.241.3
@@ -24840,8 +23418,6 @@
  117.127.16.208
  117.13.245.63
  117.13.8.87
-117.13.90.39
-117.131.111.131
  117.131.111.163
  117.131.179.66
  117.131.253.170
@@ -24850,7 +23426,6 @@
  117.131.43.196
  117.131.43.197
  117.131.43.198
-117.131.60.59
  117.132.1.47
  117.132.3.231
  117.135.226.105
@@ -24874,8 +23449,6 @@
  117.141.155.241
  117.141.18.235
  117.141.224.31
-117.141.32.74
-117.141.96.168
  117.141.97.237
  117.144.189.69
  117.144.200.236
@@ -24896,6 +23469,7 @@
  117.149.164.157
  117.149.20.18
  117.15.114.178
+117.15.121.126
  117.15.169.130
  117.15.235.149
  117.15.53.116
@@ -24911,7 +23485,6 @@
  117.157.71.49
  117.157.78.2
  117.157.94.13
-117.157.98.211
  117.158.107.189
  117.158.112.27
  117.158.116.104
@@ -24923,12 +23496,11 @@
  117.158.208.68
  117.158.228.29
  117.158.61.254
+117.158.64.100
  117.158.65.15
  117.158.66.137
-117.158.73.58
  117.158.77.154
  117.158.77.41
-117.158.78.5
  117.158.87.112
  117.158.94.152
  117.158.94.153
@@ -24956,7 +23528,6 @@
  117.172.79.4
  117.172.81.203
  117.172.86.130
-117.173.209.69
  117.173.215.73
  117.173.67.119
  117.174.165.36
@@ -24964,6 +23535,7 @@
  117.175.160.70
  117.175.44.34
  117.175.58.99
+117.176.104.102
  117.176.122.20
  117.176.136.190
  117.176.173.180
@@ -24973,7 +23545,6 @@
  117.177.122.189
  117.18.4.157
  117.18.5.133
-117.184.114.139
  117.184.200.154
  117.184.200.180
  117.184.200.185
@@ -24986,40 +23557,32 @@
  117.187.63.201
  117.187.64.50
  117.188.39.150
-117.190.139.16
  117.190.242.69
  117.191.101.208
+117.191.65.8
  117.191.67.68
  117.191.68.57
  117.191.71.176
-117.192.116.255
-117.192.224.145
-117.192.224.229
-117.192.226.186
-117.192.226.39
-117.192.227.245
+117.192.224.26
+117.192.226.29
  117.192.42.33
  117.192.46.40
  117.192.8.86
+117.193.162.211
  117.193.79.162
-117.194.160.190
-117.194.160.203
  117.194.160.44
+117.194.161.141
  117.194.161.232
+117.194.161.54
  117.194.161.64
  117.194.161.66
-117.194.162.175
-117.194.163.128
-117.194.163.60
+117.194.162.145
+117.194.164.116
  117.194.164.57
+117.194.164.6
+117.194.164.87
  117.194.165.195
-117.194.165.253
-117.194.165.90
-117.194.167.13
-117.194.167.191
  117.194.167.80
-117.194.179.130
-117.194.185.211
  117.195.117.84
  117.195.119.98
  117.195.49.142
@@ -25033,29 +23596,29 @@
  117.196.237.88
  117.196.237.92
  117.196.238.107
+117.196.238.113
  117.196.238.130
+117.196.238.240
  117.196.238.62
  117.196.239.236
  117.196.239.239
  117.196.250.210
-117.196.49.162
-117.196.50.1
-117.196.50.161
-117.196.50.188
-117.196.50.218
-117.196.51.219
+117.196.48.172
+117.196.49.56
+117.196.50.227
+117.196.50.252
  117.197.102.195
  117.197.126.130
  117.197.127.98
-117.197.18.13
-117.197.28.77
  117.198.101.213
  117.198.218.70
  117.198.76.152
  117.199.40.210
  117.2.133.106
+117.2.137.179
  117.2.139.117
  117.2.165.12
+117.2.165.159
  117.2.184.254
  117.2.185.72
  117.2.204.146
@@ -25071,11 +23634,14 @@
  117.20.204.83
  117.20.205.13
  117.20.205.77
+117.20.213.29
  117.20.223.73
  117.20.223.92
+117.20.229.107
  117.20.229.12
  117.20.230.38
  117.20.230.39
+117.20.236.14
  117.20.238.12
  117.20.243.40
  117.20.247.156
@@ -25088,26 +23654,29 @@
  117.200.48.82
  117.200.48.94
  117.200.76.30
-117.202.64.179
-117.202.64.92
+117.202.134.9
+117.202.64.125
+117.202.64.171
+117.202.64.206
+117.202.65.131
  117.202.65.188
-117.202.65.205
-117.202.65.21
-117.202.65.54
-117.202.66.134
-117.202.66.182
-117.202.66.200
-117.202.66.86
-117.202.68.225
-117.202.70.135
-117.202.70.69
-117.202.71.148
-117.202.71.85
+117.202.65.80
+117.202.66.125
+117.202.67.13
+117.202.68.251
+117.202.68.45
+117.202.69.194
+117.202.69.235
+117.202.69.38
+117.202.69.81
+117.202.71.130
+117.202.71.40
+117.202.71.98
+117.202.78.243
  117.202.78.38
-117.202.78.92
-117.202.79.26
-117.202.79.68
-117.202.79.94
+117.202.78.79
+117.202.78.82
+117.202.79.174
  117.202.8.55
  117.204.252.122
  117.204.255.60
@@ -25129,74 +23698,70 @@
  117.207.46.39
  117.207.47.66
  117.208.127.183
-117.208.133.169
-117.208.133.2
-117.208.134.110
-117.208.134.241
-117.208.135.195
  117.208.51.51
  117.21.178.28
  117.21.178.33
  117.21.178.44
+117.21.178.45
  117.21.178.49
  117.21.246.46
  117.21.77.34
+117.210.181.145
  117.211.100.22
  117.211.126.230
  117.211.147.57
  117.211.162.106
  117.211.166.168
  117.211.169.164
-117.211.19.120
  117.211.192.70
  117.211.210.9
-117.211.40.129
  117.211.40.180
  117.211.40.26
+117.211.40.42
  117.211.41.31
-117.211.41.6
-117.211.42.180
-117.211.42.227
+117.211.41.85
+117.211.42.143
  117.211.42.48
-117.211.43.121
-117.211.43.219
-117.211.43.56
+117.211.43.11
+117.211.43.52
+117.211.43.68
  117.212.100.217
  117.212.194.117
  117.212.241.152
  117.212.242.183
  117.213.203.86
-117.213.41.166
-117.213.43.111
-117.213.43.163
+117.213.41.183
+117.213.41.31
+117.213.41.63
+117.213.42.141
+117.213.42.37
  117.213.43.178
-117.213.43.3
-117.213.43.63
-117.213.45.214
-117.213.45.76
-117.213.47.218
+117.213.43.185
+117.213.43.242
+117.213.43.94
+117.213.44.36
+117.213.44.61
+117.213.45.192
+117.213.45.231
+117.213.45.81
+117.213.45.9
+117.213.45.98
+117.213.46.22
+117.213.47.90
  117.214.123.217
-117.215.129.29
  117.215.130.27
  117.215.133.36
-117.215.248.145
-117.215.248.220
-117.215.248.56
-117.215.249.20
-117.215.249.66
-117.215.251.158
+117.216.251.20
  117.217.126.171
  117.217.14.29
  117.217.69.150
  117.218.174.250
  117.218.176.164
  117.218.59.146
-117.22.133.45
+117.22.144.60
  117.22.144.71
-117.22.144.86
  117.22.187.207
  117.22.230.94
-117.220.143.33
  117.220.15.119
  117.220.170.193
  117.220.171.105
@@ -25205,28 +23770,36 @@
  117.220.176.227
  117.220.4.130
  117.221.106.16
-117.222.160.182
-117.222.160.200
-117.222.161.0
+117.222.160.110
+117.222.160.157
  117.222.161.121
-117.222.162.29
-117.222.163.160
-117.222.164.106
-117.222.164.134
-117.222.164.42
-117.222.165.50
-117.222.166.27
+117.222.161.17
+117.222.162.13
+117.222.162.218
+117.222.162.59
+117.222.163.167
+117.222.164.14
+117.222.164.91
+117.222.165.52
+117.222.166.106
+117.222.166.116
+117.222.167.143
+117.222.167.210
  117.222.61.229
+117.222.62.139
+117.222.63.12
  117.223.136.107
  117.223.181.82
-117.223.185.195
  117.23.5.151
  117.232.96.204
+117.236.139.55
  117.236.147.159
  117.239.136.179
  117.239.150.66
  117.239.183.185
+117.239.2.251
  117.239.209.24
+117.239.226.81
  117.239.238.70
  117.239.240.202
  117.239.39.51
@@ -25246,46 +23819,38 @@
  117.241.150.62
  117.241.150.91
  117.241.172.3
-117.241.64.180
-117.241.64.183
-117.241.66.146
-117.241.66.194
-117.241.66.212
-117.241.66.223
+117.241.173.40
+117.241.65.249
+117.241.65.5
+117.241.66.196
+117.241.66.240
+117.241.67.102
+117.241.67.207
+117.241.67.231
  117.241.74.33
  117.242.147.101
  117.242.147.109
  117.242.147.5
  117.242.147.69
  117.242.147.73
-117.242.147.93
  117.242.147.97
  117.242.154.112
  117.242.188.82
  117.242.188.84
  117.242.188.86
-117.242.208.109
-117.242.208.133
-117.242.208.138
+117.242.208.146
  117.242.208.165
-117.242.208.175
-117.242.208.191
-117.242.208.227
-117.242.208.59
-117.242.208.61
+117.242.208.216
+117.242.208.47
  117.242.208.93
-117.242.209.249
-117.242.209.78
-117.242.210.141
-117.242.210.219
+117.242.209.248
+117.242.211.217
+117.242.211.95
  117.242.38.243
+117.242.39.208
  117.242.45.133
-117.247.158.248
  117.247.16.142
-117.247.183.216
  117.247.191.243
-117.247.205.203
-117.247.206.112
  117.247.208.108
  117.247.208.95
  117.247.209.129
@@ -25295,37 +23860,20 @@
  117.247.70.91
  117.247.72.49
  117.247.74.41
-117.247.83.240
-117.247.86.117
  117.247.88.232
+117.247.88.238
  117.247.92.104
-117.248.187.33
-117.248.60.241
-117.248.61.186
-117.248.62.153
-117.248.62.52
-117.248.94.252
  117.25.107.78
  117.25.129.249
-117.25.133.10
-117.25.139.39
  117.25.145.151
  117.25.149.254
  117.25.182.90
  117.251.21.23
-117.251.56.146
-117.251.56.239
-117.251.57.193
-117.251.57.65
-117.251.58.0
-117.251.58.58
-117.251.59.109
-117.251.59.24
+117.251.57.84
+117.251.59.129
  117.251.60.247
-117.251.62.234
-117.251.63.169
-117.251.63.201
-117.251.63.254
+117.251.61.32
+117.252.208.195
  117.252.218.190
  117.252.223.147
  117.252.64.161
@@ -25339,7 +23887,6 @@
  117.254.186.98
  117.254.197.13
  117.254.50.51
-117.254.93.234
  117.255.220.201
  117.255.220.70
  117.26.104.225
@@ -25347,7 +23894,6 @@
  117.26.110.43
  117.26.110.75
  117.26.124.66
-117.26.221.186
  117.26.243.167
  117.27.136.37
  117.27.136.42
@@ -25359,17 +23905,15 @@
  117.27.170.56
  117.27.172.66
  117.27.88.61
-117.28.13.8
  117.28.25.50
  117.28.254.143
  117.28.255.165
  117.28.32.51
-117.29.240.71
+117.29.238.29
  117.29.42.99
  117.3.141.51
  117.3.150.201
  117.3.210.111
-117.3.67.9
  117.3.69.209
  117.30.164.119
  117.30.196.192
@@ -25379,28 +23923,20 @@
  117.30.223.231
  117.30.232.48
  117.30.236.21
-117.30.236.237
  117.30.237.225
  117.30.237.78
-117.31.76.232
  117.32.96.34
  117.33.128.218
  117.33.137.19
-117.33.158.93
  117.33.225.111
  117.33.253.49
-117.34.105.233
  117.34.105.42
  117.34.118.137
-117.34.210.106
  117.34.25.155
  117.34.66.245
  117.34.70.53
  117.34.74.252
  117.34.87.48
-117.34.91.2
-117.34.91.22
-117.34.91.23
  117.34.99.31
  117.35.118.42
  117.35.158.94
@@ -25410,17 +23946,16 @@
  117.36.198.199
  117.36.198.91
  117.36.74.101
-117.36.74.58
+117.37.125.152
  117.37.125.246
  117.37.125.254
  117.39.63.34
-117.4.101.26
  117.4.107.199
  117.4.136.11
  117.4.139.62
  117.4.145.16
  117.4.241.135
-117.4.247.80
+117.4.64.10
  117.4.98.133
  117.40.138.178
  117.40.174.2
@@ -25435,39 +23970,24 @@
  117.42.204.242
  117.43.82.214
  117.43.83.206
-117.44.46.199
  117.44.51.221
  117.44.51.45
  117.44.51.89
-117.44.60.219
  117.45.90.37
  117.48.192.245
-117.48.203.169
-117.48.227.152
-117.48.228.46
-117.5.115.77
  117.5.41.101
  117.5.42.174
-117.50.10.177
  117.50.10.244
-117.50.100.13
  117.50.100.216
  117.50.101.117
  117.50.104.206
-117.50.105.55
-117.50.106.150
-117.50.107.175
  117.50.11.192
-117.50.11.3
  117.50.110.19
  117.50.115.156
  117.50.116.120
  117.50.116.16
  117.50.116.98
-117.50.126.15
  117.50.126.4
-117.50.13.51
-117.50.134.134
  117.50.137.36
  117.50.18.243
  117.50.2.235
@@ -25479,7 +23999,6 @@
  117.50.22.148
  117.50.22.167
  117.50.23.52
-117.50.24.33
  117.50.25.188
  117.50.3.142
  117.50.34.131
@@ -25488,45 +24007,32 @@
  117.50.36.250
  117.50.39.62
  117.50.40.157
-117.50.40.36
-117.50.43.135
  117.50.43.204
-117.50.44.115
  117.50.44.5
  117.50.44.88
-117.50.48.238
  117.50.49.57
-117.50.5.198
  117.50.5.37
  117.50.50.186
  117.50.55.132
-117.50.61.55
  117.50.63.120
  117.50.63.227
-117.50.63.241
  117.50.63.253
  117.50.65.167
-117.50.65.85
-117.50.71.169
+117.50.7.159
  117.50.82.156
  117.50.84.240
  117.50.9.239
  117.50.92.209
  117.50.93.75
-117.50.99.197
  117.51.137.24
  117.51.137.82
  117.51.138.89
-117.51.141.241
  117.51.142.47
-117.51.145.81
-117.51.146.122
+117.51.147.103
  117.51.150.202
  117.51.153.18
-117.51.153.70
  117.51.156.217
  117.51.158.223
-117.51.159.77
  117.52.31.220
  117.52.91.248
  117.53.255.20
@@ -25540,15 +24046,14 @@
  117.54.236.25
  117.54.238.133
  117.54.250.58
+117.55.176.181
  117.55.209.126
  117.55.232.193
-117.55.241.178
  117.55.241.61
  117.56.247.87
  117.57.52.10
-117.57.62.89
  117.57.94.193
-117.57.95.63
+117.57.94.47
  117.57.97.13
  117.57.99.168
  117.58.240.177
@@ -25562,12 +24067,9 @@
  117.6.160.167
  117.6.161.118
  117.6.162.47
-117.6.223.1
+117.6.55.35
  117.6.86.134
-117.6.95.52
-117.6.97.138
  117.60.134.112
-117.60.134.79
  117.60.204.195
  117.60.21.63
  117.60.239.70
@@ -25582,7 +24084,6 @@
  117.62.175.106
  117.62.22.250
  117.63.103.76
-117.63.151.91
  117.63.156.234
  117.63.157.34
  117.63.158.101
@@ -25593,11 +24094,7 @@
  117.63.195.220
  117.63.2.58
  117.63.223.200
-117.63.228.64
-117.63.248.125
  117.63.253.69
-117.63.254.195
-117.63.255.241
  117.63.49.41
  117.63.50.238
  117.63.51.128
@@ -25605,8 +24102,6 @@
  117.64.148.159
  117.64.224.207
  117.64.250.205
-117.65.15.209
-117.66.243.77
  117.67.185.118
  117.67.4.101
  117.67.4.123
@@ -25624,9 +24119,10 @@
  117.67.73.223
  117.67.73.248
  117.68.116.91
+117.68.194.24
+117.69.154.187
  117.69.191.218
-117.69.230.223
-117.69.46.73
+117.69.31.2
  117.7.184.188
  117.7.213.19
  117.7.236.110
@@ -25637,6 +24133,7 @@
  117.70.61.151
  117.70.74.67
  117.71.107.24
+117.71.159.15
  117.71.178.178
  117.71.57.195
  117.71.58.144
@@ -25675,11 +24172,11 @@
  117.81.242.138
  117.81.252.99
  117.81.59.216
+117.81.60.28
  117.82.138.70
  117.82.147.129
  117.82.147.134
  117.82.156.195
-117.82.163.209
  117.82.176.42
  117.82.78.44
  117.83.15.246
@@ -25692,7 +24189,7 @@
  117.84.208.189
  117.85.218.227
  117.85.89.213
-117.86.14.85
+117.86.14.42
  117.86.155.236
  117.86.177.219
  117.86.212.189
@@ -25724,15 +24221,13 @@
  117.87.78.212
  117.88.151.152
  117.88.173.4
-117.88.210.174
  117.88.25.154
  117.88.26.25
  117.89.12.183
-117.89.128.132
-117.89.173.138
  117.89.174.206
  117.89.30.61
  117.89.5.114
+117.89.95.129
  117.90.119.186
  117.90.119.63
  117.90.128.14
@@ -25744,19 +24239,15 @@
  117.90.234.118
  117.90.254.53
  117.90.33.131
-117.90.47.185
  117.90.75.236
  117.90.89.195
  117.90.89.95
  117.90.94.211
  117.91.168.60
  117.91.186.39
-117.91.186.55
  117.91.186.77
-117.91.254.24
  117.92.120.42
  117.92.153.207
-117.92.242.102
  117.93.114.188
  117.93.115.109
  117.93.117.238
@@ -25771,11 +24262,12 @@
  117.93.216.98
  117.93.33.55
  117.93.79.226
+117.94.158.68
  117.94.174.64
  117.94.180.233
  117.94.223.247
+117.94.236.191
  117.94.26.215
-117.94.47.28
  117.94.50.123
  117.95.132.49
  117.95.160.220
@@ -25800,26 +24292,19 @@
  117.96.192.75
  117.96.217.21
  117.98.190.157
-117.99.90.4
  117.ip-51-178-82.eu
  11716-45741.ws4.pph-server.de
  1171j.projectsbit.org
  1177857-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  117cbf81fba6f4aaa4363ed99db7fce674427f2d.info
-118.100.180.79
  118.100.22.163
  118.100.49.228
  118.100.6.97
  118.100.71.139
  118.101.0.243
  118.101.149.206
-118.101.192.62
-118.101.192.81
-118.101.194.19
  118.101.252.59
-118.101.47.235
  118.101.49.137
-118.101.51.111
  118.101.7.13
  118.102.168.199
  118.103.119.50
@@ -25835,10 +24320,13 @@
  118.112.186.58
  118.112.204.101
  118.112.205.31
+118.112.207.172
+118.112.207.78
  118.112.92.52
  118.113.15.27
  118.113.192.238
-118.113.95.60
+118.114.169.196
+118.114.171.172
  118.114.193.160
  118.114.208.192
  118.114.237.85
@@ -25846,10 +24334,7 @@
  118.114.33.233
  118.116.104.158
  118.116.106.160
-118.116.107.70
-118.116.108.221
  118.116.109.158
-118.116.111.170
  118.116.121.251
  118.116.127.224
  118.116.15.203
@@ -25860,7 +24345,7 @@
  118.119.110.13
  118.120.145.eliterv.ca
  118.120.173.89
-118.121.198.24
+118.121.119.193
  118.121.61.158
  118.121.62.53
  118.122.102.166
@@ -25871,15 +24356,12 @@
  118.122.124.85
  118.122.124.86
  118.122.124.87
-118.122.148.193
-118.122.246.211
  118.122.38.61
  118.122.4.173
  118.122.40.14
  118.122.6.219
  118.122.6.227
  118.122.91.148
-118.123.11.98
  118.123.13.29
  118.123.147.185
  118.123.15.235
@@ -25909,9 +24391,7 @@
  118.125.227.210
  118.125.227.227
  118.125.93.190
-118.126.105.120
  118.126.105.126
-118.126.105.207
  118.126.109.155
  118.126.110.28
  118.126.113.29
@@ -25923,12 +24403,10 @@
  118.126.88.254
  118.126.90.104
  118.126.90.89
-118.126.90.93
  118.126.91.71
  118.126.93.16
  118.126.97.184
  118.126.98.159
-118.126.99.88
  118.127.34.29
  118.128.29.139
  118.129.166.10
@@ -25947,13 +24425,13 @@
  118.136.14.108
  118.136.63.72
  118.136.86.43
+118.137.178.40
  118.139.178.67
  118.139.245.114
  118.140.150.74
  118.140.160.93
  118.140.176.162
  118.140.187.226
-118.140.252.230
  118.140.38.6
  118.140.57.146
  118.144.68.87
@@ -25974,12 +24452,11 @@
  118.150.52.81
  118.151.210.242
  118.151.220.206
-118.156.69.83
+118.156.248.29
  118.159.81.206
  118.159.82.124
  118.16.177.248
  118.160.10.195
-118.160.101.113
  118.160.230.91
  118.160.3.253
  118.160.48.63
@@ -26002,14 +24479,10 @@
  118.163.13.140
  118.163.13.200
  118.163.13.244
-118.163.135.17
-118.163.135.18
  118.163.146.240
-118.163.146.70
  118.163.152.225
  118.163.163.44
  118.163.169.182
-118.163.176.97
  118.163.180.2
  118.163.180.3
  118.163.180.56
@@ -26018,6 +24491,7 @@
  118.163.192.48
  118.163.199.186
  118.163.202.47
+118.163.207.67
  118.163.208.241
  118.163.215.182
  118.163.222.45
@@ -26033,11 +24507,13 @@
  118.163.91.125
  118.163.97.19
  118.165.101.141
+118.165.107.4
+118.165.123.76
  118.165.160.94
  118.165.161.46
-118.165.175.124
  118.165.177.67
  118.165.235.245
+118.166.107.182
  118.166.111.195
  118.166.114.195
  118.166.142.4
@@ -26063,10 +24539,12 @@
  118.169.44.151
  118.170.168.55
  118.170.185.59
+118.170.187.167
  118.170.36.155
  118.170.41.203
  118.170.43.138
  118.170.54.243
+118.170.56.16
  118.170.57.130
  118.170.57.61
  118.171.12.11
@@ -26074,20 +24552,24 @@
  118.171.200.7
  118.171.55.136
  118.171.95.218
+118.172.100.203
+118.172.112.45
  118.172.115.93
  118.172.117.126
+118.172.12.66
  118.172.129.231
  118.172.130.172
  118.172.130.252
  118.172.135.51
  118.172.141.11
  118.172.146.139
+118.172.15.157
  118.172.158.239
  118.172.159.123
  118.172.159.141
+118.172.159.87
  118.172.165.81
  118.172.176.41
-118.172.18.180
  118.172.181.147
  118.172.199.130
  118.172.201.105
@@ -26096,7 +24578,6 @@
  118.172.201.49
  118.172.201.5
  118.172.201.59
-118.172.201.80
  118.172.201.89
  118.172.203.209
  118.172.207.37
@@ -26121,19 +24602,19 @@
  118.172.54.66
  118.172.60.65
  118.172.74.225
-118.172.74.25
+118.172.87.4
  118.172.97.120
  118.173.109.174
-118.173.119.173
-118.173.128.211
  118.173.128.65
  118.173.130.207
  118.173.152.245
  118.173.156.4
  118.173.160.125
-118.173.172.93
+118.173.163.83
+118.173.165.40
  118.173.182.148
  118.173.182.250
+118.173.194.28
  118.173.197.241
  118.173.204.253
  118.173.214.86
@@ -26155,24 +24636,23 @@
  118.173.38.238
  118.173.54.2
  118.173.66.8
+118.173.77.108
  118.173.95.141
  118.174.12.126
  118.174.159.108
  118.174.159.62
  118.174.161.235
-118.174.166.225
  118.174.167.158
  118.174.185.203
  118.174.186.95
+118.174.187.179
  118.174.194.227
-118.174.196.112
  118.174.196.130
  118.174.196.86
  118.174.209.220
  118.174.209.45
  118.174.211.220
  118.174.219.110
-118.174.219.68
  118.174.220.14
  118.174.220.211
  118.174.220.237
@@ -26180,7 +24660,6 @@
  118.174.220.61
  118.174.232.106
  118.174.232.128
-118.174.232.148
  118.174.232.181
  118.174.232.234
  118.174.232.237
@@ -26204,7 +24683,6 @@
  118.174.74.148
  118.174.79.50
  118.174.81.224
-118.174.93.83
  118.175.183.190
  118.175.207.129
  118.175.207.205
@@ -26215,11 +24693,13 @@
  118.175.227.219
  118.175.228.149
  118.175.233.249
+118.175.235.166
  118.175.235.199
  118.175.235.216
  118.175.235.75
  118.175.235.90
  118.175.236.208
+118.175.240.205
  118.175.244.111
  118.175.46.191
  118.175.7.114
@@ -26251,8 +24731,9 @@
  118.179.208.162
  118.179.226.248
  118.179.42.19
+118.179.66.148
  118.179.96.158
-118.180.251.9
+118.180.219.91
  118.181.40.109
  118.182.122.109
  118.182.21.13
@@ -26278,8 +24759,6 @@
  118.185.202.82
  118.185.38.173
  118.186.17.38
-118.186.17.45
-118.186.2.18
  118.186.2.211
  118.186.203.145
  118.186.203.146
@@ -26303,21 +24782,15 @@
  118.187.50.30
  118.187.65.147
  118.187.65.34
-118.187.8.34
  118.188.20.229
-118.188.20.5
  118.189.139.212
  118.189.187.219
  118.189.22.244
-118.189.22.67
  118.189.68.135
  118.189.74.228
-118.189.8.253
  118.189.9.99
  118.19.126.68
-118.190.148.25
  118.190.40.252
-118.190.60.24
  118.190.90.36
  118.193.140.131
  118.193.151.250
@@ -26325,7 +24798,6 @@
  118.193.151.51
  118.193.157.98
  118.193.158.51
-118.193.161.11
  118.193.161.87
  118.193.166.177
  118.193.168.32
@@ -26343,7 +24815,6 @@
  118.193.32.219
  118.193.33.186
  118.193.34.198
-118.193.34.233
  118.193.35.16
  118.193.35.172
  118.193.38.38
@@ -26358,10 +24829,8 @@
  118.193.41.221
  118.193.41.249
  118.193.47.130
-118.194.132.112
  118.194.229.133
  118.194.236.26
-118.194.236.80
  118.194.51.162
  118.200.105.74
  118.200.121.35
@@ -26378,23 +24847,18 @@
  118.201.212.230
  118.201.240.6
  118.201.247.28
-118.201.65.165
  118.202.255.141
  118.208.110.92
-118.208.159.77
  118.209.140.114
-118.209.253.89
  118.21.157.106
  118.21.99.28
-118.210.35.248
-118.211.23.246
+118.211.15.92
  118.211.61.208
  118.212.107.190
  118.212.113.187
  118.212.113.239
  118.212.114.141
  118.212.114.209
-118.212.115.253
  118.212.115.80
  118.212.117.61
  118.212.117.96
@@ -26405,15 +24869,14 @@
  118.213.176.234
  118.213.225.102
  118.216.209.85
-118.217.181.116
  118.217.183.234
  118.217.216.132
-118.217.27.244
  118.219.188.8
  118.219.254.105
  118.219.29.175
  118.22.110.102
  118.22.112.15
+118.22.203.25
  118.220.255.156
  118.221.200.196
  118.222.208.33
@@ -26426,10 +24889,10 @@
  118.232.124.228
  118.232.124.252
  118.232.125.120
+118.232.126.247
  118.232.127.101
  118.232.128.147
  118.232.130.189
-118.232.130.210
  118.232.130.222
  118.232.136.183
  118.232.14.129
@@ -26472,7 +24935,6 @@
  118.233.28.64
  118.233.40.108
  118.233.40.125
-118.233.40.174
  118.233.62.136
  118.233.62.169
  118.233.63.194
@@ -26482,9 +24944,8 @@
  118.233.92.135
  118.237.131.228
  118.237.136.21
-118.239.21.4
+118.238.236.25
  118.24.1.9
-118.24.10.13
  118.24.100.198
  118.24.102.189
  118.24.104.160
@@ -26500,14 +24961,10 @@
  118.24.109.70
  118.24.11.226
  118.24.114.205
-118.24.114.22
  118.24.115.181
-118.24.115.185
-118.24.115.241
  118.24.116.78
  118.24.117.104
  118.24.117.134
-118.24.117.236
  118.24.118.97
  118.24.119.36
  118.24.119.45
@@ -26517,7 +24974,6 @@
  118.24.121.227
  118.24.121.69
  118.24.122.242
-118.24.122.36
  118.24.123.34
  118.24.125.81
  118.24.126.48
@@ -26528,7 +24984,6 @@
  118.24.14.106
  118.24.14.64
  118.24.140.195
-118.24.140.69
  118.24.142.170
  118.24.146.186
  118.24.148.18
@@ -26538,18 +24993,13 @@
  118.24.151.254
  118.24.153.198
  118.24.153.214
-118.24.153.230
  118.24.156.184
  118.24.156.209
  118.24.158.103
  118.24.158.42
-118.24.160.242
-118.24.17.128
  118.24.17.28
  118.24.175.151
-118.24.18.226
  118.24.2.141
-118.24.2.219
  118.24.2.83
  118.24.208.24
  118.24.211.170
@@ -26559,28 +25009,23 @@
  118.24.219.30
  118.24.22.5
  118.24.231.93
-118.24.232.241
  118.24.233.84
  118.24.234.79
  118.24.236.203
  118.24.237.118
-118.24.237.92
-118.24.239.245
  118.24.241.217
  118.24.241.97
  118.24.243.39
  118.24.243.53
  118.24.245.56
-118.24.247.76
-118.24.250.84
  118.24.253.100
  118.24.255.210
  118.24.26.173
+118.24.27.247
  118.24.30.97
  118.24.33.38
  118.24.35.5
  118.24.36.247
-118.24.38.12
  118.24.42.159
  118.24.48.15
  118.24.48.18
@@ -26588,29 +25033,26 @@
  118.24.5.125
  118.24.51.199
  118.24.51.76
+118.24.53.161
  118.24.54.178
  118.24.6.215
-118.24.6.69
  118.24.63.50
  118.24.7.98
  118.24.70.248
-118.24.71.83
+118.24.72.133
  118.24.72.18
  118.24.72.84
  118.24.72.92
  118.24.8.99
  118.24.80.229
-118.24.82.212
  118.24.82.81
  118.24.83.41
  118.24.84.55
  118.24.85.21
  118.24.89.224
-118.24.89.243
-118.24.9.152
  118.24.90.64
-118.24.99.230
  118.241.9.15
+118.243.22.87
  118.243.95.37
  118.244.128.0
  118.244.128.17
@@ -26618,29 +25060,20 @@
  118.244.128.29
  118.244.128.4
  118.244.192.13
-118.244.195.141
  118.249.136.175
+118.249.20.118
  118.249.80.41
  118.25.1.48
  118.25.103.178
-118.25.104.200
-118.25.104.48
  118.25.108.201
-118.25.109.46
  118.25.11.153
-118.25.11.204
  118.25.11.8
  118.25.111.130
-118.25.111.153
  118.25.114.245
  118.25.114.3
-118.25.12.9
-118.25.123.165
  118.25.123.42
-118.25.124.182
  118.25.125.17
  118.25.125.187
-118.25.125.189
  118.25.128.221
  118.25.131.80
  118.25.133.121
@@ -26648,37 +25081,23 @@
  118.25.138.53
  118.25.139.201
  118.25.14.14
-118.25.14.19
  118.25.141.195
  118.25.142.138
  118.25.144.133
  118.25.144.49
-118.25.146.128
  118.25.150.183
  118.25.152.169
-118.25.153.63
-118.25.154.146
  118.25.154.210
-118.25.173.57
-118.25.175.161
  118.25.176.15
-118.25.177.225
-118.25.178.111
-118.25.18.130
  118.25.18.97
  118.25.181.3
  118.25.182.118
-118.25.182.230
  118.25.182.61
  118.25.192.122
  118.25.194.250
-118.25.195.237
-118.25.195.244
  118.25.195.78
  118.25.196.31
  118.25.2.60
-118.25.21.176
-118.25.213.185
  118.25.215.186
  118.25.216.77
  118.25.22.185
@@ -26692,16 +25111,13 @@
  118.25.251.4
  118.25.26.111
  118.25.26.75
-118.25.27.102
  118.25.27.67
  118.25.3.65
  118.25.35.202
-118.25.36.79
  118.25.39.110
  118.25.40.183
  118.25.43.101
  118.25.44.66
-118.25.47.130
  118.25.49.119
  118.25.53.96
  118.25.55.155
@@ -26709,28 +25125,19 @@
  118.25.57.184
  118.25.59.28
  118.25.59.57
-118.25.6.53
  118.25.62.210
  118.25.63.170
  118.25.64.152
-118.25.65.163
-118.25.68.254
  118.25.7.83
  118.25.71.53
-118.25.74.199
  118.25.74.248
  118.25.78.123
-118.25.79.56
-118.25.8.234
-118.25.82.219
  118.25.84.146
  118.25.88.204
  118.25.88.47
  118.25.91.103
  118.25.91.168
  118.25.96.246
-118.25.96.30
-118.25.99.44
  118.250.0.166
  118.250.16.108
  118.250.3.148
@@ -26749,7 +25156,6 @@
  118.254.110.127
  118.254.111.235
  118.254.111.24
-118.254.111.57
  118.254.121.52
  118.254.20.187
  118.254.20.61
@@ -26759,24 +25165,19 @@
  118.26.168.39
  118.27.1.192
  118.27.11.126
-118.27.12.150
+118.27.11.79
  118.27.13.23
  118.27.14.123
  118.27.14.194
  118.27.16.42
  118.27.19.93
-118.27.19.96
  118.27.20.138
-118.27.21.194
  118.27.22.241
-118.27.24.127
  118.27.27.122
  118.27.28.16
  118.27.28.171
  118.27.31.50
-118.27.33.234
  118.27.35.131
-118.27.37.223
  118.27.38.41
  118.27.39.94
  118.27.4.225
@@ -26787,7 +25188,6 @@
  118.27.72.85
  118.27.73.126
  118.27.73.15
-118.27.73.160
  118.27.73.197
  118.27.73.24
  118.27.73.47
@@ -26815,12 +25215,14 @@
  118.31.120.119
  118.31.121.93
  118.31.164.48
-118.31.18.235
  118.31.244.29
+118.31.33.174
  118.31.46.67
  118.31.52.208
+118.32.170.122
  118.32.18.169
  118.32.201.179
+118.32.21.140
  118.32.210.177
  118.32.210.177bin.sh
  118.32.211.9
@@ -26831,7 +25233,10 @@
  118.32.89.126
  118.33.129.88
  118.33.153.133
+118.33.153.233
  118.33.153.74
+118.33.153.88
+118.33.155.189
  118.33.198.249
  118.33.213.196
  118.33.215.109
@@ -26847,7 +25252,6 @@
  118.34.135.166
  118.34.196.4
  118.34.199.30
-118.34.27.146
  118.34.60.105
  118.34.62.154
  118.35.184.185
@@ -26858,9 +25262,6 @@
  118.36.154.73
  118.36.21.147
  118.36.214.221
-118.36.234.144
-118.36.234.187
-118.36.240.156
  118.36.66.178
  118.36.66.178bin.sh
  118.36.74.168
@@ -26868,10 +25269,12 @@
  118.37.197.49
  118.37.53.196
  118.38.122.198
+118.38.143.41
  118.38.162.122
  118.38.183.87
  118.38.217.2
  118.38.35.216
+118.38.38.83
  118.39.115.26
  118.39.118.183
  118.39.135.11
@@ -26886,18 +25289,18 @@
  118.39.253.86
  118.39.77.10
  118.39.83.138
-118.39.91.14
  118.40.114.97
  118.40.122.21
  118.40.154.179
-118.40.189.117
-118.40.189.136
  118.40.242.20
  118.40.248.20
+118.40.53.249
+118.40.9.104
  118.40.94.152
  118.40.95.222
  118.41.116.65
  118.41.134.182
+118.41.17.218
  118.41.23.106
  118.41.246.106
  118.41.28.119
@@ -26905,6 +25308,7 @@
  118.42.100.56
  118.42.125.246
  118.42.173.28
+118.42.208.39
  118.42.210.89
  118.42.227.153
  118.42.233.90
@@ -26912,11 +25316,13 @@
  118.42.69.158
  118.42.74.177
  118.42.74.237
+118.42.8.209
  118.43.100.125
  118.43.114.17
  118.43.14.94
  118.43.144.196
  118.43.180.33
+118.43.215.114
  118.43.218.131
  118.43.218.220
  118.43.236.12
@@ -26926,17 +25332,19 @@
  118.44.148.247
  118.44.154.157
  118.44.213.191
+118.44.236.101
  118.44.37.217
+118.44.48.100
  118.44.6.75
  118.44.70.160
  118.45.13.114
-118.45.130.170
  118.45.144.155
  118.45.151.18
  118.45.182.174
  118.45.190.163
  118.45.200.149
  118.45.35.189
+118.45.40.241
  118.45.44.98
  118.46.115.192
  118.46.7.150
@@ -26961,7 +25369,6 @@
  118.67.250.75
  118.68.101.213
  118.68.107.253
-118.68.129.170
  118.68.134.75
  118.68.136.114
  118.68.165.116
@@ -26969,7 +25376,6 @@
  118.68.165.50
  118.68.165.54
  118.68.180.19
-118.68.185.219
  118.68.187.236
  118.68.191.174
  118.68.194.10
@@ -26977,7 +25383,6 @@
  118.68.196.174
  118.68.203.187
  118.68.208.86
-118.68.231.218
  118.68.242.4
  118.68.246.160
  118.68.255.17
@@ -26992,7 +25397,6 @@
  118.69.11.81
  118.69.117.217
  118.69.161.67
-118.69.173.199
  118.69.176.26
  118.69.181.162
  118.69.181.231
@@ -27012,8 +25416,6 @@
  118.69.50.154
  118.69.52.169
  118.69.52.67
-118.69.55.101
-118.69.55.141
  118.69.56.68
  118.69.61.212
  118.69.64.250
@@ -27022,20 +25424,16 @@
  118.69.78.29
  118.69.82.233
  118.70.111.104
-118.70.117.156
  118.70.12.171
-118.70.125.198
  118.70.126.64
  118.70.129.244
  118.70.13.63
  118.70.133.226
-118.70.155.60
  118.70.170.120
  118.70.175.160
  118.70.175.209
  118.70.177.235
  118.70.180.174
-118.70.180.188
  118.70.180.189
  118.70.183.188
  118.70.187.108
@@ -27045,7 +25443,6 @@
  118.70.220.116
  118.70.233.117
  118.70.233.163
-118.70.233.206
  118.70.43.128
  118.70.43.153
  118.70.43.186
@@ -27056,8 +25453,6 @@
  118.70.72.103
  118.70.72.192
  118.70.80.213
-118.70.81.241
-118.70.81.249
  118.70.85.195
  118.71.106.53
  118.71.115.97
@@ -27067,7 +25462,6 @@
  118.71.118.41
  118.71.118.94
  118.71.125.207
-118.71.135.94
  118.71.137.134
  118.71.140.57
  118.71.152.20
@@ -27079,7 +25473,6 @@
  118.71.164.42
  118.71.165.251
  118.71.166.127
-118.71.166.230
  118.71.166.62
  118.71.167.178
  118.71.168.173
@@ -27091,12 +25484,11 @@
  118.71.180.232
  118.71.187.196
  118.71.206.200
-118.71.210.117
  118.71.210.118
  118.71.210.25
  118.71.210.7
+118.71.227.100
  118.71.253.20
-118.71.50.170
  118.71.67.98
  118.71.75.115
  118.71.75.71
@@ -27116,29 +25508,29 @@
  118.73.188.194
  118.73.95.159
  118.74.223.31
+118.75.115.154
  118.75.119.214
+118.75.125.141
  118.75.137.134
  118.75.142.1
  118.75.142.79
  118.75.156.43
  118.75.162.173
  118.75.184.240
-118.75.185.57
  118.75.190.221
  118.75.218.212
-118.75.222.213
-118.75.243.137
-118.75.38.197
  118.75.45.215
  118.75.46.151
  118.75.46.196
  118.75.48.15
  118.75.48.151
+118.75.79.64
  118.76.141.131
  118.76.141.197
  118.76.143.108
+118.76.166.196
  118.76.232.203
-118.76.29.133
+118.76.240.31
  118.76.77.188
  118.76.83.138
  118.77.115.70
@@ -27152,11 +25544,9 @@
  118.79.146.212
  118.79.150.254
  118.79.151.166
-118.79.167.90
  118.79.188.140
-118.79.195.142
  118.79.196.14
-118.79.199.193
+118.79.197.121
  118.79.20.131
  118.79.202.69
  118.79.220.75
@@ -27167,8 +25557,8 @@
  118.79.238.200
  118.79.241.68
  118.79.253.174
+118.79.30.173
  118.79.4.250
-118.79.47.104
  118.79.47.207
  118.79.47.234
  118.79.58.128
@@ -27178,9 +25568,7 @@
  118.79.74.237
  118.79.75.183
  118.79.76.118
-118.79.80.97
  118.79.96.249
-118.80.191.158
  118.81.16.99
  118.81.18.213
  118.81.55.97
@@ -27189,29 +25577,22 @@
  118.83.85.71
  118.86.33.77
  118.88.71.238
-118.89.105.186
  118.89.106.11
  118.89.108.152
  118.89.108.37
  118.89.111.225
  118.89.111.49
  118.89.113.252
-118.89.116.13
-118.89.118.103
  118.89.120.110
  118.89.125.59
  118.89.138.117
  118.89.144.131
-118.89.152.103
  118.89.153.180
  118.89.153.32
-118.89.153.96
  118.89.157.43
-118.89.16.139
  118.89.160.141
  118.89.162.187
  118.89.163.105
-118.89.164.156
  118.89.167.20
  118.89.167.33
  118.89.170.192
@@ -27219,18 +25600,13 @@
  118.89.173.215
  118.89.177.212
  118.89.19.73
-118.89.219.116
  118.89.228.58
  118.89.229.84
  118.89.230.116
  118.89.230.243
-118.89.231.109
  118.89.231.121
  118.89.235.114
  118.89.235.86
-118.89.236.249
-118.89.236.56
-118.89.237.146
  118.89.237.20
  118.89.239.21
  118.89.240.128
@@ -27238,19 +25614,14 @@
  118.89.241.180
  118.89.241.214
  118.89.245.202
-118.89.25.35
  118.89.27.72
  118.89.30.90
-118.89.35.113
-118.89.35.209
  118.89.46.81
  118.89.47.205
  118.89.52.173
  118.89.61.51
  118.89.63.234
  118.89.66.102
-118.89.66.42
-118.89.69.159
  118.89.91.134
  118.91.0.240
  118.91.15.156
@@ -27272,7 +25643,6 @@
  118.91.60.42
  118.91.63.23
  118.91.91.21
-118.92.215.247
  118.92.41.104
  118.92.5.233
  118.93.127.90
@@ -27284,13 +25654,12 @@
  118.97.13.146
  118.97.16.106
  118.97.16.109
-118.97.16.154
  118.97.164.19
  118.97.186.214
+118.97.191.179
  118.97.191.233
  118.97.203.101
  118.97.204.93
-118.97.213.194
  118.97.221.251
  118.97.224.2
  118.97.23.26
@@ -27303,21 +25672,15 @@
  118.97.95.182
  118.97.95.19
  118.98.104.21
-118.98.121.194
  118.98.121.220
-118.98.127.138
  118.98.218.11
  118.98.233.226
  118.98.72.91
-118.98.90.22
  118.98.96.184
  118.99.100.109
  118.99.102.106
  118.99.102.124
-118.99.102.238
-118.99.104.138
-118.99.104.140
-118.99.104.141
+118.99.102.224
  118.99.104.149
  118.99.104.20
  118.99.108.42
@@ -27332,9 +25695,7 @@
  118.99.188.171
  118.99.239.217
  118.99.28.130
-118.99.65.184
  118.99.67.86
-118.99.73.83
  118.99.76.57
  118.99.76.70
  118.99.79.215
@@ -27360,7 +25721,7 @@
  119.100.64.191
  119.102.144.43
  119.102.153.184
-119.108.12.89
+119.102.57.83
  119.108.121.59
  119.108.15.134
  119.108.163.108
@@ -27372,33 +25733,29 @@
  119.108.86.171
  119.108.91.190
  119.109.170.229
-119.109.207.3
  119.109.242.214
  119.109.47.67
  119.109.83.158
-119.109.93.20
  119.109.94.78
  119.11.240.78
  119.110.204.62
  119.110.205.66
  119.110.96.195
  119.112.1.73
-119.112.214.210
  119.112.48.115
  119.112.56.52
  119.112.80.191
  119.113.192.32
+119.113.196.126
  119.113.224.141
  119.114.106.159
  119.114.109.41
  119.114.111.159
-119.114.128.77
  119.114.131.114
  119.114.133.58
  119.114.136.230
  119.114.26.82
  119.114.39.72
-119.114.72.91
  119.114.78.174
  119.115.128.2
  119.115.190.61
@@ -27410,6 +25767,7 @@
  119.115.43.112
  119.115.43.129
  119.115.54.99
+119.115.57.253
  119.115.62.224
  119.115.76.158
  119.115.8.44
@@ -27418,6 +25776,7 @@
  119.116.146.104
  119.116.15.5
  119.116.151.220
+119.116.160.135
  119.116.243.145
  119.116.4.217
  119.116.97.190
@@ -27425,7 +25784,6 @@
  119.117.108.31
  119.117.111.92
  119.117.12.17
-119.117.15.2
  119.117.244.204
  119.117.42.33
  119.117.44.126
@@ -27444,9 +25802,9 @@
  119.119.177.175
  119.119.191.35
  119.119.99.61
+119.120.20.210
  119.120.22.71
  119.120.61.248
-119.120.62.226
  119.120.62.62
  119.120.7.39
  119.120.71.97
@@ -27455,28 +25813,24 @@
  119.122.113.224
  119.122.113.28
  119.123.1.233
+119.123.1.86
  119.123.124.149
-119.123.124.244
  119.123.125.251
-119.123.125.79
-119.123.175.105
-119.123.178.189
+119.123.174.187
+119.123.177.157
  119.123.216.217
-119.123.218.37
  119.123.219.240
-119.123.224.221
-119.123.225.106
  119.123.225.249
  119.123.239.28
  119.123.240.119
  119.123.240.247
  119.123.242.169
  119.123.242.80
-119.123.243.128
  119.123.244.133
  119.123.244.77
  119.123.247.161
  119.123.30.250
+119.123.61.82
  119.123.75.119
  119.123.76.225
  119.124.0.231
@@ -27484,38 +25838,37 @@
  119.126.13.43
  119.126.140.255
  119.126.158.240
-119.129.52.137
  119.130.114.236
  119.130.164.153
+119.130.213.94
  119.130.215.167
  119.131.209.234
  119.131.244.13
-119.133.16.230
-119.133.204.79
  119.133.205.140
-119.133.87.175
-119.133.87.181
+119.134.111.213
  119.135.183.114
  119.135.183.115
  119.135.183.202
  119.136.18.142
  119.136.89.223
  119.137.55.148
-119.139.193.245
+119.139.192.85
  119.139.196.138
  119.139.196.236
  119.139.197.51
  119.139.197.90
  119.139.198.130
-119.139.198.3
  119.139.199.170
+119.139.199.3
  119.14.143.176
+119.14.161.37
  119.14.168.27
  119.140.56.111
  119.141.24.144
  119.141.24.175
  119.141.24.19
  119.141.24.218
+119.141.24.249
  119.141.24.34
  119.141.25.128
  119.141.25.148
@@ -27527,15 +25880,15 @@
  119.145.101.190
  119.145.104.2
  119.145.147.23
-119.145.2.55
  119.145.23.18
  119.145.29.160
  119.145.33.147
+119.145.82.128
+119.145.82.137
  119.145.82.48
  119.145.82.49
  119.146.131.247
  119.146.131.89
-119.146.150.134
  119.146.189.84
  119.147.137.79
  119.147.144.22
@@ -27559,15 +25912,13 @@
  119.149.229.42
  119.15.136.244
  119.15.136.245
-119.15.154.193
-119.15.210.98
  119.15.242.57
  119.15.80.203
  119.15.82.17
  119.15.89.106
+119.15.91.24
  119.15.93.38
  119.15.95.158
-119.152.226.210
  119.152.246.150
  119.153.134.102
  119.155.101.245
@@ -27576,7 +25927,6 @@
  119.159.147.54
  119.159.150.176
  119.159.229.245
-119.160.103.240
  119.160.129.114
  119.160.130.219
  119.160.135.166
@@ -27586,7 +25936,6 @@
  119.161.98.132
  119.161.98.139
  119.161.98.141
-119.162.162.146
  119.162.63.61
  119.162.65.162
  119.162.74.224
@@ -27598,9 +25947,9 @@
  119.163.22.117
  119.163.228.106
  119.163.94.12
-119.164.127.230
  119.164.150.189
-119.164.179.215
+119.164.151.211
+119.164.23.177
  119.164.64.189
  119.164.89.226
  119.165.107.65
@@ -27608,7 +25957,6 @@
  119.165.11.32
  119.165.147.145
  119.165.153.202
-119.165.155.238
  119.165.165.210
  119.165.187.241
  119.165.2.101
@@ -27621,7 +25969,6 @@
  119.165.239.83
  119.165.24.5
  119.165.28.27
-119.165.3.235
  119.165.3.61
  119.165.54.221
  119.165.56.154
@@ -27635,14 +25982,13 @@
  119.166.145.234
  119.166.154.237
  119.166.169.115
-119.166.182.17
  119.166.196.21
  119.166.226.110
  119.166.247.214
  119.166.247.214bin.sh
+119.166.31.100
  119.166.39.128
  119.166.39.54
-119.166.42.53
  119.166.44.196
  119.166.73.216
  119.166.74.85
@@ -27656,6 +26002,7 @@
  119.167.2.49
  119.167.21.135
  119.167.29.135
+119.167.31.184
  119.167.31.210
  119.167.32.39
  119.167.41.123
@@ -27672,30 +26019,28 @@
  119.177.65.229
  119.178.178.79
  119.178.246.244
-119.178.39.206
  119.178.42.217
-119.179.10.70
+119.179.101.62
  119.179.119.79
  119.179.120.169
  119.179.131.77
  119.179.150.233
  119.179.157.16
-119.179.16.157
  119.179.163.67
  119.179.164.139
  119.179.165.18
  119.179.18.206
  119.179.19.176
+119.179.190.97
  119.179.191.165
+119.179.197.191
  119.179.2.185
  119.179.226.195
  119.179.237.182
  119.179.25.240
  119.179.27.36
-119.179.30.34
  119.179.30.93
  119.179.34.206
-119.179.58.52
  119.179.63.114
  119.179.74.252
  119.179.77.122
@@ -27716,7 +26061,6 @@
  119.18.154.196
  119.18.154.202
  119.18.155.122
-119.18.155.82
  119.18.157.197
  119.18.157.42
  119.18.158.221
@@ -27724,10 +26068,8 @@
  119.18.159.146
  119.18.159.34
  119.18.159.6
-119.18.194.130
  119.18.194.168
  119.18.197.98
-119.18.2.221
  119.18.34.97
  119.18.38.176
  119.18.52.235
@@ -27758,7 +26100,6 @@
  119.181.54.70
  119.182.112.201
  119.182.113.182
-119.182.20.153
  119.182.60.251
  119.182.67.204
  119.182.8.82
@@ -27767,6 +26108,7 @@
  119.183.14.177
  119.183.143.223
  119.183.145.221
+119.183.148.45
  119.183.155.239
  119.183.18.102
  119.183.204.178
@@ -27785,7 +26127,6 @@
  119.185.153.86
  119.185.155.1
  119.185.159.81
-119.185.176.16
  119.185.177.156
  119.185.236.116
  119.185.237.13
@@ -27796,23 +26137,21 @@
  119.186.204.74
  119.187.1.141
  119.187.117.154
-119.187.119.146
  119.187.120.38
  119.187.129.48
  119.187.144.206
  119.187.149.238
+119.187.159.241
  119.187.235.145
  119.187.235.23
  119.187.235.5
  119.187.239.228
-119.187.239.64
  119.187.241.21
  119.187.29.196
  119.187.77.195
  119.188.241.247
  119.188.245.108
  119.188.246.185
-119.188.246.231
  119.188.248.7
  119.189.129.35
  119.189.137.208
@@ -27823,7 +26162,6 @@
  119.189.202.240
  119.189.203.23
  119.189.207.105
-119.190.109.15
  119.190.144.131
  119.190.150.174
  119.190.180.197
@@ -27849,32 +26187,35 @@
  119.191.242.14
  119.191.244.59
  119.191.31.45
-119.192.190.63
  119.192.206.158
  119.192.254.1
  119.192.49.212
-119.192.55.49
  119.192.77.31
  119.193.127.130
  119.193.152.76
+119.193.156.216
  119.193.182.126
+119.193.203.55
  119.193.203.74
  119.193.210.120
-119.193.228.81
  119.193.238.60
  119.193.239.59
  119.193.244.222
+119.193.244.89
  119.193.33.206
  119.193.47.162
  119.193.58.95
  119.194.214.43
  119.194.223.190
+119.194.225.68
  119.194.240.249
  119.194.240.249bin.sh
  119.194.52.61
  119.194.75.229
  119.195.112.221
+119.195.117.126
  119.195.180.213
+119.195.180.215
  119.195.180.227
  119.195.180.239
  119.195.181.125
@@ -27885,7 +26226,6 @@
  119.195.239.171
  119.195.239.206
  119.195.239.91
-119.195.38.173
  119.195.39.76
  119.195.69.97
  119.195.78.53
@@ -27914,6 +26254,7 @@
  119.198.128.223
  119.198.146.111
  119.198.155.123
+119.198.155.76
  119.198.158.115
  119.198.160.54
  119.198.175.242
@@ -27924,7 +26265,6 @@
  119.198.244.159
  119.198.251.181
  119.198.34.78
-119.198.85.191
  119.198.87.162
  119.199.109.86
  119.199.181.39
@@ -27945,8 +26285,10 @@
  119.200.113.36
  119.200.113.45
  119.200.186.168
+119.200.229.146
  119.200.229.33
  119.200.24.30
+119.200.247.24
  119.200.73.103
  119.200.73.123
  119.200.73.155
@@ -27959,6 +26301,7 @@
  119.201.140.138
  119.201.161.86
  119.201.181.63
+119.201.204.240
  119.201.29.18
  119.201.40.195
  119.201.68.12
@@ -27970,11 +26313,11 @@
  119.202.28.22
  119.202.76.160
  119.203.16.24
+119.203.177.178
  119.203.185.186
  119.203.43.45
  119.203.68.69
  119.203.7.75
-119.204.112.229
  119.204.218.9
  119.204.53.101
  119.204.53.112
@@ -27982,13 +26325,10 @@
  119.204.7.5
  119.204.96.131
  119.205.1.58
-119.205.235.251
  119.205.82.25
  119.205.87.153
  119.206.115.137
  119.206.190.198
-119.206.224.253
-119.206.255.171
  119.206.48.90
  119.206.60.222
  119.206.62.129
@@ -27996,7 +26336,6 @@
  119.206.86.8
  119.206.88.75
  119.207.109.223
-119.207.126.21
  119.207.147.69
  119.207.153.8
  119.207.204.253
@@ -28005,12 +26344,10 @@
  119.207.30.62
  119.207.76.245
  119.207.81.194
-119.207.94.37
  119.209.10.12
  119.224.102.107
  119.224.7.149
  119.226.226.116
-119.226.30.54
  119.228.75.211
  119.23.104.38
  119.23.128.199
@@ -28020,9 +26357,7 @@
  119.23.238.165
  119.23.31.104
  119.23.33.89
-119.230.193.197
  119.230.47.15
-119.234.30.116
  119.235.19.66
  119.235.242.19
  119.235.244.128
@@ -28039,12 +26374,11 @@
  119.235.51.166
  119.235.51.241
  119.235.54.45
+119.235.84.218
  119.236.104.145
-119.236.116.94
  119.236.15.239
  119.236.161.41
  119.236.163.213
-119.236.170.60
  119.236.18.35
  119.236.185.231
  119.236.251.11
@@ -28071,9 +26405,9 @@
  119.237.92.184
  119.238.121.222
  119.238.169.31
-119.24.246.160
  119.240.232.7
  119.240.237.93
+119.241.28.28
  119.244.67.64
  119.245.138.143
  119.245.91.241
@@ -28092,6 +26426,7 @@
  119.247.114.122
  119.247.118.107
  119.247.152.226
+119.247.226.162
  119.247.35.8
  119.247.39.203
  119.247.53.247
@@ -28099,13 +26434,13 @@
  119.247.74.182
  119.247.91.203
  119.247.94.100
+119.248.201.103
  119.249.16.203
  119.249.22.96
  119.249.221.221
  119.249.236.105
  119.249.86.72
  119.250.1.103
-119.250.10.124
  119.250.115.235
  119.250.119.227
  119.250.154.224
@@ -28124,33 +26459,29 @@
  119.251.214.132
  119.251.221.62
  119.251.84.203
-119.252.143.102
  119.252.143.6
  119.252.160.165
  119.252.169.173
  119.252.170.2
  119.252.174.199
  119.252.174.201
-119.253.84.106
  119.254.12.66
  119.254.145.18
  119.254.155.187
  119.254.36.2
  119.254.65.12
-119.254.7.114
  119.254.84.87
  119.27.160.25
  119.27.165.198
  119.27.165.49
  119.27.166.126
  119.27.166.193
+119.27.168.199
  119.27.172.62
  119.27.174.130
  119.27.189.46
  119.27.189.65
-119.27.190.236
  119.27.191.172
-119.27.191.202
  119.28.100.67
  119.28.102.86
  119.28.115.13
@@ -28158,8 +26489,6 @@
  119.28.128.211
  119.28.132.211
  119.28.135.173
-119.28.136.172
-119.28.138.87
  119.28.140.134
  119.28.149.239
  119.28.151.166
@@ -28173,11 +26502,8 @@
  119.28.164.144
  119.28.164.149
  119.28.164.31
-119.28.177.36
-119.28.178.213
  119.28.178.61
  119.28.179.179
-119.28.182.241
  119.28.187.227
  119.28.19.237
  119.28.194.66
@@ -28185,7 +26511,6 @@
  119.28.2.199
  119.28.20.131
  119.28.20.208
-119.28.21.55
  119.28.215.129
  119.28.221.132
  119.28.223.229
@@ -28201,23 +26526,22 @@
  119.28.239.239
  119.28.239.36
  119.28.26.57
+119.28.3.58
  119.28.32.60
  119.28.4.87
-119.28.51.195
+119.28.44.92
  119.28.51.99
  119.28.54.131
  119.28.55.185
  119.28.55.239
  119.28.55.81
  119.28.57.132
-119.28.57.226
  119.28.6.128
  119.28.60.164
  119.28.61.162
  119.28.67.221
  119.28.68.182
  119.28.7.77
-119.28.70.21
  119.28.73.193
  119.28.73.99
  119.28.74.39
@@ -28235,7 +26559,6 @@
  119.29.102.152
  119.29.102.4
  119.29.108.252
-119.29.111.220
  119.29.112.70
  119.29.113.233
  119.29.115.153
@@ -28247,7 +26570,6 @@
  119.29.135.29
  119.29.136.114
  119.29.138.191
-119.29.139.17
  119.29.142.34
  119.29.143.201
  119.29.144.4
@@ -28255,14 +26577,12 @@
  119.29.149.214
  119.29.150.218
  119.29.151.107
-119.29.152.172
-119.29.154.221
  119.29.155.106
+119.29.155.57
  119.29.156.239
  119.29.158.76
+119.29.159.20
  119.29.16.190
-119.29.16.76
-119.29.161.236
  119.29.167.95
  119.29.168.187
  119.29.170.202
@@ -28274,18 +26594,14 @@
  119.29.183.138
  119.29.184.119
  119.29.188.119
-119.29.191.217
  119.29.195.187
  119.29.198.127
-119.29.199.150
  119.29.2.157
  119.29.2.72
  119.29.205.228
-119.29.205.52
  119.29.21.142
  119.29.216.238
  119.29.22.68
-119.29.227.108
  119.29.231.121
  119.29.234.23
  119.29.245.130
@@ -28307,6 +26623,7 @@
  119.29.73.73
  119.29.74.28
  119.29.79.127
+119.29.82.97
  119.29.83.12
  119.29.83.177
  119.29.86.132
@@ -28330,7 +26647,6 @@
  119.3.187.46
  119.3.191.65
  119.3.193.50
-119.3.201.34
  119.3.208.236
  119.3.212.143
  119.3.217.100
@@ -28342,8 +26658,8 @@
  119.3.248.66
  119.3.249.44
  119.3.45.237
+119.3.55.158
  119.3.89.185
-119.31.126.100
  119.36.107.24
  119.36.221.166
  119.36.221.176
@@ -28373,35 +26689,34 @@
  119.40.87.219
  119.40.92.17
  119.40.98.74
+119.41.194.120
  119.41.196.89
-119.41.197.23
  119.41.198.74
  119.41.198.77
  119.41.199.117
+119.41.2.202
  119.41.200.91
  119.41.201.204
  119.41.202.67
  119.41.205.42
  119.41.206.22
-119.41.207.30
+119.41.207.35
  119.41.236.180
  119.42.105.241
-119.42.107.26
+119.42.107.6
  119.42.107.93
  119.42.108.194
-119.42.108.53
  119.42.109.247
+119.42.109.46
  119.42.113.241
  119.42.113.38
  119.42.113.86
  119.42.114.121
  119.42.114.234
-119.42.114.69
+119.42.114.32
  119.42.115.239
-119.42.115.38
  119.42.121.108
  119.42.121.127
-119.42.121.130
  119.42.121.136
  119.42.121.160
  119.42.121.182
@@ -28414,14 +26729,13 @@
  119.42.122.136
  119.42.122.149
  119.42.122.16
+119.42.122.196
  119.42.122.201
  119.42.122.234
  119.42.122.239
  119.42.122.242
  119.42.122.245
  119.42.122.25
-119.42.122.29
-119.42.122.60
  119.42.122.72
  119.42.122.91
  119.42.123.107
@@ -28436,7 +26750,6 @@
  119.42.123.52
  119.42.123.97
  119.42.124.247
-119.42.126.7
  119.42.161.254
  119.42.163.126
  119.42.167.30
@@ -28444,7 +26757,6 @@
  119.42.168.14
  119.42.168.26
  119.42.168.46
-119.42.175.200
  119.42.176.46
  119.42.178.6
  119.42.67.119
@@ -28452,18 +26764,17 @@
  119.42.67.134
  119.42.67.153
  119.42.67.187
-119.42.67.2
  119.42.67.202
  119.42.67.236
  119.42.67.239
-119.42.67.46
  119.42.67.58
  119.42.67.76
+119.42.67.77
  119.42.71.110
  119.42.71.82
  119.42.72.107
+119.42.72.156
  119.42.72.81
-119.42.73.225
  119.42.73.27
  119.42.73.99
  119.42.74.55
@@ -28472,17 +26783,19 @@
  119.42.78.85
  119.42.80.202
  119.42.80.238
+119.42.80.24
  119.42.80.250
  119.42.80.9
+119.42.86.131
  119.42.86.153
  119.42.86.154
  119.42.86.225
-119.42.86.229
  119.42.95.106
+119.42.96.136
  119.42.96.58
  119.44.20.30
-119.45.0.9
  119.45.10.225
+119.45.10.4
  119.45.10.5
  119.45.105.184
  119.45.112.28
@@ -28491,7 +26804,6 @@
  119.45.115.21
  119.45.116.170
  119.45.117.145
-119.45.119.141
  119.45.12.105
  119.45.120.121
  119.45.120.24
@@ -28502,9 +26814,7 @@
  119.45.130.71
  119.45.131.232
  119.45.133.109
-119.45.134.200
  119.45.134.38
-119.45.136.36
  119.45.137.244
  119.45.137.52
  119.45.138.160
@@ -28515,14 +26825,10 @@
  119.45.142.15
  119.45.142.38
  119.45.142.72
-119.45.143.131
-119.45.143.143
-119.45.147.142
  119.45.147.7
  119.45.148.171
  119.45.149.173
  119.45.149.82
-119.45.150.122
  119.45.150.155
  119.45.151.125
  119.45.154.156
@@ -28531,10 +26837,9 @@
  119.45.160.126
  119.45.162.248
  119.45.165.211
-119.45.171.183
  119.45.173.117
  119.45.176.109
-119.45.177.47
+119.45.176.230
  119.45.178.44
  119.45.18.205
  119.45.181.168
@@ -28544,6 +26849,7 @@
  119.45.186.186
  119.45.187.6
  119.45.19.141
+119.45.19.201
  119.45.191.168
  119.45.191.209
  119.45.192.106
@@ -28556,11 +26862,12 @@
  119.45.194.246
  119.45.195.57
  119.45.196.97
-119.45.198.117
  119.45.199.200
  119.45.199.253
+119.45.201.244
  119.45.202.43
  119.45.202.79
+119.45.203.143
  119.45.205.97
  119.45.206.237
  119.45.207.191
@@ -28577,7 +26884,6 @@
  119.45.215.155
  119.45.215.195
  119.45.216.2
-119.45.218.253
  119.45.22.71
  119.45.220.5
  119.45.221.79
@@ -28590,9 +26896,12 @@
  119.45.231.207
  119.45.231.71
  119.45.235.14
+119.45.236.83
  119.45.239.231
  119.45.239.247
+119.45.239.252
  119.45.239.75
+119.45.240.155
  119.45.240.49
  119.45.242.149
  119.45.243.118
@@ -28611,12 +26920,10 @@
  119.45.31.199
  119.45.32.187
  119.45.33.80
-119.45.34.122
  119.45.34.52
  119.45.36.123
  119.45.36.221
  119.45.39.207
-119.45.40.87
  119.45.42.241
  119.45.45.185
  119.45.45.195
@@ -28629,13 +26936,10 @@
  119.45.49.240
  119.45.49.31
  119.45.49.42
-119.45.5.145
-119.45.5.237
  119.45.5.55
  119.45.50.126
  119.45.50.17
  119.45.51.206
-119.45.51.234
  119.45.52.133
  119.45.52.153
  119.45.52.194
@@ -28644,7 +26948,6 @@
  119.45.55.249
  119.45.57.14
  119.45.58.111
-119.45.6.43
  119.45.6.9
  119.45.60.140
  119.45.60.204
@@ -28659,7 +26962,6 @@
  119.46.2.250
  119.46.2.251
  119.47.92.20
-119.49.106.196
  119.49.106.236
  119.49.108.87
  119.49.138.205
@@ -28677,6 +26979,7 @@
  119.50.103.30
  119.50.11.32
  119.50.113.231
+119.50.133.252
  119.50.135.176
  119.50.146.29
  119.50.150.38
@@ -28684,13 +26987,12 @@
  119.50.177.201
  119.50.206.46
  119.50.70.170
+119.50.89.151
  119.51.116.145
-119.51.163.177
  119.51.163.53
  119.51.225.13
  119.51.226.112
  119.51.46.168
-119.51.96.135
  119.51.99.128
  119.52.139.181
  119.52.139.51
@@ -28706,10 +27008,9 @@
  119.53.142.209
  119.53.156.9
  119.53.162.71
-119.53.56.203
+119.53.26.51
  119.54.118.65
  119.54.127.193
-119.54.180.7
  119.54.221.178
  119.54.252.67
  119.55.209.5
@@ -28721,13 +27022,10 @@
  119.56.130.60
  119.56.130.94
  119.56.131.155
-119.56.138.33
-119.56.140.73
+119.56.138.46
  119.56.142.35
-119.56.143.23
  119.56.143.46
  119.56.143.51
-119.56.143.71
  119.56.144.135
  119.56.144.162
  119.56.144.65
@@ -28746,7 +27044,7 @@
  119.56.152.45
  119.56.153.16
  119.56.155.57
-119.56.156.166
+119.56.156.102
  119.56.164.133
  119.56.165.126
  119.56.166.36
@@ -28755,6 +27053,7 @@
  119.56.185.4
  119.56.185.73
  119.56.189.148
+119.56.189.19
  119.56.189.61
  119.56.194.105
  119.56.194.80
@@ -28772,6 +27071,7 @@
  119.56.200.37
  119.56.201.33
  119.56.202.11
+119.56.206.100
  119.56.206.24
  119.56.206.48
  119.56.208.30
@@ -28783,12 +27083,10 @@
  119.56.219.6
  119.56.219.71
  119.56.219.75
-119.56.221.183
  119.56.222.112
  119.56.226.81
  119.56.231.42
  119.56.238.145
-119.56.240.139
  119.56.241.128
  119.56.243.62
  119.56.248.112
@@ -28802,18 +27100,19 @@
  119.57.160.59
  119.57.162.18
  119.57.17.20
-119.57.170.155
  119.57.254.3
  119.57.44.114
  119.57.89.126
  119.57.93.23
  119.59.116.21
+119.59.123.55
  119.59.124.163
  119.59.124.54
  119.6.100.24
  119.6.54.5
  119.6.57.122
  119.60.2.249
+119.60.25.234
  119.60.5.37
  119.61.19.84
  119.61.19.87
@@ -28823,6 +27122,7 @@
  119.63.130.53
  119.63.130.62
  119.63.135.116
+119.63.138.173
  119.63.139.136
  119.63.245.112
  119.63.250.31
@@ -28835,7 +27135,6 @@
  119.68.194.119
  119.69.199.43
  119.7.117.7
-119.7.164.34
  119.7.237.43
  119.73.179.114
  119.74.131.198
@@ -28847,7 +27146,6 @@
  119.75.32.18
  119.76.128.163
  119.76.140.113
-119.76.150.52
  119.76.150.61
  119.76.173.2
  119.76.190.126
@@ -28890,16 +27188,14 @@
  119.82.253.24
  119.82.253.63
  119.82.34.20
-119.82.65.194
  119.82.65.217
  119.84.128.40
-119.84.135.143
  119.84.66.170
  119.84.8.43
-119.86.18.225
-119.86.182.126
-119.86.19.131
+119.86.18.89
+119.86.20.254
  119.86.22.217
+119.86.22.84
  119.86.239.36
  119.9.110.100
  119.9.110.234
@@ -28916,8 +27212,6 @@
  119.9.74.76
  119.9.75.6
  119.9.77.24
-119.90.34.135
-119.90.51.171
  119.90.61.10
  119.90.63.249
  119.92.165.124
@@ -28934,7 +27228,6 @@
  119.95.180.106
  119.96.100.222
  119.96.109.21
-119.96.118.78
  119.96.120.113
  119.96.124.131
  119.96.125.185
@@ -28964,8 +27257,7 @@
  119.96.215.80
  119.96.217.100
  119.96.221.131
-119.96.222.202
-119.96.223.211
+119.96.224.153
  119.96.227.154
  119.96.227.221
  119.96.230.103
@@ -28973,6 +27265,7 @@
  119.96.230.32
  119.96.231.110
  119.96.235.35
+119.96.235.73
  119.96.237.94
  119.96.239.27
  119.96.68.234
@@ -28981,6 +27274,7 @@
  119.96.69.210
  119.96.83.86
  119.96.84.208
+119.96.86.168
  119.96.86.193
  119.96.87.156
  119.96.92.223
@@ -28991,21 +27285,17 @@
  119.97.150.42
  119.97.150.55
  119.97.159.52
-119.97.164.245
-119.97.164.246
  119.97.221.82
  119.97.221.92
  119.97.221.94
-119.97.236.4
  119.97.248.76
  119.97.251.162
  119.97.252.154
-119.97.252.157
  119.98.108.150
  119.98.140.111
  119.98.188.69
-119.98.19.218
  119.98.28.163
+119.98.28.26
  119.98.29.238
  119.98.31.153
  119.98.34.113
@@ -29035,7 +27325,6 @@
  12.132.115.32
  12.132.115.37
  12.133.139.166
-12.144.255.2
  12.146.219.131
  12.146.9.146
  12.15.69.83
@@ -29057,14 +27346,12 @@
  12.182.181.129
  12.182.4.60
  12.183.171.36
-12.184.217.101
+12.186.205.176
  12.186.206.84
  12.189.124.50
  12.189.239.194
-12.191.54.236
  12.192.33.18
  12.20.165.35
-12.201.144.252
  12.202.70.93
  12.203.165.115
  12.207.235.250
@@ -29103,7 +27390,6 @@
  12.96.187.243
  12.97.172.196
  120.0.202.59
-120.0.27.226
  120.1.10.101
  120.1.153.170
  120.1.206.234
@@ -29115,27 +27401,21 @@
  120.11.159.155
  120.11.159.162
  120.11.93.179
-120.117.65.33
  120.12.100.99
  120.12.149.242
  120.12.227.174
  120.131.13.186
-120.131.13.198
  120.131.14.125
  120.131.2.210
-120.131.3.119
  120.131.3.191
  120.131.5.2
  120.131.6.210
  120.131.6.231
-120.131.8.12
  120.131.9.167
  120.132.0.204
-120.132.101.92
  120.132.103.67
  120.132.106.211
  120.132.11.151
-120.132.116.214
  120.132.117.254
  120.132.12.162
  120.132.124.179
@@ -29143,7 +27423,6 @@
  120.132.13.206
  120.132.17.44
  120.132.22.30
-120.132.22.92
  120.132.28.86
  120.132.33.210
  120.132.38.222
@@ -29154,12 +27433,9 @@
  120.132.9.183
  120.132.96.254
  120.132.99.101
-120.133.1.16
  120.133.136.35
  120.133.136.75
-120.133.17.168
  120.133.2.9
-120.133.22.121
  120.133.35.4
  120.133.60.230
  120.133.60.235
@@ -29174,10 +27450,8 @@
  120.142.222.22
  120.143.173.154
  120.144.161.12
-120.148.216.204
  120.148.88.200
  120.15.103.100
-120.15.138.119
  120.150.152.201
  120.150.216.161
  120.150.218.241
@@ -29197,13 +27471,12 @@
  120.157.61.90
  120.157.70.233
  120.157.70.238
-120.159.185.11
  120.17.187.30
  120.19.91.199
  120.192.167.171
  120.192.167.83
-120.192.185.117
  120.192.19.130
+120.192.246.107
  120.192.31.142
  120.192.31.171
  120.192.31.173
@@ -29265,12 +27538,12 @@
  120.194.42.194
  120.194.52.143
  120.194.6.70
+120.194.7.10
  120.194.83.50
  120.194.98.74
  120.194.98.76
  120.195.161.2
  120.195.30.152
-120.195.65.124
  120.195.95.165
  120.196.131.107
  120.196.181.230
@@ -29288,8 +27561,6 @@
  120.198.76.45
  120.199.0.43
  120.199.112.15
-120.201.125.204
-120.201.2.134
  120.201.250.44
  120.202.128.23
  120.202.17.190
@@ -29303,7 +27574,6 @@
  120.203.15.155
  120.203.16.37
  120.203.160.18
-120.203.29.78
  120.203.5.92
  120.203.64.215
  120.204.194.170
@@ -29337,22 +27607,18 @@
  120.209.99.122
  120.209.99.201
  120.209.99.97
-120.210.134.49
  120.210.147.60
  120.210.89.180
  120.210.89.79
  120.211.100.18
  120.211.145.66
  120.211.39.164
-120.211.61.213
  120.211.61.239
  120.212.210.199
  120.213.213.54
-120.220.15.5
-120.220.242.30
+120.214.178.236
  120.220.43.77
  120.221.130.109
-120.224.121.19
  120.224.213.100
  120.224.214.34
  120.224.222.37
@@ -29369,7 +27635,7 @@
  120.224.83.112
  120.224.87.212
  120.227.8.141
-120.229.53.23
+120.229.72.95
  120.232.182.40
  120.232.193.113
  120.232.252.15
@@ -29380,7 +27646,7 @@
  120.236.117.205
  120.236.128.52
  120.236.146.43
-120.236.189.171
+120.236.216.217
  120.236.219.182
  120.236.229.50
  120.236.247.197
@@ -29396,7 +27662,6 @@
  120.236.55.130
  120.236.87.3
  120.237.118.139
-120.237.118.144
  120.237.123.242
  120.237.159.92
  120.237.170.27
@@ -29406,14 +27671,9 @@
  120.238.131.23
  120.238.201.6
  120.238.223.6
-120.239.196.113
  120.239.196.61
-120.239.196.69
-120.24.227.230
-120.24.234.239
  120.24.40.26
  120.240.95.154
-120.244.112.83
  120.244.156.167
  120.244.158.218
  120.244.158.90
@@ -29434,12 +27694,12 @@
  120.26.76.229
  120.26.76.47
  120.27.114.140
-120.28.109.188
  120.28.110.61
  120.28.111.215
  120.28.198.54
  120.28.201.50
  120.28.45.202
+120.29.102.39
  120.29.124.106
  120.29.124.131
  120.29.125.194
@@ -29452,16 +27712,10 @@
  120.31.132.35
  120.31.136.173
  120.31.136.232
-120.31.138.70
-120.31.138.79
-120.31.138.82
  120.31.140.179
  120.31.140.183
  120.31.140.237
  120.31.140.41
-120.31.143.209
-120.31.143.254
-120.31.160.225
  120.31.162.202
  120.31.56.111
  120.31.71.238
@@ -29469,30 +27723,24 @@
  120.32.96.151
  120.34.174.193
  120.34.175.40
-120.34.180.146
  120.34.180.220
+120.34.181.143
  120.34.181.154
-120.34.181.210
-120.34.183.6
-120.34.241.134
+120.34.182.223
+120.35.189.175
+120.35.189.36
  120.35.26.129
+120.35.8.73
  120.36.208.89
  120.36.211.93
  120.36.220.7
-120.36.25.37
-120.36.255.91
  120.36.3.101
-120.36.33.28
-120.36.96.108
  120.38.232.131
-120.38.29.107
-120.38.29.46
+120.38.28.149
  120.39.243.192
  120.39.243.84
  120.39.244.134
-120.39.251.232
  120.4.120.39
-120.4.226.16
  120.40.130.70
  120.41.132.139
  120.41.187.206
@@ -29502,7 +27750,6 @@
  120.43.134.101
  120.43.228.143
  120.43.32.62
-120.43.9.70
  120.48.25.159
  120.48.31.186
  120.48.7.156
@@ -29515,10 +27762,10 @@
  120.50.66.60
  120.50.72.88
  120.50.8.2
-120.50.8.46
  120.50.82.29
  120.50.93.115
  120.51.201.70
+120.51.34.254
  120.52.120.11
  120.52.139.130
  120.52.146.211
@@ -29531,25 +27778,19 @@
  120.53.1.97
  120.53.10.102
  120.53.10.17
-120.53.10.191
-120.53.103.84
  120.53.104.104
  120.53.108.58
-120.53.117.219
  120.53.118.140
  120.53.12.94
-120.53.120.109
  120.53.120.131
  120.53.121.152
  120.53.121.178
  120.53.122.66
-120.53.124.104
  120.53.124.220
  120.53.125.66
+120.53.13.226
  120.53.2.190
-120.53.20.111
  120.53.21.174
-120.53.22.204
  120.53.223.186
  120.53.225.103
  120.53.225.13
@@ -29560,7 +27801,6 @@
  120.53.237.33
  120.53.238.156
  120.53.238.43
-120.53.24.140
  120.53.24.160
  120.53.240.229
  120.53.243.163
@@ -29571,14 +27811,9 @@
  120.53.246.66
  120.53.251.82
  120.53.27.188
-120.53.27.233
  120.53.28.165
-120.53.3.4
-120.53.30.243
  120.53.31.96
  120.53.9.188
-120.55.212.226
-120.56.112.181
  120.56.119.118
  120.57.32.52
  120.57.33.11
@@ -29606,6 +27841,7 @@
  120.68.105.46
  120.68.107.131
  120.68.108.74
+120.68.109.73
  120.68.110.120
  120.68.110.24
  120.68.111.34
@@ -29627,23 +27863,13 @@
  120.7.210.164
  120.7.222.199
  120.70.100.13
-120.70.100.159
-120.70.100.2
-120.70.100.54
  120.70.100.88
  120.70.100.89
-120.70.101.103
-120.70.101.107
  120.70.101.85
  120.70.102.16
  120.70.102.239
-120.70.103.239
  120.70.103.27
-120.70.103.40
-120.70.97.233
-120.70.98.132
  120.70.98.195
-120.70.99.15
  120.71.13.18
  120.71.145.166
  120.71.145.181
@@ -29660,51 +27886,46 @@
  120.72.18.91
  120.72.20.82
  120.72.85.69
-120.72.86.4
  120.76.140.189
  120.76.156.193
  120.76.22.182
-120.76.60.65
+120.77.145.154
  120.77.253.219
  120.77.3.221
  120.77.36.28
+120.77.60.26
  120.77.60.48
-120.78.11.170
  120.78.12.121
  120.78.144.149
+120.78.151.193
  120.78.182.195
  120.78.2.189
  120.78.2.215
  120.78.203.123
-120.78.207.140
  120.78.4.233
-120.78.67.149
  120.78.68.241
  120.78.79.85
  120.79.0.86
-120.79.103.161
  120.79.106.130
  120.79.139.196
-120.79.151.246
+120.79.143.47
  120.79.151.95
-120.79.155.8
  120.79.161.133
  120.79.169.174
-120.79.188.144
  120.79.202.67
  120.79.212.174
  120.79.217.10
  120.79.218.202
-120.79.222.140
+120.79.222.186
  120.79.223.9
  120.79.226.20
  120.79.251.131
+120.79.251.37
  120.79.3.52
+120.79.32.117
  120.79.48.236
-120.79.53.218
  120.79.83.132
  120.79.92.64
-120.79.93.66
  120.8.111.160
  120.8.112.251
  120.8.35.2
@@ -29712,22 +27933,14 @@
  120.8.97.114
  120.83.111.240
  120.83.74.139
-120.84.96.117
+120.84.238.52
  120.84.96.82
-120.85.102.241
-120.85.102.70
-120.85.102.72
-120.85.103.67
-120.85.164.35
-120.85.184.184
-120.85.239.154
+120.85.208.220
+120.85.253.93
  120.86.113.106
  120.86.123.211
-120.86.127.45
-120.88.142.154
+120.86.147.197
  120.88.46.226
-120.89.102.100
-120.89.102.137
  120.9.32.62
  120.92.10.24
  120.92.102.213
@@ -29748,11 +27961,9 @@
  120.92.118.155
  120.92.119.90
  120.92.122.249
-120.92.133.32
  120.92.136.84
  120.92.138.1
  120.92.139.2
-120.92.139.28
  120.92.148.190
  120.92.149.124
  120.92.149.231
@@ -29760,7 +27971,6 @@
  120.92.151.17
  120.92.151.248
  120.92.154.149
-120.92.154.210
  120.92.155.102
  120.92.155.231
  120.92.164.193
@@ -29768,18 +27978,12 @@
  120.92.169.65
  120.92.173.154
  120.92.174.161
-120.92.2.217
  120.92.208.106
-120.92.209.229
  120.92.210.196
-120.92.213.60
  120.92.253.6
  120.92.33.108
  120.92.33.68
  120.92.34.203
-120.92.35.127
-120.92.42.123
-120.92.45.102
  120.92.55.138
  120.92.55.155
  120.92.72.190
@@ -29789,7 +27993,6 @@
  120.92.78.70
  120.92.80.120
  120.92.89.30
-120.92.91.176
  120.92.92.40
  120.92.94.94
  120.92.94.95
@@ -29814,22 +28017,17 @@
  121.100.114.164
  121.100.17.42
  121.100.19.18
-121.100.28.199
  121.100.4.170
  121.100.96.8
  121.101.130.41
  121.101.130.42
-121.101.133.36
  121.101.159.29
  121.101.176.31
  121.101.186.242
  121.101.214.54
  121.102.210.214
-121.11.100.183
-121.11.110.200
-121.11.111.230
  121.11.112.199
-121.11.113.225
+121.11.115.91
  121.11.117.252
  121.11.166.14
  121.11.83.7
@@ -29839,11 +28037,10 @@
  121.117.147.153
  121.119.145.152
  121.119.179.133
-121.12.151.250
  121.12.162.93
  121.12.252.10
  121.12.252.206
-121.12.252.208
+121.120.240.226
  121.121.118.217
  121.121.120.240
  121.121.141.225
@@ -29853,20 +28050,15 @@
  121.121.190.210
  121.121.208.129
  121.121.76.81
-121.121.91.64
-121.121.91.95
  121.121.94.104
  121.121.94.65
  121.121.98.192
-121.122.101.228
  121.122.109.35
  121.122.139.104
  121.122.139.104bin.sh
  121.122.50.157
-121.122.51.65
  121.122.66.226
  121.122.67.249
-121.122.76.4
  121.122.82.68
  121.122.87.153
  121.122.87.229
@@ -29887,13 +28079,11 @@
  121.125.101.88
  121.125.68.90
  121.126.31.66
-121.127.127.215
  121.127.234.54
  121.127.249.45
-121.127.252.209
  121.127.252.30
  121.128.135.73
-121.128.49.11
+121.128.135.75
  121.129.127.209
  121.129.129.23
  121.129.192.177
@@ -29902,21 +28092,22 @@
  121.13.252.53
  121.13.64.11
  121.130.120.130
-121.130.121.1
  121.130.124.57
  121.130.141.172
+121.130.230.142
  121.130.237.78
+121.130.249.227
  121.130.29.11
  121.130.29.21
  121.131.206.165
-121.131.224.39
-121.131.232.156
  121.131.27.8
  121.132.100.14
  121.132.104.101
  121.132.105.76
  121.132.107.111
  121.132.107.70
+121.132.138.236
+121.132.191.9
  121.132.194.124
  121.132.197.78
  121.132.225.156
@@ -29926,17 +28117,17 @@
  121.132.58.102
  121.132.82.202
  121.133.16.44
+121.133.160.177
  121.133.179.201
  121.133.186.184
+121.133.30.129
  121.134.108.87
  121.134.159.21
  121.134.174.236
-121.134.192.11
  121.134.198.156
  121.134.215.112
  121.134.249.151
  121.134.65.228
-121.135.113.49
  121.135.117.53
  121.135.117.53bin.sh
  121.135.123.234
@@ -29949,8 +28140,11 @@
  121.135.51.140
  121.136.130.77
  121.136.150.44
+121.136.151.219
+121.136.151.41
  121.136.152.184
  121.136.180.124
+121.136.190.82
  121.136.202.12
  121.136.233.89
  121.136.80.58
@@ -29960,7 +28154,7 @@
  121.137.219.129
  121.137.219.233
  121.137.241.118
-121.137.46.73
+121.138.138.117
  121.138.149.198
  121.138.155.41
  121.138.171.153
@@ -29997,10 +28191,13 @@
  121.14.242.61
  121.140.0.70
  121.140.118.26
+121.140.125.230
  121.140.216.75
+121.140.237.77
  121.140.94.122
  121.141.34.205
  121.141.55.144
+121.142.121.17
  121.142.127.140
  121.142.154.192
  121.142.158.97
@@ -30015,12 +28212,15 @@
  121.144.136.109
  121.144.181.231
  121.144.182.9
+121.144.226.90
  121.144.235.179
  121.144.80.176
+121.145.120.3
  121.145.133.127
  121.145.232.224
  121.145.238.192
  121.145.248.189
+121.145.50.191
  121.145.54.134
  121.145.75.234
  121.145.79.150
@@ -30034,7 +28234,6 @@
  121.147.179.199
  121.147.2.41
  121.147.227.133
-121.147.227.150
  121.147.227.184
  121.147.241.223
  121.147.54.178
@@ -30051,6 +28250,7 @@
  121.148.212.229
  121.148.23.22
  121.148.244.119
+121.148.57.200
  121.149.104.142
  121.149.104.145
  121.149.104.170
@@ -30059,20 +28259,17 @@
  121.149.104.58
  121.149.104.60
  121.149.104.83
-121.149.112.10
  121.149.114.172
  121.149.114.55
  121.149.114.59
  121.149.114.70
  121.149.121.199
  121.149.121.199bin.sh
-121.149.180.24
  121.149.180.81
  121.149.180.9
  121.149.20.29
  121.149.20.34
  121.149.20.53
-121.149.20.54
  121.149.20.55
  121.149.21.18
  121.149.245.146
@@ -30084,7 +28281,6 @@
  121.149.93.169
  121.149.99.17
  121.15.137.137
-121.15.139.2
  121.15.165.185
  121.15.170.60
  121.15.2.178
@@ -30098,6 +28294,7 @@
  121.150.122.116
  121.150.154.168
  121.150.186.74
+121.150.209.217
  121.150.7.141
  121.151.108.195
  121.151.150.243
@@ -30122,6 +28319,7 @@
  121.153.155.2
  121.153.22.222
  121.153.37.78
+121.153.8.44
  121.154.155.24
  121.154.162.103
  121.154.190.232
@@ -30133,10 +28331,12 @@
  121.154.94.200
  121.155.104.198
  121.155.117.207
+121.155.135.242
  121.155.156.93
  121.155.156.93bin.sh
+121.155.16.223
  121.155.179.134
-121.155.179.155
+121.155.233.13
  121.155.247.168
  121.155.249.227
  121.155.57.69
@@ -30152,8 +28352,11 @@
  121.156.212.210
  121.156.236.50
  121.156.26.163
+121.156.27.90
  121.156.87.243
+121.157.129.153
  121.157.17.112
+121.157.207.26
  121.157.225.132
  121.157.236.24
  121.157.31.11
@@ -30173,9 +28376,7 @@
  121.16.109.97
  121.16.131.180
  121.16.144.186
-121.16.162.235
  121.16.41.154
-121.160.139.118
  121.160.147.70
  121.160.165.136
  121.160.173.243
@@ -30192,7 +28393,6 @@
  121.162.131.223
  121.162.235.44
  121.162.237.104
-121.162.60.159
  121.163.131.224
  121.163.140.158
  121.163.151.113
@@ -30200,29 +28400,38 @@
  121.163.183.204
  121.163.208.19
  121.163.210.131
+121.163.244.171
  121.163.39.8
  121.163.94.158
  121.164.0.80
+121.164.152.149
  121.164.178.157
  121.164.184.155
+121.164.215.205
  121.164.82.98
  121.164.87.206
+121.165.10.216
  121.165.140.242
  121.165.162.44
+121.165.174.221
  121.165.18.228
+121.165.21.76
+121.165.219.59
  121.165.26.119
  121.165.73.157
+121.166.113.27
  121.166.244.18
-121.166.245.171
  121.166.59.13
  121.166.73.47
  121.167.110.147
-121.167.117.68
  121.167.233.128
  121.167.5.254
+121.167.74.88
  121.168.108.87
  121.168.145.104
  121.168.186.156
+121.168.186.204
+121.168.240.145
  121.168.244.168
  121.168.244.201
  121.168.3.208
@@ -30245,6 +28454,7 @@
  121.169.222.192
  121.169.224.101
  121.169.25.46
+121.169.30.71
  121.169.34.103
  121.169.34.119
  121.169.34.14
@@ -30272,7 +28482,6 @@
  121.170.129.112
  121.170.19.103
  121.170.19.226
-121.170.195.137
  121.170.31.103
  121.170.31.223
  121.170.31.28
@@ -30285,7 +28494,7 @@
  121.170.53.157
  121.170.66.217
  121.170.71.70
-121.171.116.211
+121.170.90.234
  121.171.118.217
  121.171.166.170
  121.171.166.47
@@ -30297,6 +28506,7 @@
  121.172.73.163
  121.172.86.43
  121.172.86.53
+121.172.91.79
  121.173.115.68
  121.173.126.110
  121.173.126.111
@@ -30314,6 +28524,7 @@
  121.174.185.107
  121.174.241.95
  121.174.242.223
+121.174.99.115
  121.175.104.251
  121.175.157.24
  121.175.191.243
@@ -30323,7 +28534,7 @@
  121.175.66.25
  121.175.70.221
  121.175.75.193
-121.175.84.205
+121.175.8.174
  121.176.202.191
  121.176.205.166
  121.176.251.165
@@ -30371,8 +28582,6 @@
  121.178.235.11
  121.178.235.127
  121.178.235.212
-121.178.235.245
-121.178.235.65
  121.178.235.95
  121.178.247.156
  121.178.247.206
@@ -30383,6 +28592,7 @@
  121.178.247.34
  121.178.247.49
  121.178.247.82
+121.178.38.239
  121.178.86.208
  121.179.112.163
  121.179.124.109
@@ -30394,33 +28604,36 @@
  121.18.115.170
  121.18.128.26
  121.18.154.174
-121.18.85.114
  121.18.87.139
  121.18.88.186
  121.180.106.112
  121.180.106.112bin.sh
  121.180.171.227
+121.180.203.139
  121.180.222.43
  121.180.39.150
  121.180.43.39
  121.180.53.230
+121.181.138.70
  121.181.16.122
  121.181.168.21
  121.181.57.183
  121.181.94.33
  121.182.106.202
  121.182.127.136
+121.182.14.160
  121.182.156.241
  121.182.251.175
  121.182.5.227
  121.182.67.220
-121.182.69.107
  121.182.73.56
  121.183.117.232
  121.183.128.220
  121.183.188.85
  121.183.235.19
  121.183.251.18
+121.183.254.58
+121.183.70.91
  121.183.75.145
  121.183.76.224
  121.183.86.60
@@ -30430,15 +28643,16 @@
  121.184.179.36
  121.184.235.88
  121.185.114.181
+121.185.150.8
  121.185.152.89
  121.185.17.141
  121.185.231.55
  121.185.31.185
  121.185.56.11
-121.186.122.216
  121.186.147.16
  121.186.174.29
  121.186.175.229
+121.186.79.89
  121.186.79.90
  121.187.128.97
  121.187.138.81
@@ -30454,7 +28668,6 @@
  121.189.194.125
  121.189.194.165
  121.189.210.2
-121.19.222.27
  121.190.102.21
  121.190.192.77
  121.190.244.213
@@ -30467,14 +28680,14 @@
  121.196.23.247
  121.196.57.160
  121.196.59.48
-121.199.29.223
+121.199.60.92
+121.199.9.251
  121.20.202.25
  121.20.248.252
  121.20.4.210
  121.20.74.209
  121.200.48.58
  121.200.48.98
-121.200.61.37
  121.200.63.10
  121.200.64.45
  121.200.7.120
@@ -30482,12 +28695,10 @@
  121.200.82.40
  121.201.10.117
  121.201.10.82
-121.201.106.27
  121.201.108.7
  121.201.110.223
  121.201.119.61
  121.201.119.77
-121.201.123.252
  121.201.124.251
  121.201.126.46
  121.201.3.121
@@ -30502,48 +28713,39 @@
  121.201.74.154
  121.201.75.161
  121.201.76.119
+121.201.84.143
  121.201.93.66
  121.201.94.17
  121.201.95.66
  121.201.95.79
  121.203.221.85
  121.204.0.122
-121.204.141.232
  121.204.142.193
  121.204.148.63
  121.204.153.151
  121.204.154.158
  121.204.164.170
  121.204.164.96
-121.204.166.240
-121.204.185.106
-121.204.204.240
-121.204.208.167
  121.204.208.43
  121.204.213.37
  121.204.247.190
-121.204.59.237
  121.205.220.251
  121.205.96.188
-121.206.10.147
-121.206.126.208
  121.206.16.116
  121.206.38.14
  121.206.38.20
-121.206.38.215
-121.206.6.25
+121.206.38.82
  121.206.64.87
  121.206.92.211
  121.206.92.249
-121.207.114.103
  121.207.226.106
  121.207.226.21
  121.208.69.69
  121.21.120.16
  121.21.154.65
  121.21.92.217
-121.210.48.217
  121.211.20.23
+121.211.201.98
  121.215.45.82
  121.216.8.166
  121.218.0.79
@@ -30572,7 +28774,6 @@
  121.22.5.154
  121.22.5.156
  121.22.5.160
-121.22.5.83
  121.22.6.45
  121.22.95.142
  121.221.133.155
@@ -30580,10 +28781,7 @@
  121.224.179.33
  121.224.59.192
  121.225.25.43
-121.225.25.76
-121.225.84.11
  121.225.85.100
-121.225.85.183
  121.225.85.188
  121.226.131.122
  121.226.131.146
@@ -30605,33 +28803,29 @@
  121.226.94.109
  121.227.0.117
  121.227.103.87
-121.227.152.235
  121.227.153.232
  121.227.31.13
  121.227.31.162
  121.227.48.205
  121.228.136.239
  121.228.196.248
+121.228.215.83
  121.229.0.116
-121.229.0.154
  121.229.10.130
  121.229.124.211
  121.229.125.224
-121.229.13.181
  121.229.133.218
  121.229.15.146
  121.229.15.6
  121.229.19.200
-121.229.2.136
  121.229.2.190
  121.229.20.121
+121.229.20.84
  121.229.26.104
  121.229.4.236
  121.229.48.89
-121.229.57.211
  121.229.58.8
  121.229.6.166
-121.229.62.64
  121.229.62.94
  121.229.63.151
  121.229.9.72
@@ -30647,6 +28841,7 @@
  121.230.24.151
  121.230.24.97
  121.230.254.53
+121.231.10.27
  121.231.100.184
  121.231.100.43
  121.231.101.240
@@ -30660,6 +28855,7 @@
  121.231.75.160
  121.231.83.134
  121.232.179.201
+121.232.195.86
  121.232.39.129bin.sh
  121.233.1.189
  121.233.101.155
@@ -30692,7 +28888,6 @@
  121.234.13.23
  121.234.20.155
  121.234.20.205
-121.234.215.102
  121.234.46.5
  121.234.47.75
  121.235.0.11
@@ -30705,15 +28900,16 @@
  121.237.114.52
  121.237.140.165
  121.237.225.11bin.sh
-121.237.249.168
  121.237.76.140
  121.237.77.159
-121.237.92.57
  121.239.143.14
  121.239.42.133
  121.239.46.113
  121.239.65.149
+121.24.124.34
  121.24.139.131
+121.24.245.90
+121.24.83.79
  121.241.244.92
  121.241.90.242
  121.244.147.176
@@ -30741,6 +28937,7 @@
  121.254.78.145
  121.254.84.9
  121.254.85.49
+121.27.159.242
  121.27.172.49
  121.27.59.7
  121.28.12.105
@@ -30759,6 +28956,7 @@
  121.28.255.244
  121.28.38.235
  121.28.56.246
+121.28.80.173
  121.28.95.243
  121.29.77.45
  121.29.82.147
@@ -30772,7 +28970,6 @@
  121.31.126.134
  121.31.14.133
  121.31.41.77
-121.31.5.184
  121.31.66.220
  121.31.66.77
  121.31.69.124
@@ -30780,10 +28977,8 @@
  121.32.129.18
  121.32.150.82
  121.33.113.76
-121.33.144.123
  121.33.144.168
  121.33.144.200
-121.33.145.214
  121.33.146.141
  121.33.146.236
  121.33.147.155
@@ -30794,12 +28989,10 @@
  121.33.254.10
  121.34.150.146
  121.34.150.176
-121.35.184.159
  121.35.240.245
  121.35.96.41
  121.36.109.204
  121.36.109.241
-121.36.118.139
  121.36.147.174
  121.36.196.71
  121.36.230.178
@@ -30834,21 +29027,18 @@
  121.37.232.12
  121.37.240.245
  121.37.248.95
+121.37.26.179
+121.40.105.124
  121.40.128.99
  121.40.141.226
  121.40.162.239
  121.40.199.102
  121.40.203.142
-121.40.21.205
-121.40.31.203
  121.40.55.144
  121.40.66.129
-121.41.224.37
+121.40.70.132
  121.41.24.64
-121.41.35.114
-121.41.50.13
  121.41.82.60
-121.41.88.110
  121.42.227.63
  121.42.38.56
  121.43.116.52
@@ -30870,22 +29060,18 @@
  121.46.29.198
  121.46.31.174
  121.46.4.194
-121.48.163.225
-121.48.165.121
-121.48.165.2
  121.52.132.186
  121.52.150.220
-121.52.153.104
  121.52.153.6
  121.52.154.216
  121.52.157.112
  121.52.214.63
-121.52.41.26
  121.52.66.102
  121.54.164.151
  121.54.168.251
  121.54.168.252
  121.54.168.253
+121.54.169.69
  121.54.216.91
  121.54.58.242
  121.54.71.217
@@ -30905,7 +29091,6 @@
  121.57.179.172
  121.57.179.179
  121.58.195.140
-121.58.211.162
  121.58.212.70
  121.58.242.66
  121.58.243.202
@@ -30919,7 +29104,6 @@
  121.6.234.150
  121.6.39.204
  121.6.54.248
-121.60.117.170
  121.60.122.145
  121.61.104.2
  121.61.106.104
@@ -30933,15 +29117,14 @@
  121.61.65.135
  121.61.67.219
  121.61.68.138
-121.61.77.121
  121.61.78.91
  121.61.96.111
  121.61.97.0
  121.61.97.71
  121.61.97.75
-121.63.179.228
  121.63.247.49
  121.63.247.74
+121.63.3.55
  121.63.64.213
  121.63.73.61
  121.63.82.89
@@ -30952,7 +29135,6 @@
  121.66.198.51
  121.66.198.76
  121.66.205.3
-121.66.252.158
  121.66.35.37
  121.67.246.170
  121.67.99.220
@@ -30961,10 +29143,7 @@
  121.69.26.214
  121.69.37.210
  121.69.44.6
-121.69.65.110
-121.69.89.78
  121.69.93.226
-121.7.127.92
  121.7.146.78
  121.7.226.118
  121.7.31.214
@@ -30979,13 +29158,11 @@
  121.78.145.242
  121.78.147.110
  121.78.147.32
-121.78.156.150
  121.78.158.54
  121.78.223.195
  121.78.236.175
  121.8.143.165
  121.8.146.99
-121.8.157.138
  121.8.164.114
  121.8.184.58
  121.8.185.98
@@ -30995,13 +29172,10 @@
  121.88.4.141
  121.88.4.74
  121.88.99.236
-121.89.176.79
  121.89.193.102
  121.89.194.147
-121.89.196.54
  121.89.198.64
-121.89.215.20
-121.9.226.234
+121.89.204.67
  121.9.252.250
  121.92.116.166
  121.92.170.238
@@ -31034,54 +29208,41 @@
  122.102.36.10
  122.102.39.107
  122.102.43.82
-122.109.190.104
  122.11.148.38
  122.11.149.133
  122.11.205.244
-122.112.141.115
  122.112.198.158
-122.112.201.139
  122.112.229.12
  122.112.71.214
-122.114.109.220
  122.114.11.182
  122.114.11.7
  122.114.112.195
-122.114.120.213
  122.114.127.157
  122.114.13.4
  122.114.131.124
  122.114.141.155
  122.114.149.176
-122.114.156.165
  122.114.156.206
  122.114.157.103
  122.114.157.45
-122.114.158.242
  122.114.159.176
  122.114.159.212
+122.114.159.92
  122.114.166.8
  122.114.167.2
  122.114.169.101
  122.114.170.66
  122.114.171.217
-122.114.171.57
  122.114.173.38
  122.114.175.35
-122.114.183.18
  122.114.185.153
  122.114.198.163
  122.114.202.204
  122.114.202.208
-122.114.206.30
  122.114.215.140
-122.114.217.147
-122.114.222.223
-122.114.239.22
  122.114.240.228
  122.114.246.248
  122.114.247.201
-122.114.247.244
  122.114.248.57
  122.114.30.111
  122.114.4.186
@@ -31116,7 +29277,6 @@
  122.115.230.149
  122.115.230.204
  122.115.231.192
-122.115.231.228
  122.115.232.107
  122.115.239.24
  122.115.43.228
@@ -31129,7 +29289,6 @@
  122.116.101.202
  122.116.103.221
  122.116.104.167
-122.116.105.138
  122.116.106.217
  122.116.108.111
  122.116.115.30
@@ -31145,6 +29304,7 @@
  122.116.133.132
  122.116.133.33
  122.116.135.1
+122.116.135.60
  122.116.138.32
  122.116.138.42
  122.116.139.108
@@ -31173,6 +29333,7 @@
  122.116.174.33
  122.116.175.51
  122.116.189.218
+122.116.194.37
  122.116.198.236
  122.116.198.36
  122.116.2.213
@@ -31234,14 +29395,12 @@
  122.116.247.37
  122.116.247.59
  122.116.249.9
-122.116.251.139
  122.116.251.18
  122.116.252.164
  122.116.252.205
  122.116.252.41
  122.116.253.71
  122.116.29.158
-122.116.29.168
  122.116.31.25
  122.116.32.122
  122.116.32.139
@@ -31258,6 +29417,7 @@
  122.116.47.42
  122.116.49.107
  122.116.5.156
+122.116.50.229
  122.116.50.251
  122.116.50.83
  122.116.51.123
@@ -31275,6 +29435,7 @@
  122.116.67.159
  122.116.7.29
  122.116.73.178
+122.116.73.231
  122.116.75.104
  122.116.77.50
  122.116.79.114
@@ -31320,6 +29481,7 @@
  122.117.120.148
  122.117.120.29
  122.117.121.105
+122.117.122.2
  122.117.122.42
  122.117.123.200
  122.117.123.51
@@ -31360,6 +29522,8 @@
  122.117.152.144
  122.117.152.172
  122.117.152.204
+122.117.153.232
+122.117.153.59
  122.117.155.196
  122.117.155.92
  122.117.156.82
@@ -31376,6 +29540,7 @@
  122.117.165.163
  122.117.165.239
  122.117.166.13
+122.117.166.210
  122.117.166.247
  122.117.169.117
  122.117.169.252
@@ -31395,7 +29560,6 @@
  122.117.189.32
  122.117.19.122
  122.117.19.146
-122.117.19.66
  122.117.190.202
  122.117.190.230
  122.117.190.232
@@ -31447,7 +29611,6 @@
  122.117.227.47
  122.117.228.118
  122.117.228.80
-122.117.228.82
  122.117.23.143
  122.117.233.105
  122.117.234.96
@@ -31504,7 +29667,6 @@
  122.117.49.5
  122.117.50.118
  122.117.51.86
-122.117.55.58
  122.117.58.164
  122.117.58.197
  122.117.58.210
@@ -31596,8 +29758,8 @@
  122.128.55.129
  122.128.55.25
  122.129.112.209
+122.129.154.58
  122.129.212.234
-122.129.212.252
  122.129.212.90
  122.129.74.58
  122.135.107.115
@@ -31607,36 +29769,38 @@
  122.136.219.81
  122.136.50.160
  122.136.51.139
+122.136.6.200
  122.137.17.14
  122.137.173.176
  122.137.174.50
  122.137.175.32
-122.137.178.100
+122.137.178.111
  122.137.25.200
  122.137.31.117
-122.137.47.44
  122.137.7.93
  122.137.8.160
  122.137.8.81
  122.137.9.60
-122.138.166.140
  122.138.181.117
  122.138.186.198
  122.138.20.8
  122.138.207.137
  122.138.215.74
  122.138.216.178
+122.138.216.20
  122.138.225.233
  122.138.25.122
  122.139.102.19
-122.139.20.181
+122.139.114.115
  122.139.21.146
  122.139.30.193
  122.14.195.58
+122.14.198.75
  122.14.200.208
  122.14.201.129
  122.14.201.170
  122.14.211.208
+122.14.213.71
  122.14.214.107
  122.14.217.48
  122.14.220.129
@@ -31670,7 +29834,9 @@
  122.141.25.235
  122.141.26.134
  122.141.26.212
+122.142.105.194
  122.142.156.61
+122.142.28.71
  122.142.91.184
  122.143.11.111
  122.143.111.250
@@ -31684,7 +29850,6 @@
  122.143.19.73
  122.143.190.222
  122.143.23.149
-122.143.42.4
  122.143.57.66
  122.144.131.74
  122.144.131.75
@@ -31692,45 +29857,36 @@
  122.144.134.27
  122.144.15.36
  122.144.196.122
-122.144.211.235
  122.144.212.144
  122.144.221.149
  122.146.196.217
+122.147.131.89
  122.147.213.63
  122.147.42.3
  122.149.205.155
  122.15.131.65
  122.15.137.178
-122.15.2.119
  122.15.202.50
  122.15.71.33
-122.15.82.86
  122.152.194.123
-122.152.194.184
  122.152.196.222
-122.152.197.157
-122.152.197.6
-122.152.201.228
  122.152.202.214
-122.152.204.104
  122.152.204.42
  122.152.208.242
-122.152.208.61
  122.152.209.120
  122.152.211.187
-122.152.213.85
  122.152.215.115
  122.152.217.9
  122.152.220.161
  122.152.248.27
  122.152.249.135
+122.152.52.225
  122.152.55.49
  122.153.212.195
  122.154.141.244
  122.154.151.202
  122.154.162.2
  122.154.178.202
-122.154.24.254
  122.154.251.22
  122.154.253.20
  122.154.41.59
@@ -31752,13 +29908,11 @@
  122.155.201.43
  122.155.202.93
  122.155.223.20
-122.155.223.38
  122.155.223.59
  122.155.223.9
  122.155.27.222
  122.155.7.117
  122.155.9.169
-122.156.120.233
  122.156.122.215
  122.156.184.163
  122.156.219.194
@@ -31767,6 +29921,7 @@
  122.156.250.101
  122.156.251.216
  122.156.44.55
+122.157.59.239
  122.158.154.234
  122.159.131.78
  122.159.177.251
@@ -31774,17 +29929,15 @@
  122.159.208.211
  122.159.208.61
  122.159.243.43
+122.159.29.103
  122.159.81.8
  122.16.180.244
  122.160.112.27
  122.160.137.76
  122.160.147.51
-122.160.148.238
  122.160.179.142
  122.160.2.233
  122.160.25.225
-122.160.45.4
-122.160.46.61
  122.160.48.10
  122.160.48.9
  122.160.51.88
@@ -31800,8 +29953,7 @@
  122.164.27.12
  122.165.104.51
  122.165.131.29
-122.165.136.199
-122.165.144.219
+122.165.131.7
  122.165.149.75
  122.165.171.107
  122.165.194.191
@@ -31814,40 +29966,29 @@
  122.166.162.9
  122.166.171.166
  122.166.176.48
-122.166.192.26
  122.166.22.197
  122.166.227.27
  122.166.237.117
  122.167.177.179
-122.167.22.73
-122.168.125.226
  122.168.196.12
  122.169.110.96
  122.169.114.254
  122.169.202.72
  122.169.232.38
-122.169.81.109
  122.170.103.231
  122.170.105.227
-122.170.108.228
  122.170.109.61
  122.170.111.175
-122.170.179.165
  122.170.5.123
  122.170.6.71
-122.171.156.93
  122.173.137.226
  122.174.12.93
-122.174.221.36
  122.175.62.51
  122.176.169.143
  122.176.251.183
  122.176.32.194
-122.176.40.9
  122.176.42.237
  122.176.49.139
-122.176.52.13
-122.176.55.10
  122.176.55.24
  122.176.56.220
  122.176.56.5
@@ -31870,19 +30011,19 @@
  122.181.16.134
  122.183.139.104
  122.183.17.66
+122.185.149.38
+122.185.174.134
  122.185.22.171
-122.188.208.110
  122.188.61.157
-122.189.2.165
  122.190.192.182
  122.190.244.85
  122.191.189.91
-122.192.255.228
  122.192.5.82
  122.193.10.153
  122.193.10.180
  122.193.103.228
  122.193.178.60
+122.193.224.98
  122.193.233.24
  122.193.252.97
  122.193.255.64
@@ -31897,16 +30038,14 @@
  122.194.44.48
  122.195.134.68
  122.195.156.76
-122.195.162.2
  122.195.197.116
  122.195.197.62
-122.195.58.166
  122.195.67.226
  122.195.67.227
  122.199.105.167
  122.199.106.39
+122.199.111.87
  122.199.140.158
-122.199.152.114
  122.199.45.91
  122.199.66.26
  122.199.66.28
@@ -31917,7 +30056,7 @@
  122.199.79.41
  122.199.86.200
  122.199.86.209
-122.2.37.38
+122.2.16.227
  122.200.144.42
  122.200.150.129
  122.200.150.249
@@ -31933,6 +30072,7 @@
  122.201.82.218
  122.202.220.186
  122.202.32.70
+122.202.34.60
  122.202.48.251
  122.202.50.129
  122.202.50.76
@@ -31945,10 +30085,9 @@
  122.223.33.18
  122.224.119.123
  122.224.126.58
+122.224.129.237
  122.224.131.115
-122.224.131.116
  122.224.132.59
-122.224.168.22
  122.224.168.237
  122.224.19.43
  122.224.199.174
@@ -31963,7 +30102,6 @@
  122.224.237.234
  122.224.240.99
  122.224.65.197
-122.224.86.182
  122.224.93.75
  122.224.93.77
  122.224.95.158
@@ -31972,10 +30110,8 @@
  122.225.130.74
  122.225.139.180
  122.225.202.74
-122.225.203.162
  122.225.218.234
  122.225.228.90
-122.225.230.10
  122.225.52.166
  122.225.61.30
  122.225.68.45
@@ -31996,7 +30132,6 @@
  122.226.73.22
  122.226.73.50
  122.226.73.54
-122.226.78.182
  122.226.92.166
  122.227.100.42
  122.227.112.234
@@ -32016,6 +30151,7 @@
  122.227.198.250
  122.227.214.155
  122.227.225.6
+122.227.26.90
  122.227.42.48
  122.227.48.190
  122.227.62.234
@@ -32042,11 +30178,9 @@
  122.230.69.141
  122.230.70.119
  122.231.47.237
-122.232.154.24
-122.232.254.231
  122.233.109.171
+122.233.135.21
  122.233.188.147
-122.233.230.46
  122.233.238.248
  122.234.235.129
  122.234.77.121
@@ -32054,20 +30188,16 @@
  122.236.192.162
  122.237.107.36
  122.237.107.86
-122.238.148.180
  122.239.128.19
-122.239.143.239
  122.239.153.225
  122.239.155.129
-122.24.58.232
  122.24.84.151
  122.240.155.200
  122.241.150.98
-122.241.229.229
-122.242.99.18
  122.244.221.131
  122.244.222.14
  122.244.51.202
+122.245.83.18
  122.246.240.243
  122.247.240.209
  122.247.243.30
@@ -32103,11 +30233,12 @@
  122.254.30.48
  122.254.33.146
  122.254.33.161
+122.254.33.77
  122.254.35.44
  122.254.82.43
-122.254.85.253
  122.254.87.109
  122.255.5.42
+122.27.50.217
  122.3.0.11
  122.3.0.23
  122.3.0.26
@@ -32122,11 +30253,10 @@
  122.4.199.239
  122.4.240.189
  122.4.249.171
-122.4.44.205
-122.4.56.10
  122.40.66.17
  122.42.206.235
  122.44.136.151
+122.44.232.128
  122.46.191.204
  122.49.208.36
  122.49.249.235
@@ -32138,42 +30268,26 @@
  122.51.100.145
  122.51.101.136
  122.51.102.227
-122.51.104.100
  122.51.104.166
  122.51.104.28
-122.51.105.211
  122.51.108.64
-122.51.109.222
  122.51.114.226
-122.51.114.51
-122.51.120.6
  122.51.124.85
  122.51.125.104
-122.51.125.117
  122.51.125.71
-122.51.127.17
  122.51.129.180
  122.51.129.198
  122.51.130.21
-122.51.131.225
  122.51.136.128
  122.51.137.21
-122.51.139.57
-122.51.14.236
-122.51.142.251
-122.51.142.72
  122.51.147.181
  122.51.147.221
  122.51.149.86
  122.51.150.134
-122.51.154.105
  122.51.154.136
-122.51.154.248
  122.51.154.84
  122.51.155.140
-122.51.156.113
  122.51.156.216
-122.51.158.15
  122.51.158.27
  122.51.161.231
  122.51.163.237
@@ -32186,39 +30300,24 @@
  122.51.176.111
  122.51.178.207
  122.51.178.89
-122.51.179.14
  122.51.18.119
  122.51.181.232
-122.51.181.251
-122.51.183.238
-122.51.183.47
  122.51.186.145
-122.51.186.17
  122.51.186.219
  122.51.186.228
-122.51.186.243
-122.51.186.86
  122.51.187.118
  122.51.188.100
  122.51.188.20
  122.51.189.179
-122.51.189.69
  122.51.190.182
  122.51.191.69
  122.51.192.105
  122.51.194.44
-122.51.195.104
  122.51.196.235
-122.51.197.3
-122.51.198.248
-122.51.198.67
-122.51.198.90
  122.51.199.69
-122.51.2.33
  122.51.200.223
  122.51.200.252
  122.51.203.120
-122.51.203.177
  122.51.204.45
  122.51.204.47
  122.51.204.51
@@ -32228,54 +30327,37 @@
  122.51.208.60
  122.51.209.153
  122.51.209.252
-122.51.21.208
  122.51.210.116
-122.51.210.176
  122.51.211.131
  122.51.211.249
  122.51.213.238
-122.51.214.35
  122.51.214.44
-122.51.216.203
-122.51.217.131
  122.51.218.122
-122.51.22.134
  122.51.221.184
-122.51.221.3
  122.51.222.42
-122.51.223.155
  122.51.224.106
  122.51.225.107
  122.51.226.217
-122.51.226.75
  122.51.227.216
  122.51.227.221
-122.51.227.65
  122.51.227.85
  122.51.229.116
-122.51.229.124
  122.51.230.155
  122.51.231.165
-122.51.231.218
  122.51.231.80
  122.51.233.63
  122.51.234.65
-122.51.234.86
  122.51.237.131
  122.51.238.227
  122.51.238.27
  122.51.239.65
  122.51.239.90
-122.51.24.180
-122.51.240.241
  122.51.241.109
  122.51.241.12
  122.51.241.65
-122.51.242.122
-122.51.243.143
+122.51.242.196
  122.51.243.223
  122.51.243.251
-122.51.245.179
  122.51.245.236
  122.51.245.240
  122.51.246.97
@@ -32283,11 +30365,8 @@
  122.51.248.76
  122.51.250.133
  122.51.250.3
-122.51.250.43
-122.51.251.253
  122.51.252.15
  122.51.252.45
-122.51.253.157
  122.51.254.201
  122.51.254.221
  122.51.254.9
@@ -32301,40 +30380,24 @@
  122.51.32.248
  122.51.32.91
  122.51.33.61
-122.51.34.199
  122.51.34.215
-122.51.34.64
  122.51.36.254
  122.51.39.232
  122.51.4.108
  122.51.40.61
  122.51.41.36
-122.51.41.44
  122.51.41.63
  122.51.43.191
-122.51.44.80
  122.51.45.200
  122.51.45.213
-122.51.45.240
-122.51.47.205
-122.51.49.32
  122.51.52.109
  122.51.52.154
-122.51.55.171
  122.51.56.113
-122.51.56.205
  122.51.57.14
-122.51.57.78
-122.51.58.42
-122.51.60.228
  122.51.60.39
-122.51.62.135
  122.51.62.212
  122.51.64.115
  122.51.64.150
-122.51.65.164
-122.51.66.125
-122.51.66.219
  122.51.66.91
  122.51.67.249
  122.51.68.119
@@ -32342,32 +30405,24 @@
  122.51.69.116
  122.51.7.103
  122.51.72.249
-122.51.72.53
  122.51.73.73
-122.51.76.233
-122.51.77.128
  122.51.77.182
  122.51.78.73
  122.51.80.81
  122.51.81.247
  122.51.82.162
-122.51.82.22
  122.51.83.195
  122.51.85.95
  122.51.86.120
-122.51.86.234
  122.51.89.18
  122.51.90.66
-122.51.91.131
-122.51.91.191
  122.51.91.2
+122.51.92.196
  122.51.92.78
-122.51.94.92
  122.51.95.90
  122.51.96.57
  122.51.97.151
  122.51.97.199
-122.51.98.36
  122.51.99.88
  122.52.107.94
  122.52.127.96
@@ -32379,7 +30434,6 @@
  122.52.48.92
  122.53.152.40
  122.53.220.75
-122.54.101.57
  122.54.131.137
  122.54.134.176
  122.54.143.156
@@ -32389,14 +30443,14 @@
  122.54.20.213
  122.54.20.216
  122.54.200.48
-122.54.247.83
  122.55.108.14
-122.55.195.5
  122.55.202.100
  122.55.79.116
  122.56.185.175
+122.58.130.251
  122.58.86.163
  122.6.250.171
+122.60.63.85
  122.7.82.158
  122.70.150.10
  122.70.158.79
@@ -32408,10 +30462,10 @@
  122.9.43.73
  122.9.67.134
  122.9.77.119
+122.96.103.90
  122.96.140.194
  122.96.140.226
  122.96.254.112
-122.96.51.9
  122.96.9.86
  122.97.162.201
  122.97.208.74
@@ -32429,12 +30483,9 @@
  123.0.243.122
  123.0.250.82
  123.0.34.96
-123.0.36.156
  123.1.148.100
  123.1.154.200
  123.1.154.224
-123.1.157.166
-123.1.174.156
  123.1.180.246
  123.1.187.40
  123.1.187.49
@@ -32446,6 +30497,10 @@
  123.1.189.70
  123.10.129.234
  123.10.130.193
+123.10.133.246
+123.10.135.69
+123.10.140.246
+123.10.146.76
  123.10.153.139
  123.10.157.219
  123.10.159.123
@@ -32453,22 +30508,30 @@
  123.10.165.76
  123.10.172.185
  123.10.173.145
+123.10.178.233
  123.10.179.118
+123.10.192.218
  123.10.2.38
+123.10.21.50
  123.10.210.180
+123.10.213.230
  123.10.213.244
+123.10.22.104
+123.10.234.176
+123.10.241.110
  123.10.28.162
  123.10.29.255
  123.10.35.171
+123.10.35.255
+123.10.45.85
  123.10.49.8
+123.10.49.83
  123.10.52.160
-123.10.57.27
  123.10.59.138
  123.10.8.237
  123.10.82.220
  123.10.90.173
-123.10.99.46
-123.100.226.172
+123.10.99.171
  123.101.174.165
  123.103.242.12
  123.103.88.252
@@ -32485,43 +30548,38 @@
  123.108.201.91
  123.108.249.82
  123.108.252.170
-123.108.35.186
  123.108.50.164
  123.108.97.50
  123.109.80.223
+123.11.0.174
  123.11.10.156
+123.11.11.246
+123.11.12.218
  123.11.13.120
  123.11.13.202
  123.11.13.233
-123.11.14.240
-123.11.15.203
-123.11.150.165
  123.11.153.28
-123.11.169.205
-123.11.178.79
  123.11.193.137
  123.11.195.214
+123.11.198.175
  123.11.199.244
  123.11.203.136
-123.11.233.41
-123.11.234.244
  123.11.235.95
  123.11.239.77
  123.11.30.100
-123.11.37.199
  123.11.4.81
  123.11.5.171
-123.11.5.3
-123.11.54.164
-123.11.6.115
+123.11.62.24
  123.11.63.173
-123.11.69.180
+123.11.7.47
+123.11.7.8
  123.11.73.104
  123.11.78.153
  123.11.78.82
  123.11.79.213
  123.11.9.1
  123.11.9.175
+123.11.9.224
  123.11.94.238
  123.110.102.172
  123.110.11.185
@@ -32560,11 +30618,8 @@
  123.113.116.173
  123.113.13.113
  123.113.13.239
-123.113.190.59
-123.113.26.246
-123.113.29.165
+123.113.204.96
  123.114.14.213
-123.114.164.155
  123.114.208.126
  123.114.245.46
  123.114.32.217
@@ -32590,21 +30645,19 @@
  123.118.110.57
  123.118.142.175
  123.118.176.61
-123.118.3.231
+123.118.76.18
  123.118.99.100
  123.118.99.24
-123.119.184.252
  123.119.47.203
  123.12.170.108
  123.12.176.191
  123.12.181.91
-123.12.182.187
-123.12.185.226
  123.12.196.134
  123.12.197.46
  123.12.221.108
  123.12.229.211
  123.12.231.175
+123.12.232.94
  123.12.233.225
  123.12.233.247
  123.12.235.170
@@ -32612,18 +30665,19 @@
  123.12.242.248
  123.12.242.41
  123.12.243.129
+123.12.39.227
  123.12.41.157
  123.12.43.166
-123.12.44.19
-123.12.45.63
+123.12.45.135
+123.12.5.143
  123.12.57.50
+123.12.60.249
  123.12.62.90
  123.12.65.254
+123.12.7.209
  123.12.75.177
  123.120.162.195
  123.120.163.18
-123.120.171.148
-123.120.173.213
  123.120.33.210
  123.120.38.199
  123.121.100.245
@@ -32638,7 +30692,7 @@
  123.122.162.200
  123.122.163.86
  123.122.232.190
-123.123.97.182
+123.122.79.37
  123.124.21.253
  123.124.21.254
  123.124.71.106
@@ -32647,7 +30701,6 @@
  123.125.21.125
  123.126.106.88
  123.126.3.30
-123.126.40.22
  123.126.40.65
  123.127.198.100
  123.127.222.120
@@ -32659,11 +30712,10 @@
  123.128.112.7
  123.128.118.106
  123.128.118.108
-123.128.124.161
  123.128.129.94
  123.128.136.48
-123.128.158.247
  123.128.168.94
+123.128.177.117
  123.128.180.98
  123.128.221.216
  123.128.226.140
@@ -32685,33 +30737,28 @@
  123.129.80.116
  123.129.80.5
  123.129.93.210
-123.129.93.255
  123.129.95.213
  123.129.99.24
  123.13.120.172
-123.13.120.82
+123.13.121.213
  123.13.14.133
  123.13.143.145
  123.13.154.144
-123.13.182.10
  123.13.182.16
+123.13.20.126
  123.13.210.89
  123.13.214.105
  123.13.22.7
-123.13.221.191
-123.13.246.33
  123.13.27.197
  123.13.28.245
  123.13.38.147
-123.13.55.114
+123.13.5.252
  123.13.58.191
  123.13.58.22
+123.13.62.209
  123.13.63.225
-123.13.63.38
-123.13.7.191
-123.13.77.62
  123.13.82.124
-123.13.96.80
+123.13.87.95
  123.13.98.186
  123.130.0.231
  123.130.112.6
@@ -32723,7 +30770,6 @@
  123.130.186.142
  123.130.19.225
  123.130.204.144
-123.130.21.39
  123.130.216.110
  123.130.216.147
  123.130.236.87
@@ -32773,7 +30819,6 @@
  123.133.84.163
  123.133.86.55
  123.134.16.254
-123.134.169.109
  123.134.243.223
  123.134.3.4
  123.134.48.181
@@ -32792,7 +30837,7 @@
  123.136.27.202
  123.136.29.99
  123.138.111.148
-123.138.18.35
+123.138.153.211
  123.139.156.3
  123.139.189.45
  123.139.243.36
@@ -32800,21 +30845,23 @@
  123.139.243.6
  123.139.243.8
  123.139.243.9
+123.139.249.238
  123.139.33.12
  123.139.56.148
  123.139.56.171
  123.139.56.238
+123.139.90.212
  123.14.104.224
  123.14.106.154
-123.14.107.144
+123.14.106.227
+123.14.107.18
  123.14.107.209
  123.14.119.103
-123.14.119.45
  123.14.144.22
  123.14.144.254
-123.14.145.73
+123.14.148.217
  123.14.148.99
-123.14.150.155
+123.14.152.111
  123.14.154.13
  123.14.166.183
  123.14.166.99
@@ -32822,33 +30869,31 @@
  123.14.192.204
  123.14.194.236
  123.14.196.168
-123.14.196.239
  123.14.197.213
  123.14.199.130
+123.14.201.167
+123.14.202.111
  123.14.202.209
-123.14.202.4
+123.14.204.185
+123.14.207.117
+123.14.208.86
  123.14.232.62
  123.14.248.111
-123.14.253.4
  123.14.254.237
+123.14.254.84
  123.14.32.140
-123.14.35.152
-123.14.43.49
-123.14.49.10
-123.14.49.3
-123.14.5.115
+123.14.49.46
  123.14.51.196
-123.14.69.151
-123.14.79.242
-123.14.80.144
+123.14.66.155
+123.14.71.194
  123.14.81.195
+123.14.83.43
  123.14.83.47
-123.14.86.138
-123.14.91.108
+123.14.84.143
+123.14.85.52
  123.14.91.113
  123.14.91.92
  123.14.94.100
-123.14.94.65
  123.140.114.196
  123.140.114.252
  123.140.250.171
@@ -32874,37 +30919,34 @@
  123.145.220.216
  123.145.220.218
  123.145.223.45
-123.145.85.157
  123.146.114.40
  123.146.120.121
  123.146.202.181
  123.146.23.149
  123.146.82.191
  123.146.89.90
-123.147.192.2
  123.147.193.133
  123.148.140.145
  123.149.205.4
  123.149.209.240
  123.149.209.254
  123.149.211.163
-123.149.211.61
+123.149.211.60
  123.149.211.96
  123.149.213.185
+123.149.214.82
  123.149.215.55
  123.149.22.119
  123.149.23.43
  123.149.23.45
  123.15.0.199
-123.15.58.214
+123.150.143.184
  123.150.244.226
  123.150.9.74
  123.150.94.82
  123.152.114.180
  123.152.237.96
  123.152.63.119
-123.153.1.189
-123.153.2.112
  123.153.58.110
  123.154.156.170
  123.154.170.135
@@ -32914,11 +30956,10 @@
  123.154.95.216
  123.155.117.9
  123.155.120.60
-123.155.154.204
  123.155.62.26
  123.156.201.205
  123.156.225.30
-123.156.91.21
+123.156.84.175
  123.157.102.179
  123.157.164.85
  123.157.165.103
@@ -32928,19 +30969,19 @@
  123.157.242.106
  123.158.10.237
  123.158.47.157
+123.159.11.126
  123.159.178.43
  123.159.204.162
  123.159.68.81
  123.159.70.163
  123.16.137.11
-123.16.147.173
  123.16.15.201
  123.16.188.2
  123.16.20.143
+123.16.224.160
  123.16.23.72
  123.16.32.175
-123.16.32.207
-123.16.63.111
+123.16.53.97
  123.16.66.215
  123.160.194.4
  123.160.246.90
@@ -32948,14 +30989,15 @@
  123.161.211.7
  123.161.24.178
  123.161.25.169
+123.161.25.172
  123.161.27.23
-123.162.15.165
  123.162.182.243
-123.162.203.41
+123.162.203.221
  123.162.83.141
  123.163.10.58
  123.163.11.251
  123.163.122.122
+123.163.135.228
  123.163.234.44
  123.163.237.119
  123.163.97.210
@@ -32968,33 +31010,30 @@
  123.17.119.85
  123.170.221.178
  123.170.98.122
-123.171.1.100
  123.171.1.101
-123.171.1.114
  123.171.1.138
  123.171.1.149
  123.171.1.156
-123.171.1.171
+123.171.1.169
  123.171.1.190
  123.171.1.194
  123.171.1.195
  123.171.1.201
-123.171.1.21
  123.171.1.249
-123.171.1.71
+123.171.1.42
+123.171.1.6
+123.171.1.66
  123.171.1.93
  123.171.42.11
  123.171.42.151
-123.171.42.156
  123.171.42.161
-123.171.42.167
+123.171.42.181
  123.171.42.189
+123.171.42.20
  123.171.42.219
-123.171.42.42
  123.171.42.45
  123.171.42.52
  123.171.42.58
-123.172.70.206
  123.172.77.19
  123.172.81.115
  123.173.8.115
@@ -33031,14 +31070,13 @@
  123.182.255.52
  123.182.98.191
  123.182.98.245
-123.183.116.147
+123.183.119.148
  123.183.120.196
  123.183.124.18
  123.183.125.7
  123.183.172.85
  123.183.19.209
  123.184.16.66
-123.185.201.152
  123.185.202.96
  123.185.234.7
  123.185.24.26
@@ -33048,11 +31086,9 @@
  123.188.222.154
  123.188.242.131
  123.188.248.58
-123.188.56.225
  123.188.6.32
  123.188.6.70
  123.189.127.111
-123.189.41.78
  123.189.6.51
  123.189.82.141
  123.189.85.131
@@ -33060,7 +31096,6 @@
  123.19.144.98
  123.19.209.128
  123.19.224.25
-123.19.233.42
  123.19.9.196
  123.190.162.88
  123.190.164.83
@@ -33072,7 +31107,6 @@
  123.191.58.0
  123.191.60.197
  123.191.67.232
-123.191.95.185
  123.192.101.163
  123.192.101.163bin.sh
  123.192.164.190
@@ -33135,6 +31169,7 @@
  123.195.184.77
  123.195.185.137
  123.195.197.10
+123.195.56.212
  123.195.57.235
  123.195.59.35
  123.195.60.186
@@ -33150,7 +31185,6 @@
  123.199.38.143
  123.20.0.254
  123.20.103.4
-123.20.117.233
  123.20.153.96
  123.20.18.216
  123.20.184.127
@@ -33158,12 +31192,15 @@
  123.20.243.52
  123.20.250.77
  123.20.3.152
+123.20.30.200
  123.20.35.207
  123.20.35.38
  123.20.44.21
  123.20.45.189
  123.20.45.212
+123.20.45.99
  123.20.50.245
+123.20.57.250
  123.20.80.95
  123.200.11.230
  123.200.117.29
@@ -33184,10 +31221,8 @@
  123.201.165.121
  123.201.178.131
  123.201.192.217
-123.201.20.30
  123.201.232.66
  123.201.24.38
-123.201.90.133
  123.202.194.67
  123.202.199.143
  123.202.216.69
@@ -33195,6 +31230,7 @@
  123.202.96.137
  123.202.96.193
  123.203.138.210
+123.203.149.167
  123.203.163.128
  123.203.176.207
  123.203.186.15
@@ -33226,13 +31262,8 @@
  123.206.104.110
  123.206.104.162
  123.206.111.27
-123.206.118.47
-123.206.14.58
-123.206.17.3
  123.206.174.21
  123.206.188.77
-123.206.190.82
-123.206.200.204
  123.206.216.65
  123.206.217.32
  123.206.219.211
@@ -33242,7 +31273,6 @@
  123.206.23.106
  123.206.23.158
  123.206.232.235
-123.206.255.17
  123.206.255.181
  123.206.26.133
  123.206.28.232
@@ -33250,24 +31280,18 @@
  123.206.31.61
  123.206.33.56
  123.206.34.88
-123.206.36.174
  123.206.38.253
  123.206.41.205
  123.206.41.68
-123.206.44.101
-123.206.45.16
  123.206.45.179
  123.206.46.250
  123.206.51.192
  123.206.53.230
  123.206.54.218
  123.206.54.78
-123.206.59.235
  123.206.62.112
  123.206.64.111
-123.206.64.77
  123.206.65.38
-123.206.69.58
  123.206.69.81
  123.206.7.96
  123.206.71.71
@@ -33275,10 +31299,7 @@
  123.206.81.59
  123.206.83.78
  123.206.87.233
-123.206.89.41
-123.206.9.241
  123.206.90.149
-123.206.90.226
  123.206.92.150
  123.206.95.243
  123.207.10.199
@@ -33289,16 +31310,15 @@
  123.207.121.114
  123.207.121.169
  123.207.123.143
+123.207.14.74
  123.207.140.131
  123.207.142.208
-123.207.142.31
  123.207.144.186
  123.207.145.66
  123.207.147.158
  123.207.153.52
  123.207.154.28
  123.207.155.210
-123.207.157.120
  123.207.16.80
  123.207.175.111
  123.207.186.215
@@ -33307,34 +31327,25 @@
  123.207.188.95
  123.207.19.105
  123.207.198.127
-123.207.2.120
-123.207.213.243
-123.207.218.163
  123.207.218.168
  123.207.22.39
  123.207.221.66
  123.207.230.234
  123.207.237.163
-123.207.240.133
  123.207.241.112
-123.207.241.223
  123.207.241.226
-123.207.249.161
  123.207.250.132
  123.207.34.86
  123.207.36.21
  123.207.41.17
-123.207.5.190
-123.207.52.61
  123.207.54.49
+123.207.58.160
  123.207.66.80
  123.207.74.24
  123.207.78.75
  123.207.78.83
-123.207.8.86
  123.207.92.183
  123.207.92.254
-123.207.94.252
  123.207.94.44
  123.207.95.121
  123.207.97.250
@@ -33345,29 +31356,24 @@
  123.209.93.122
  123.21.104.55
  123.21.106.221
-123.21.160.239
+123.21.189.180
  123.21.203.39
-123.21.223.179
-123.21.254.181
  123.21.6.135
  123.21.77.137
  123.21.94.185
  123.212.124.25
-123.213.225.130
  123.213.70.176
+123.214.230.178
  123.216.134.52
-123.22.212.99
  123.22.54.182
  123.220.251.190
  123.223.109.90
  123.223.131.228
  123.23.115.61
  123.23.207.89
-123.23.224.79
  123.23.45.117
  123.23.76.48
  123.231.12.97
-123.231.14.1
  123.231.141.58
  123.231.160.98
  123.231.165.18
@@ -33377,10 +31383,7 @@
  123.231.248.178
  123.231.46.110
  123.231.65.170
-123.231.95.93
-123.232.100.146
  123.232.100.2
-123.232.102.30
  123.232.104.253
  123.232.106.2
  123.232.170.69
@@ -33394,7 +31397,6 @@
  123.233.185.116
  123.233.236.91
  123.233.246.3
-123.233.36.152
  123.233.40.188
  123.234.116.110
  123.234.117.52
@@ -33402,6 +31404,8 @@
  123.234.124.66
  123.234.124.66bin.sh
  123.234.167.229
+123.234.173.211
+123.234.185.190
  123.234.191.51
  123.234.197.165
  123.234.222.245
@@ -33428,11 +31432,9 @@
  123.235.62.59
  123.235.81.223
  123.236.91.45
-123.24.164.158
-123.24.215.163
-123.24.221.68
  123.24.241.62
  123.24.48.58
+123.24.89.114
  123.240.103.89
  123.240.105.252
  123.240.120.249
@@ -33470,6 +31472,7 @@
  123.241.131.224
  123.241.140.20
  123.241.148.58
+123.241.160.188
  123.241.17.187
  123.241.172.97
  123.241.18.52
@@ -33481,7 +31484,9 @@
  123.241.26.7
  123.241.30.250
  123.241.32.184
+123.241.36.124
  123.241.52.24
+123.241.57.57
  123.241.64.244
  123.242.179.10
  123.247.13.183
@@ -33495,6 +31500,7 @@
  123.25.204.233
  123.25.209.69
  123.25.217.125
+123.25.243.126
  123.25.30.146
  123.252.161.249
  123.252.173.162
@@ -33513,8 +31519,6 @@
  123.28.155.113
  123.28.161.20
  123.28.4.243
-123.28.50.40
-123.29.0.114
  123.29.69.17
  123.3.82.79
  123.30.100.180
@@ -33537,7 +31541,6 @@
  123.30.191.186
  123.30.208.13
  123.30.211.6
-123.30.23.181
  123.30.235.108
  123.30.236.149
  123.30.237.51
@@ -33557,95 +31560,96 @@
  123.31.43.116
  123.31.43.238
  123.31.45.224
-123.31.45.35
  123.31.45.49
-123.4.162.149
-123.4.179.161
+123.4.148.165
+123.4.16.55
+123.4.162.238
+123.4.173.10
  123.4.179.206
-123.4.180.75
-123.4.194.18
-123.4.210.93
-123.4.22.95
-123.4.222.41
+123.4.180.32
+123.4.182.167
+123.4.198.87
+123.4.215.100
+123.4.218.197
+123.4.223.127
  123.4.225.0
  123.4.241.135
-123.4.241.196
  123.4.241.239
  123.4.241.5
  123.4.245.29
  123.4.249.127
+123.4.249.7
  123.4.25.87
  123.4.252.132
-123.4.32.129
+123.4.255.182
  123.4.32.21
-123.4.33.163
  123.4.44.244
  123.4.48.173
  123.4.48.201
+123.4.53.131
  123.4.54.219
  123.4.65.46
+123.4.65.75
+123.4.66.78
+123.4.68.5
+123.4.68.85
  123.4.69.229
  123.4.70.154
+123.4.70.41
+123.4.73.178
+123.4.73.249
  123.4.74.233
  123.4.75.134
-123.4.77.126
+123.4.76.120
  123.4.78.129
-123.4.79.211
  123.4.79.89
  123.4.80.140
-123.4.80.233
+123.4.81.31
  123.4.82.133
+123.4.82.50
  123.4.83.114
-123.4.84.233
+123.4.83.33
  123.4.85.69
-123.4.86.244
-123.4.86.78
  123.4.87.146
-123.4.87.8
-123.4.90.56
  123.4.91.169
  123.4.92.180
  123.4.92.227
-123.4.92.250
-123.4.93.227
  123.4.94.29
-123.4.95.107
-123.4.95.250
  123.48.157.61
-123.48.82.113
  123.49.41.129
  123.49.47.238
  123.49.47.241
-123.49.47.26
-123.49.52.134
  123.49.59.150
+123.5.116.101
+123.5.118.180
+123.5.118.200
  123.5.118.38
-123.5.130.246
-123.5.144.56
+123.5.137.216
+123.5.138.232
+123.5.142.184
+123.5.145.132
  123.5.146.231
  123.5.148.86
  123.5.149.197
-123.5.151.204
-123.5.151.231
-123.5.151.84
-123.5.176.247
-123.5.179.199
-123.5.180.226
-123.5.181.96
-123.5.182.53
+123.5.17.56
+123.5.181.164
  123.5.184.128
-123.5.185.120
-123.5.187.186
-123.5.187.210
+123.5.185.183
+123.5.185.250
+123.5.186.2
+123.5.187.228
  123.5.188.103
  123.5.188.112
  123.5.19.67
  123.5.19.83
  123.5.190.205
  123.5.190.232
-123.5.197.159
+123.5.194.138
+123.5.196.135
+123.5.197.166
+123.5.2.106
+123.5.22.175
  123.5.27.181
-123.5.52.160
  123.5.86.38
  123.5.9.134
  123.51.152.54
@@ -33657,45 +31661,40 @@
  123.52.43.85
  123.53.181.10
  123.53.181.8
-123.54.149.105
  123.54.198.3
  123.54.223.166
  123.54.224.101
  123.54.230.115
  123.54.232.89
-123.54.238.19
  123.54.251.225
-123.54.49.55
  123.54.5.197
  123.55.1.200
-123.55.102.154
-123.55.2.7
+123.55.114.65
  123.55.73.209
  123.56.12.117
  123.56.159.177
-123.56.160.202
  123.56.161.63
  123.56.170.214
  123.56.211.157
  123.56.211.174
+123.56.226.102
  123.56.228.50
  123.56.249.154
  123.56.41.101
  123.56.70.150
-123.56.83.239
  123.57.137.43
  123.57.150.34
  123.57.161.47
  123.57.175.137
+123.57.208.161
  123.57.215.49
+123.57.217.208
  123.57.244.92
-123.57.253.143
  123.57.61.38
+123.57.70.231
  123.57.72.201
-123.57.92.52
  123.58.109.42
  123.58.2.89
-123.58.33.18
  123.58.33.249
  123.58.38.143
  123.58.4.232
@@ -33705,18 +31704,18 @@
  123.58.7.223
  123.59.1.82
  123.59.1.83
+123.59.106.73
  123.59.116.47
  123.59.118.224
  123.59.118.251
  123.59.120.251
-123.59.120.36
  123.59.120.73
  123.59.147.250
-123.59.155.63
  123.59.182.184
  123.59.194.116
  123.59.194.242
  123.59.194.42
+123.59.194.83
  123.59.195.125
  123.59.195.173
  123.59.195.207
@@ -33728,7 +31727,6 @@
  123.59.210.240
  123.59.210.252
  123.59.213.10
-123.59.213.68
  123.59.229.55
  123.59.230.25
  123.59.230.66
@@ -33751,66 +31749,52 @@
  123.7.40.30
  123.7.63.49
  123.7.66.13
-123.8.16.172
  123.8.160.165
  123.8.160.240
-123.8.161.29
  123.8.173.107
  123.8.174.74
-123.8.187.169
+123.8.177.223
  123.8.189.118
  123.8.189.177
  123.8.190.0
  123.8.190.236
  123.8.190.7
-123.8.217.77
  123.8.23.87
-123.8.249.224
-123.8.250.239
-123.8.255.138
  123.8.26.78
  123.8.27.155
  123.8.29.250
-123.8.4.248
-123.8.45.17
-123.8.48.135
-123.8.48.87
+123.8.32.103
+123.8.40.32
  123.8.49.104
-123.8.49.251
-123.8.53.56
-123.8.71.82
-123.8.78.118
+123.8.53.19
  123.8.83.108
  123.8.87.39
  123.8.88.235
  123.8.95.238
-123.9.109.144
+123.9.100.132
  123.9.111.220
  123.9.177.30
  123.9.181.216
-123.9.193.201
-123.9.193.231
-123.9.194.246
-123.9.196.189
-123.9.197.81
-123.9.198.189
-123.9.199.69
-123.9.200.68
-123.9.200.84
+123.9.192.112
+123.9.192.230
+123.9.196.242
  123.9.204.224
  123.9.204.97
  123.9.206.1
-123.9.207.209
  123.9.207.43
  123.9.207.51
+123.9.218.74
+123.9.219.219
  123.9.223.200
+123.9.236.59
  123.9.237.34
  123.9.244.46
+123.9.245.242
  123.9.253.229
-123.9.52.95
-123.9.63.188
-123.9.8.148
+123.9.56.94
+123.9.87.151
  123.97.105.44
+123.97.110.69
  123.97.154.113
  123.97.227.59
  123.99.120.63
@@ -33863,7 +31847,6 @@
  124.107.165.170
  124.107.184.28
  124.107.185.3
-124.107.246.250
  124.107.57.216
  124.109.1.146
  124.109.1.207
@@ -33877,7 +31860,7 @@
  124.11.80.241
  124.11.81.147
  124.110.140.120
-124.111.52.102
+124.110.78.97
  124.111.53.213
  124.112.88.109
  124.112.88.196
@@ -33900,7 +31883,6 @@
  124.114.98.117
  124.114.98.182
  124.115.106.150
-124.115.138.24
  124.115.146.99
  124.115.16.13
  124.115.205.246
@@ -33918,12 +31900,11 @@
  124.117.194.22
  124.117.203.136
  124.117.248.14
-124.117.255.174
-124.118.129.5
  124.118.137.10
  124.118.141.87
  124.118.143.247
  124.118.16.178
+124.118.186.230
  124.118.9.75
  124.119.107.231
  124.119.138.104
@@ -33931,23 +31912,23 @@
  124.119.139.137
  124.119.139.173
  124.119.139.245
+124.119.57.214
  124.119.63.243
  124.119.9.34
-124.119.95.109
  124.120.142.124
  124.120.187.152
  124.120.86.73
-124.120.86.95
+124.120.88.198
  124.121.12.127
  124.121.176.122
-124.121.177.88
  124.121.19.206
  124.121.19.228
  124.121.19.230
  124.121.191.13
-124.121.191.36
  124.121.193.81
  124.121.20.209
+124.121.204.16
+124.121.237.20
  124.121.31.161
  124.121.99.154
  124.122.102.111
@@ -33956,8 +31937,6 @@
  124.122.120.17
  124.122.140.95
  124.122.161.227
-124.122.17.31
-124.122.193.201
  124.122.27.206
  124.122.68.185
  124.123.35.35
@@ -33967,29 +31946,26 @@
  124.124.197.72
  124.126.18.130
  124.126.18.162
+124.126.19.26
  124.126.229.98
-124.127.102.1
-124.127.118.179
  124.127.130.2
  124.127.133.114
  124.127.202.106
  124.127.202.30
-124.127.206.4
  124.127.35.42
  124.127.35.46
  124.127.38.154
  124.127.40.202
  124.127.40.206
  124.127.42.42
+124.127.43.239
  124.128.157.147
-124.128.158.37
  124.128.180.87
  124.128.251.118
  124.128.39.226
  124.128.57.133
  124.128.90.220
  124.128.94.206
-124.129.1.116
  124.129.117.61
  124.129.126.228
  124.129.133.172
@@ -34004,23 +31980,20 @@
  124.129.32.4
  124.129.59.57
  124.129.66.151
-124.129.70.124
-124.129.96.31
  124.13.10.200
-124.13.106.143
  124.13.117.221
  124.13.132.178
  124.13.133.216
+124.13.148.19
  124.13.201.68
  124.13.232.41
  124.13.236.244
  124.13.244.244
  124.13.248.147
  124.13.248.206
-124.130.105.107
+124.130.101.19
  124.130.116.34
  124.130.118.97
-124.130.148.2
  124.130.164.173
  124.130.164.91
  124.130.35.151
@@ -34053,6 +32026,7 @@
  124.131.155.17
  124.131.156.60
  124.131.158.220
+124.131.16.31
  124.131.20.113
  124.131.236.70
  124.131.239.254
@@ -34061,23 +32035,17 @@
  124.131.39.171
  124.131.51.163
  124.131.6.49
-124.131.9.5
  124.131.90.3
-124.131.91.50
  124.131.95.178
-124.132.114.22
  124.132.151.53
  124.132.207.254
  124.132.215.218
  124.133.125.163
  124.133.126.165
  124.133.14.229
-124.133.145.168
  124.133.164.199
  124.133.2.13
  124.133.2.16
-124.133.230.74
-124.133.252.109
  124.133.252.204
  124.133.253.178
  124.133.28.50
@@ -34104,14 +32072,12 @@
  124.138.115.131
  124.138.58.3
  124.141.1.24
-124.143.63.166
  124.146.40.99
  124.149.37.20
-124.149.61.126
-124.149.63.108
  124.150.132.74
  124.150.175.133
  124.150.236.51
+124.150.85.45
  124.152.108.35
  124.152.108.37
  124.152.109.123
@@ -34125,48 +32091,34 @@
  124.152.216.180
  124.152.47.154
  124.152.57.24
+124.152.73.189
  124.152.76.191
  124.153.136.175
-124.153.224.220
  124.156.102.254
  124.156.103.155
  124.156.104.250
  124.156.105.251
-124.156.105.47
-124.156.106.71
-124.156.107.252
-124.156.107.57
  124.156.108.171
  124.156.112.181
  124.156.114.53
  124.156.119.150
  124.156.120.214
-124.156.121.233
-124.156.132.183
-124.156.134.36
  124.156.136.225
  124.156.138.134
  124.156.139.91
  124.156.139.95
-124.156.140.217
-124.156.142.128
-124.156.142.189
  124.156.148.119
-124.156.148.157
  124.156.149.44
  124.156.150.174
  124.156.154.152
  124.156.154.51
  124.156.155.34
-124.156.159.125
  124.156.159.144
  124.156.159.211
  124.156.168.117
-124.156.173.13
  124.156.180.189
  124.156.183.23
  124.156.183.8
-124.156.184.135
  124.156.192.221
  124.156.192.62
  124.156.193.90
@@ -34174,7 +32126,6 @@
  124.156.196.246
  124.156.197.29
  124.156.198.92
-124.156.199.234
  124.156.200.106
  124.156.200.237
  124.156.200.92
@@ -34192,7 +32143,6 @@
  124.156.218.232
  124.156.218.50
  124.156.218.80
-124.156.223.16
  124.156.225.138
  124.156.225.159
  124.156.228.197
@@ -34316,7 +32266,6 @@
  124.156.98.132
  124.156.98.172
  124.156.99.101
-124.156.99.213
  124.158.105.58
  124.158.11.197
  124.158.12.202
@@ -34331,12 +32280,12 @@
  124.158.171.110
  124.158.175.2
  124.158.175.214
+124.158.177.171
  124.158.179.122
  124.158.179.13
  124.158.179.158
  124.158.179.222
  124.158.179.24
-124.158.179.27
  124.158.183.131
  124.158.88.56
  124.16.102.20
@@ -34353,12 +32302,14 @@
  124.160.83.138
  124.160.96.242
  124.160.96.249
+124.161.90.114
  124.162.17.73
  124.162.255.142
  124.163.131.196
  124.163.137.96
  124.163.144.140
  124.163.199.31
+124.163.21.243
  124.163.212.124
  124.163.231.73
  124.163.246.19
@@ -34367,7 +32318,7 @@
  124.163.39.179
  124.163.85.247
  124.163.96.71
-124.164.253.168
+124.164.199.79
  124.164.81.119
  124.164.88.250
  124.165.117.25
@@ -34379,22 +32330,22 @@
  124.165.50.166
  124.166.149.162
  124.166.254.253
+124.167.203.246
  124.167.226.214
  124.167.248.230
  124.167.80.181
+124.167.82.187
  124.167.82.48
  124.167.83.25
-124.167.9.89
  124.168.199.168
-124.170.100.48
  124.170.172.81
  124.172.189.59
  124.172.190.9
+124.172.220.143
  124.172.220.150
  124.172.232.49
  124.172.232.57
  124.172.248.38
-124.177.35.235
  124.187.111.160
  124.189.21.242
  124.190.217.63
@@ -34416,7 +32367,6 @@
  124.195.198.43
  124.195.208.56
  124.195.209.82
-124.195.223.106
  124.195.231.133
  124.195.254.146
  124.197.200.88
@@ -34446,6 +32396,7 @@
  124.205.137.86
  124.205.138.100
  124.205.138.98
+124.205.139.75
  124.205.183.42
  124.205.183.45
  124.205.194.34
@@ -34478,6 +32429,7 @@
  124.207.29.72
  124.207.55.171
  124.207.98.213
+124.209.176.55
  124.216.80.191
  124.217.230.195
  124.217.235.180
@@ -34498,7 +32450,6 @@
  124.219.176.139
  124.224.176.82
  124.224.206.18
-124.225.17.145
  124.225.27.179
  124.225.71.220
  124.226.141.202
@@ -34516,7 +32467,6 @@
  124.227.119.143
  124.227.204.81
  124.228.41.148
-124.228.84.64
  124.229.100.37
  124.229.160.53
  124.230.175.141
@@ -34535,8 +32485,6 @@
  124.234.128.89
  124.234.141.247
  124.234.141.254
-124.234.200.147
-124.234.220.222
  124.235.118.14
  124.235.171.114
  124.235.211.184
@@ -34561,16 +32509,14 @@
  124.236.98.164
  124.238.118.20
  124.238.180.212
-124.238.57.63
  124.238.58.228
  124.238.59.181
  124.238.61.80
  124.238.62.166
-124.238.63.154
  124.239.139.42
  124.239.139.43
+124.239.139.46
  124.239.148.63
-124.239.153.215
  124.239.168.74
  124.239.176.178
  124.239.216.233
@@ -34579,6 +32525,7 @@
  124.240.194.126
  124.240.198.66
  124.243.197.72
+124.244.12.242
  124.244.250.53
  124.244.50.67
  124.244.93.38
@@ -34595,6 +32542,7 @@
  124.248.173.55
  124.248.177.106
  124.248.177.243
+124.248.177.32
  124.248.182.139
  124.248.182.188
  124.248.182.205
@@ -34612,6 +32560,7 @@
  124.251.28.8
  124.253.115.248
  124.253.118.46
+124.253.121.158
  124.253.122.117
  124.253.122.27
  124.253.123.142
@@ -34620,7 +32569,6 @@
  124.253.132.53
  124.253.135.230
  124.253.142.188
-124.253.143.146
  124.253.151.210
  124.253.185.193
  124.253.195.93
@@ -34629,6 +32577,7 @@
  124.253.214.151
  124.253.224.190
  124.253.23.163
+124.253.233.96
  124.253.235.138
  124.253.251.51
  124.253.74.237
@@ -34645,13 +32594,13 @@
  124.29.236.163
  124.29.240.185
  124.29.242.190
+124.29.245.141
  124.30.3.20
  124.30.44.214
  124.31.204.116
  124.31.204.119
  124.31.244.89
  124.31.71.83
-124.35.95.140
  124.40.244.254
  124.40.248.202
  124.40.250.4
@@ -34684,9 +32633,7 @@
  124.43.111.38
  124.43.12.185
  124.43.129.107
-124.43.16.56
  124.43.177.160
-124.43.214.120
  124.43.78.87
  124.43.8.43
  124.43.9.184
@@ -34697,6 +32644,7 @@
  124.49.100.254
  124.49.142.15
  124.5.28.41
+124.5.55.197
  124.5.74.161
  124.5.74.161bin.sh
  124.5.92.20
@@ -34707,15 +32655,16 @@
  124.59.158.158
  124.6.1.218
  124.6.14.250
-124.6.140.66
  124.6.15.152
  124.6.153.84
  124.6.16.137
+124.60.73.157
  124.61.214.44
  124.64.127.31
  124.64.237.9
  124.64.40.246
  124.64.45.81
+124.64.46.255
  124.64.93.253
  124.64.99.79
  124.65.117.38
@@ -34726,8 +32675,8 @@
  124.65.144.38
  124.65.152.42
  124.65.181.218
-124.65.186.186
  124.65.189.126
+124.65.195.142
  124.65.195.94
  124.65.236.10
  124.65.244.6
@@ -34756,7 +32705,6 @@
  124.67.89.70
  124.67.89.74
  124.67.89.76
-124.7.132.100
  124.7.139.210
  124.70.12.238
  124.70.129.79
@@ -34774,7 +32722,6 @@
  124.70.20.107
  124.70.202.177
  124.70.209.10
-124.70.209.124
  124.70.215.115
  124.70.220.155
  124.70.223.134
@@ -34818,6 +32765,7 @@
  124.71.183.79
  124.71.184.99
  124.71.186.119
+124.71.190.229
  124.71.191.152
  124.71.40.253
  124.74.10.122
@@ -34859,7 +32807,6 @@
  124.89.2.42
  124.89.218.25
  124.89.220.36
-124.89.225.169
  124.89.32.15
  124.91.132.236
  124.91.133.220
@@ -34874,16 +32821,16 @@
  124.91.37.50
  124.91.7.83
  124.91.74.38
+124.91.93.193
  124.91.94.56
  124.92.127.102
+124.92.130.105
  124.92.165.41
  124.92.182.72
  124.93.12.28
-124.93.18.202
  124.93.201.59
  124.93.222.211
  124.94.132.76
-124.94.223.158
  124.94.249.74
  124.94.250.4
  124.94.251.253
@@ -34896,10 +32843,8 @@
  124.95.165.217
  124.95.17.91
  124.95.171.196
-124.95.171.213
-124.95.171.218
  124.95.171.230
-124.95.171.244
+124.95.19.32
  124.95.241.191
  124.95.3.170
  124.95.30.186
@@ -34912,149 +32857,150 @@
  1241.31cf4fdae.com
  124667.prohoster.biz
  124insta3gram.000webhostapp.com
+125.104.102.137
  125.104.102.195
  125.104.111.216
  125.104.202.20
  125.104.207.98
  125.104.211.208
  125.104.231.209
-125.104.240.191
  125.104.252.53
  125.105.106.101
-125.105.108.132
  125.105.66.87
  125.106.143.2
-125.106.226.52
-125.106.249.179
  125.106.99.97
-125.107.45.203
  125.108.98.236
  125.109.135.23
  125.110.106.45
  125.110.124.102
  125.111.138.59
+125.111.139.19
  125.111.146.110
  125.111.150.207
  125.111.206.254
  125.111.223.246
  125.112.179.4
-125.113.105.56
-125.113.112.4
-125.113.120.79
  125.113.158.215
  125.113.166.145
  125.113.221.83
-125.113.97.60
  125.114.121.116
  125.115.82.224
  125.115.82.80
  125.115.91.227
  125.116.196.39
  125.116.221.74
+125.117.171.211
  125.117.175.159
  125.118.161.94
  125.118.189.180
-125.118.43.138
-125.118.8.47
+125.118.8.117
  125.118.9.199
  125.119.209.230
  125.119.234.17
-125.119.40.24
-125.119.44.45
-125.119.47.111
+125.119.42.39
+125.119.43.24
+125.119.43.46
+125.119.44.183
+125.119.45.129
+125.119.45.219
+125.119.47.238
+125.119.47.47
+125.119.47.98
+125.119.64.229
  125.119.66.240
-125.119.67.154
-125.119.67.160
+125.119.67.146
+125.119.67.65
  125.120.149.124
-125.120.157.1
-125.120.161.229
-125.120.233.121
  125.120.237.87
  125.120.39.61
-125.121.132.52
-125.121.136.186
+125.121.128.63
+125.121.129.13
+125.121.129.170
+125.121.130.122
+125.121.131.49
+125.121.131.91
+125.121.133.255
+125.121.134.85
+125.121.135.112
+125.121.135.130
+125.121.135.59
+125.121.137.24
  125.121.137.43
-125.121.139.169
-125.121.171.90
-125.122.127.66
+125.121.168.20
+125.121.169.176
+125.121.170.71
+125.121.170.98
+125.121.171.248
+125.121.173.118
+125.121.173.159
+125.121.175.182
+125.121.56.31
  125.122.174.7
  125.122.92.153
-125.123.122.144
  125.123.125.135
  125.123.125.166
  125.123.130.232
+125.123.152.18
+125.123.232.179
  125.123.240.113
  125.123.241.146
  125.123.241.154
-125.123.241.247
  125.123.242.45
  125.123.245.122
  125.123.246.79
+125.123.64.6
  125.123.66.55
  125.123.67.34
+125.123.68.182
+125.123.69.151
+125.123.70.197
  125.123.70.215
  125.123.70.46
-125.123.71.200
  125.124.101.152
-125.124.114.169
  125.124.115.158
  125.124.117.226
  125.124.120.123
-125.124.143.182
-125.124.143.62
-125.124.147.117
  125.124.157.48
-125.124.162.104
-125.124.166.101
  125.124.179.36
-125.124.180.71
  125.124.193.203
-125.124.193.237
-125.124.206.129
  125.124.209.123
  125.124.215.222
  125.124.254.31
  125.124.30.186
  125.124.38.96
  125.124.44.135
-125.124.47.148
  125.124.54.29
-125.124.58.206
  125.124.59.64
-125.124.64.97
-125.124.69.65
  125.124.7.74
  125.124.70.104
-125.124.70.22
  125.124.72.157
-125.124.91.206
  125.124.97.15
  125.125.104.47
-125.125.106.17
  125.125.111.128
  125.125.116.242
-125.125.192.113
  125.125.54.116
  125.125.55.1
  125.125.71.69
-125.125.72.146
  125.125.97.40
  125.126.254.180
  125.126.84.109
  125.126.86.109
  125.128.139.210
  125.128.163.100
+125.128.205.146
  125.128.241.71
  125.129.129.233
-125.129.2.104
+125.129.201.23
  125.129.47.169
  125.129.96.244
  125.130.148.206
  125.130.180.140
+125.130.243.33
  125.130.41.143
  125.131.149.4
  125.131.190.162
  125.131.236.179
+125.131.93.42
  125.132.105.125
  125.132.106.221
  125.132.110.135
@@ -35063,7 +33009,6 @@
  125.132.225.217
  125.132.247.74
  125.132.249.88
-125.132.73.14
  125.132.73.28
  125.132.77.44
  125.133.15.117
@@ -35071,17 +33016,20 @@
  125.133.196.136
  125.133.221.251
  125.133.244.178
+125.133.244.199
  125.133.248.175
  125.133.92.3
  125.134.100.153
  125.134.100.165
  125.134.100.86
  125.134.106.178
+125.134.106.21
  125.134.106.75
  125.134.119.135
  125.134.119.5
  125.134.155.35
  125.134.168.91
+125.134.169.139
  125.134.189.159
  125.134.189.5
  125.134.204.80
@@ -35095,43 +33043,47 @@
  125.134.88.9
  125.134.90.72
  125.134.97.243
+125.135.116.175
  125.135.129.6
  125.135.130.173
  125.135.182.19
+125.135.191.170
  125.135.221.94
  125.135.25.233
  125.135.252.164
+125.135.44.75
  125.135.56.63
  125.135.75.66
+125.136.110.15
  125.136.119.38
  125.136.16.245
  125.136.162.34
  125.136.164.203
  125.136.165.75
  125.136.165.99
+125.136.177.108
  125.136.180.102
  125.136.180.167
  125.136.180.98
  125.136.186.20
  125.136.225.170
  125.136.242.87
-125.136.25.123
  125.136.25.70
  125.136.25.86
-125.136.25.89
  125.136.45.200
  125.136.59.162
  125.136.59.168
  125.136.68.110
  125.137.11.141
+125.137.178.69
  125.137.179.149
  125.137.184.159
  125.137.191.115
  125.137.191.215
  125.137.206.208
  125.137.227.71
-125.137.236.50
  125.137.49.82
+125.137.60.235
  125.138.116.227
  125.138.129.101
  125.138.191.58
@@ -35140,6 +33092,7 @@
  125.138.57.18
  125.138.64.28
  125.138.73.59
+125.138.77.79
  125.139.131.143
  125.139.236.180
  125.139.40.207
@@ -35148,6 +33101,7 @@
  125.139.69.98
  125.139.76.165
  125.139.8.30
+125.139.99.47
  125.140.14.201
  125.140.152.242
  125.140.159.29
@@ -35176,6 +33130,7 @@
  125.141.200.54
  125.141.200.55
  125.141.230.79
+125.141.31.218
  125.141.36.60
  125.141.56.231
  125.141.63.90
@@ -35190,23 +33145,25 @@
  125.142.187.225
  125.142.211.237
  125.142.213.135
+125.142.22.6
  125.142.220.123
  125.142.242.133
  125.142.31.33
+125.142.37.245
+125.143.222.109
  125.143.3.230
  125.143.66.146
  125.143.70.215
  125.16.134.218
  125.16.217.170
  125.160.17.200
-125.160.200.244
  125.160.207.65
  125.160.213.234
  125.160.215.232
-125.160.69.160
+125.160.52.77
+125.160.93.101
  125.161.131.26
  125.161.137.153
-125.161.196.186
  125.161.31.225
  125.161.37.95
  125.161.53.72
@@ -35215,21 +33172,19 @@
  125.162.48.84
  125.162.71.179
  125.162.76.131
+125.162.84.34
+125.163.113.189
  125.163.147.240
  125.163.160.229
  125.163.162.49
-125.163.39.59
+125.163.65.42
  125.164.103.187
-125.164.99.136
  125.165.112.192
-125.165.125.247
+125.165.124.251
  125.165.125.36
  125.165.142.37
  125.165.179.254
-125.165.63.165
-125.165.63.31
  125.166.105.176
-125.166.135.24
  125.166.139.248
  125.166.150.16
  125.166.175.186
@@ -35247,27 +33202,24 @@
  125.167.77.145
  125.168.145.66bin.sh
  125.168.226.251
+125.17.90.10
  125.177.210.168
  125.178.227.57
-125.179.61.164
  125.18.79.122
  125.180.198.137
  125.186.205.161
  125.186.94.76
  125.189.150.159
  125.19.14.250
-125.19.153.156
  125.19.16.194
  125.19.99.90
  125.191.113.212
  125.191.76.186
  125.193.52.163
-125.200.116.183
  125.206.32.22
  125.206.38.159bin.sh
  125.208.215.40
  125.208.228.19
-125.208.26.42
  125.208.8.240
  125.209.111.148
  125.209.115.186
@@ -35290,7 +33242,7 @@
  125.209.81.202
  125.209.82.78
  125.209.98.218
-125.21.227.181
+125.21.187.66
  125.21.43.82
  125.211.119.98
  125.211.162.183
@@ -35309,7 +33261,6 @@
  125.212.193.46
  125.212.193.96
  125.212.203.113
-125.212.207.205
  125.212.217.214
  125.212.219.42
  125.212.224.103
@@ -35321,7 +33272,7 @@
  125.212.241.131
  125.212.251.28
  125.212.251.75
-125.213.128.175
+125.213.128.52
  125.213.128.88
  125.213.150.219
  125.215.121.155
@@ -35331,7 +33282,6 @@
  125.22.246.216
  125.22.9.186
  125.220.159.9
-125.220.213.225
  125.224.102.163
  125.224.104.240
  125.224.167.7
@@ -35350,7 +33300,6 @@
  125.227.138.92
  125.227.138.93
  125.227.14.125
-125.227.14.43
  125.227.141.115
  125.227.141.116
  125.227.183.142
@@ -35379,8 +33328,6 @@
  125.227.251.91
  125.227.252.95
  125.227.255.79
-125.227.26.20
-125.227.26.21
  125.227.27.167
  125.227.35.202
  125.227.47.163
@@ -35395,10 +33342,11 @@
  125.227.71.78
  125.227.80.219
  125.227.94.131
+125.227.97.161
+125.227.99.136
  125.23.240.146
  125.230.216.229
  125.230.84.211
-125.231.105.126
  125.231.117.73
  125.231.130.153
  125.231.131.10
@@ -35418,7 +33366,7 @@
  125.24.111.214
  125.24.119.142
  125.24.119.30
-125.24.126.214
+125.24.121.47
  125.24.13.103
  125.24.132.141
  125.24.14.225
@@ -35428,23 +33376,27 @@
  125.24.190.14
  125.24.196.60
  125.24.199.184
-125.24.205.139
  125.24.225.237
+125.24.239.87
  125.24.52.66
  125.24.55.47
+125.24.66.3
  125.24.72.122
  125.24.81.192
  125.24.84.142
+125.24.85.73
  125.24.86.218
  125.24.87.54
  125.24.97.174
+125.243.59.133
  125.245.165.135
  125.247.164.220
  125.247.211.3
  125.248.150.84
  125.25.114.166
-125.25.119.30
+125.25.142.137
  125.25.142.151
+125.25.159.107
  125.25.164.101
  125.25.165.108
  125.25.165.22
@@ -35452,7 +33404,6 @@
  125.25.165.91
  125.25.165.93
  125.25.165.97
-125.25.181.247
  125.25.184.10
  125.25.184.78
  125.25.187.93
@@ -35480,7 +33431,6 @@
  125.25.89.68
  125.25.89.86
  125.25.89.9
-125.25.9.14
  125.251.116.4
  125.251.133.3
  125.251.136.194
@@ -35496,7 +33446,7 @@
  125.26.109.193
  125.26.112.164
  125.26.112.166
-125.26.116.212
+125.26.15.67
  125.26.15.68
  125.26.152.144
  125.26.155.150
@@ -35507,8 +33457,6 @@
  125.26.174.74
  125.26.175.78
  125.26.178.171
-125.26.178.188
-125.26.178.210
  125.26.178.215
  125.26.178.235
  125.26.179.135
@@ -35516,15 +33464,13 @@
  125.26.183.197
  125.26.183.223
  125.26.192.128
-125.26.197.208
  125.26.238.63
-125.26.251.233
  125.26.28.70
  125.26.30.62
-125.26.31.136
  125.26.6.61
  125.26.7.124
  125.26.7.83
+125.26.75.111
  125.26.81.146
  125.26.87.129
  125.26.96.234
@@ -35548,7 +33494,6 @@
  125.27.20.96
  125.27.235.139
  125.27.239.0
-125.27.242.58
  125.27.247.97
  125.27.251.124
  125.27.251.160
@@ -35560,16 +33505,21 @@
  125.27.251.57
  125.27.251.79
  125.27.251.87
+125.27.252.120
+125.27.27.91
  125.27.29.104
+125.27.30.46
  125.27.31.223
+125.27.45.193
  125.27.48.227
+125.27.55.72
+125.27.72.92
  125.30.23.216
  125.31.48.222
  125.32.164.105
  125.32.164.221
  125.32.165.107
  125.32.95.22
-125.33.253.10
  125.33.29.134
  125.33.39.99
  125.34.240.29
@@ -35590,20 +33540,22 @@
  125.39.11.18
  125.39.11.19
  125.39.11.27
-125.39.73.101
  125.40.0.102
  125.40.105.120
  125.40.106.237
+125.40.112.105
+125.40.112.26
  125.40.113.67
  125.40.113.83
  125.40.114.24
+125.40.114.36
  125.40.120.246
-125.40.122.33
-125.40.131.52
+125.40.131.170
  125.40.136.163
  125.40.144.75
+125.40.145.215
  125.40.146.58
-125.40.147.55
+125.40.147.203
  125.40.151.79
  125.40.152.100
  125.40.152.157
@@ -35623,147 +33575,138 @@
  125.40.199.248
  125.40.209.193
  125.40.22.177
+125.40.24.248
  125.40.27.178
  125.40.3.163
  125.40.3.39
+125.40.35.182
  125.40.72.221
+125.40.73.121
  125.40.73.159
  125.40.73.165
  125.40.73.220
  125.40.73.232
  125.40.75.47
  125.40.91.15
-125.41.0.43
-125.41.1.10
  125.41.1.44
-125.41.1.98
+125.41.10.88
+125.41.102.128
  125.41.103.163
  125.41.109.123
-125.41.11.150
-125.41.11.199
-125.41.112.236
+125.41.113.200
  125.41.115.202
+125.41.118.24
  125.41.119.40
  125.41.12.190
-125.41.12.84
  125.41.12.95
+125.41.13.238
+125.41.13.255
  125.41.13.34
  125.41.13.83
-125.41.13.94
  125.41.136.149
-125.41.137.71
  125.41.14.212
  125.41.141.102
-125.41.141.143
-125.41.142.50
  125.41.143.24
-125.41.15.171
+125.41.149.190
  125.41.15.39
+125.41.153.167
  125.41.164.124
-125.41.184.21
  125.41.185.65
-125.41.2.254
+125.41.196.250
  125.41.204.217
-125.41.204.43
  125.41.204.57
-125.41.205.227
-125.41.205.24
+125.41.205.186
  125.41.205.24bin.sh
+125.41.206.111
  125.41.206.46
  125.41.207.167
  125.41.208.44
-125.41.209.25
-125.41.210.155
  125.41.210.98
-125.41.211.66
+125.41.212.3
  125.41.214.215
-125.41.215.125
+125.41.214.229
+125.41.215.173
  125.41.215.56
-125.41.220.125
-125.41.225.83
  125.41.226.98
-125.41.227.141
-125.41.229.169
+125.41.228.106
+125.41.232.68
  125.41.244.69
-125.41.245.129
-125.41.246.183
  125.41.3.172
  125.41.4.116
  125.41.4.165
  125.41.4.166
-125.41.6.117
-125.41.6.69
-125.41.7.85
+125.41.5.122
+125.41.73.158
  125.41.74.216
-125.41.76.248
+125.41.74.93
  125.41.76.47
  125.41.76.75
  125.41.76.82
  125.41.77.39
  125.41.77.74
+125.41.78.110
+125.41.78.215
  125.41.79.194
  125.41.79.231
-125.41.79.239
  125.41.79.24
  125.41.80.120
  125.41.82.228
-125.41.85.245
-125.41.86.67
  125.41.89.52
+125.41.9.85
  125.41.97.114
-125.42.106.218
+125.41.97.37
+125.42.106.205
+125.42.107.11
  125.42.107.52
  125.42.120.140
-125.42.120.214
  125.42.120.7
  125.42.121.170
  125.42.121.24
  125.42.121.67
+125.42.122.240
  125.42.123.127
-125.42.123.250
+125.42.123.28
  125.42.124.207
-125.42.124.23
  125.42.124.86
  125.42.125.125
-125.42.125.199
+125.42.125.223
  125.42.126.16
-125.42.127.106
-125.42.13.108
+125.42.126.190
  125.42.155.57
  125.42.192.48
  125.42.200.123
  125.42.200.62
  125.42.200.84
-125.42.205.107
-125.42.205.123
+125.42.235.114
  125.42.235.57
  125.42.239.99
  125.42.24.171
-125.42.29.49
  125.42.4.7
  125.42.42.75
  125.42.81.197
  125.42.90.144
-125.42.97.156
-125.42.97.28
+125.42.97.255
+125.42.99.196
  125.43.0.4
+125.43.0.92
  125.43.10.118
  125.43.112.100
+125.43.112.110
  125.43.112.123
  125.43.112.248
  125.43.112.66
  125.43.112.92
  125.43.113.1
  125.43.113.5
+125.43.113.79
  125.43.117.247
+125.43.125.206
  125.43.127.154
-125.43.16.126
-125.43.162.72
+125.43.127.44
  125.43.166.187
  125.43.166.74
  125.43.18.240
  125.43.185.70
-125.43.20.220
  125.43.20.70
  125.43.206.209
  125.43.208.62
@@ -35772,258 +33715,241 @@
  125.43.216.141
  125.43.236.208
  125.43.237.22
-125.43.25.96
+125.43.24.85
+125.43.254.91
+125.43.26.187
  125.43.27.123
-125.43.27.181
-125.43.49.175
+125.43.32.150
+125.43.36.250
  125.43.50.22
-125.43.61.224
-125.43.62.12
  125.43.65.145
-125.43.67.174
-125.43.72.123
-125.43.72.148
+125.43.69.150
+125.43.72.214
+125.43.72.53
+125.43.72.70
  125.43.73.19
-125.43.73.247
-125.43.73.75
-125.43.74.84
+125.43.74.94
+125.43.75.13
+125.43.75.81
  125.43.8.125
-125.43.8.9
  125.43.81.125
-125.43.81.40
+125.43.82.205
  125.43.88.104
  125.43.88.240
+125.43.88.48
  125.43.89.112
+125.43.9.128
  125.43.9.212
-125.43.91.145
+125.43.91.173
  125.43.92.11
+125.43.92.26
+125.43.92.56
  125.43.93.150
  125.43.93.226
-125.43.93.26
-125.43.94.248
-125.43.95.16
-125.44.10.114
+125.44.10.179
  125.44.10.243
  125.44.11.168
-125.44.12.233
  125.44.15.168
  125.44.15.190
-125.44.159.38
+125.44.152.254
+125.44.159.64
  125.44.168.76
-125.44.171.181
  125.44.171.200
-125.44.172.107
  125.44.173.124
+125.44.174.154
+125.44.193.41
  125.44.194.40
  125.44.195.21
  125.44.198.19
  125.44.198.5
  125.44.198.67
  125.44.20.154
-125.44.20.46
-125.44.209.86
  125.44.21.199
-125.44.212.120
+125.44.21.31
  125.44.212.176
-125.44.212.38
+125.44.213.110
+125.44.213.239
+125.44.214.142
  125.44.214.77
+125.44.215.151
  125.44.215.86
  125.44.22.216
+125.44.22.75
  125.44.225.153
  125.44.23.13
  125.44.23.147
  125.44.23.158
-125.44.23.188
+125.44.23.159
  125.44.23.213
+125.44.23.27
  125.44.23.44
  125.44.23.71
  125.44.231.212
  125.44.234.107
-125.44.234.192
-125.44.234.244
-125.44.239.61
+125.44.246.147
+125.44.247.157
+125.44.248.166
  125.44.248.33
-125.44.250.113
  125.44.26.145
  125.44.29.110
  125.44.31.191
+125.44.31.195
  125.44.32.22
-125.44.32.69
-125.44.39.54
-125.44.45.166
-125.44.8.215
+125.44.45.169
+125.44.48.7
+125.44.70.145
  125.44.8.248
-125.44.9.92
-125.45.12.112
-125.45.12.117
-125.45.12.133
-125.45.120.245
+125.44.8.39
+125.44.9.239
  125.45.121.162
  125.45.125.107
-125.45.153.111
  125.45.16.17
-125.45.174.93
+125.45.176.114
  125.45.176.227
-125.45.177.49
  125.45.178.109
  125.45.178.114
  125.45.179.132
-125.45.18.132
+125.45.18.169
+125.45.185.106
  125.45.186.236bin.sh
-125.45.186.250
-125.45.186.90
-125.45.24.211
  125.45.25.13
  125.45.43.169
-125.45.48.251
-125.45.49.80
  125.45.52.71
-125.45.58.105
+125.45.58.233
  125.45.65.111
-125.45.65.204
  125.45.67.112bin.sh
  125.45.67.229
-125.45.67.39
+125.45.67.237
  125.45.76.10
+125.45.76.36
  125.45.77.157
  125.45.77.161
  125.45.77.212
  125.45.77.57
-125.45.78.114
  125.45.78.176
  125.45.78.24
  125.45.79.109
  125.45.79.125
-125.45.89.120
-125.45.89.194
+125.45.88.93
  125.45.99.1
  125.46.0.62
  125.46.11.67
  125.46.133.124
-125.46.138.10
+125.46.138.232
  125.46.160.136
  125.46.160.25
-125.46.162.140
+125.46.161.77
  125.46.163.117
-125.46.165.69
-125.46.166.56
+125.46.164.191
+125.46.166.121
  125.46.175.77
  125.46.182.172
  125.46.184.137
  125.46.184.47
-125.46.185.131
  125.46.185.184
  125.46.185.8
-125.46.188.135
-125.46.188.167
  125.46.189.114
-125.46.191.177
  125.46.197.126
  125.46.197.170
-125.46.197.184
  125.46.197.224
  125.46.200.104
-125.46.202.236
-125.46.203.242
  125.46.205.189
  125.46.207.185
+125.46.208.193
+125.46.218.126
  125.46.218.72
-125.46.220.172
+125.46.223.119
  125.46.223.239
-125.46.226.204
  125.46.23.166
-125.46.240.177
-125.46.242.59
+125.46.237.76
+125.46.242.232
  125.46.243.142
-125.46.243.189
-125.46.245.164
+125.46.243.150
+125.46.243.48
+125.46.245.249
  125.46.246.118
  125.46.246.204
  125.46.246.35
-125.46.247.173
+125.46.247.109
  125.46.32.112
  125.46.56.111
  125.46.70.46
  125.46.81.106
  125.46.97.138
+125.47.100.38
  125.47.101.99
  125.47.104.216
-125.47.109.227
  125.47.13.21
  125.47.13.244
-125.47.13.4
  125.47.177.238
-125.47.199.34
-125.47.20.109
+125.47.196.135
  125.47.20.22
  125.47.204.174
  125.47.205.115
-125.47.210.30
+125.47.206.162
  125.47.211.71
-125.47.22.103
+125.47.216.112
  125.47.223.8
  125.47.226.219
-125.47.230.43
-125.47.239.78
-125.47.241.119
+125.47.235.115
+125.47.242.111
+125.47.242.177
+125.47.243.18
  125.47.244.195
  125.47.244.48
-125.47.244.54
  125.47.245.184
  125.47.245.76
-125.47.246.69
  125.47.247.184
  125.47.247.242
-125.47.247.60
  125.47.248.164
-125.47.248.38
  125.47.250.204
-125.47.250.251
-125.47.250.29
+125.47.251.201
  125.47.251.254
-125.47.252.200
-125.47.253.153
-125.47.253.32
-125.47.253.56
  125.47.255.94
+125.47.36.122
+125.47.36.226
  125.47.46.116
-125.47.47.19
-125.47.48.103
+125.47.46.193
  125.47.48.113
  125.47.48.29
  125.47.49.147
+125.47.49.62
  125.47.51.161
  125.47.51.231
+125.47.53.199
+125.47.54.229
  125.47.54.47
  125.47.55.90
-125.47.6.182
  125.47.64.149
+125.47.64.54
  125.47.65.10
-125.47.66.192
+125.47.67.250
  125.47.68.66
  125.47.68.88
-125.47.69.31
  125.47.7.154
-125.47.73.144
+125.47.70.164
+125.47.71.28
  125.47.73.94
  125.47.74.206
  125.47.74.248
+125.47.75.216
  125.47.85.232
  125.47.85.43
+125.47.87.139
  125.47.89.14
  125.47.89.167
  125.47.90.241
  125.47.90.73
-125.47.99.158
  125.57.214.79
  125.57.237.51
+125.57.246.29
  125.58.101.67
  125.59.115.73
  125.59.117.154
  125.59.139.98
  125.59.145.224
+125.59.157.236
  125.59.162.141
-125.59.166.174
  125.59.178.169
  125.59.18.87
  125.59.190.15
@@ -36047,12 +33973,13 @@
  125.62.221.252
  125.62.222.37
  125.62.223.19
-125.63.116.106
  125.63.124.82
  125.63.68.2
+125.63.72.2
  125.64.103.2
  125.64.103.94
  125.64.103.96
+125.64.103.99
  125.64.154.34
  125.64.17.40
  125.64.193.35
@@ -36076,11 +34003,9 @@
  125.65.112.168
  125.65.112.226
  125.65.179.167
-125.65.42.38
  125.65.77.120
  125.65.79.156
  125.65.79.68
-125.65.79.72
  125.65.82.7
  125.65.86.164
  125.65.90.220
@@ -36090,18 +34015,16 @@
  125.66.106.2
  125.66.18.61
  125.66.2.157
+125.67.11.87
  125.67.17.152
  125.67.228.232
  125.67.239.82
  125.68.147.65
  125.68.172.20
  125.68.57.100
-125.69.161.113
  125.69.162.5
  125.69.67.94
-125.69.68.125
  125.69.78.131
-125.69.93.25
  125.70.0.248
  125.70.163.216
  125.70.18.12
@@ -36113,26 +34036,28 @@
  125.70.244.60
  125.70.244.61
  125.70.253.149
-125.70.27.208
  125.70.34.60
-125.70.35.128
  125.71.129.202
  125.71.178.65
  125.71.189.108
  125.71.206.3
  125.71.239.135
  125.71.239.216
+125.71.65.134
  125.72.100.110
  125.72.106.11
-125.72.106.134
+125.72.106.113
  125.72.106.148
-125.72.106.174
+125.72.106.149
+125.72.106.153
  125.72.106.180
  125.72.106.200
-125.72.106.227
-125.72.106.31
-125.72.106.8
-125.72.106.95
+125.72.106.215
+125.72.106.251
+125.72.106.27
+125.72.106.28
+125.72.106.69
+125.72.106.72
  125.72.148.242
  125.72.17.5
  125.72.209.78
@@ -36141,33 +34066,21 @@
  125.73.127.74
  125.73.131.213
  125.73.40.12
-125.73.56.96
-125.74.193.194
  125.74.193.55
-125.74.196.136
  125.74.197.100
  125.74.27.185
-125.74.27.34
  125.74.27.36
  125.74.28.28
  125.74.55.161
-125.74.8.209
-125.74.95.195
  125.75.114.6
  125.75.120.12
  125.75.126.70
  125.75.128.12
  125.75.128.231
-125.75.151.142
  125.75.8.68
-125.76.162.101
-125.76.162.127
  125.76.162.40
  125.76.174.78
-125.76.177.143
  125.76.177.145
-125.76.177.150
-125.76.177.151
  125.76.228.32
  125.76.230.10
  125.76.235.86
@@ -36187,6 +34100,7 @@
  125.78.32.186
  125.78.49.82
  125.79.120.28
+125.82.180.214
  125.82.180.62
  125.82.181.116
  125.82.181.221
@@ -36197,11 +34111,12 @@
  125.82.182.82
  125.84.217.97
  125.86.184.228
+125.86.185.192
+125.86.58.250
  125.87.80.131
  125.87.89.209
  125.88.169.233
  125.88.17.30
-125.88.183.107
  125.88.254.178
  125.89.148.99
  125.89.160.151
@@ -36210,30 +34125,24 @@
  125.89.53.156
  125.89.53.16
  125.89.53.206
+125.89.53.241
  125.89.53.56
  125.89.54.120
  125.89.55.10
-125.89.55.230
  125.89.55.28
  125.90.107.175
  125.90.175.66
  125.91.106.231
  125.91.109.200
-125.91.109.232
  125.91.111.197
-125.91.124.125
  125.91.126.92
-125.91.126.97
-125.91.127.21
  125.91.17.134
  125.91.17.216
-125.91.32.157
  125.91.32.168
-125.91.32.65
  125.91.34.13
  125.91.35.134
+125.91.35.36
  125.92.104.175
-125.92.105.84
  125.93.149.146
  125.93.183.178
  125.93.50.50
@@ -36251,26 +34160,23 @@
  125.94.149.76
  125.94.149.88
  125.94.219.188
-125.94.44.112
  125.94.68.118
-125.94.75.169
  125.99.100.193
  125.99.113.150
  125.99.120.166
  125.99.147.56
-125.99.159.82
  125.99.159.93
  125.99.173.162
  125.99.242.202
  125.99.46.49
  125.99.46.50
-125.99.50.242
  125.99.60.171
  125.99.61.162
  125.99.72.27
  125478526j.weebly.com
  125fbe8e-c223-43d2-974f-9e171c4e36c0.htmlcomponentservice.com
  126.0.21.51
+126.0.63.53
  126.10.146.226
  126.103.172.79
  126.114.197.202
@@ -36294,10 +34200,8 @@
  126.7.188.15
  126.7.192.30
  126.7.29.45
-126.72.75.196
  126.76.249.185
  126.90.59.69
-126.93.32.199
  126bus.cn
  126f7b50-bfe6-4649-a622-42cb62c2a8d5.htmlcomponentservice.com
  126mailbox-verification.duckdns.org
@@ -36305,7 +34209,6 @@
  12774.psdzy.com
  128.0.129.192
  128.0.131.195
-128.1.132.221
  128.1.145.153
  128.1.223.242
  128.1.223.243
@@ -36313,13 +34216,13 @@
  128.1.223.245
  128.1.223.246
  128.1.49.156
+128.1.49.31
  128.1.91.202
  128.1.91.203
  128.1.91.204
  128.1.91.205
  128.1.91.206
  128.106.107.174
-128.106.117.200
  128.106.120.55
  128.106.121.19
  128.106.129.103
@@ -36327,7 +34230,7 @@
  128.106.133.31
  128.106.135.14
  128.106.136.18
-128.106.195.126
+128.106.150.252
  128.106.2.250
  128.106.239.48
  128.106.72.17
@@ -36335,7 +34238,6 @@
  128.106.98.60
  128.116.133.92
  128.116.134.251
-128.116.147.172
  128.116.154.5
  128.116.169.210
  128.116.178.181
@@ -36344,9 +34246,9 @@
  128.121.17.148
  128.121.17.154
  128.121.17.155
+128.127.106.37
  128.127.15.27
  128.127.90.34
-128.134.178.1
  128.134.185.145
  128.136.166.141
  128.136.35.30
@@ -36358,7 +34260,6 @@
  128.14.133.98
  128.14.134.134
  128.14.134.170
-128.14.135.138
  128.14.137.178
  128.14.137.179
  128.14.137.180
@@ -36379,7 +34280,6 @@
  128.14.156.186
  128.14.16.156
  128.14.16.233
-128.14.16.93
  128.14.178.94
  128.14.181.134
  128.14.209.154
@@ -36412,14 +34312,6 @@
  128.14.209.252
  128.14.209.253
  128.14.209.254
-128.14.226.107
-128.14.226.159
-128.14.226.199
-128.14.227.177
-128.14.229.158
-128.14.230.200
-128.14.236.157
-128.14.236.201
  128.14.3.110
  128.14.3.84
  128.14.30.178
@@ -36442,7 +34334,6 @@
  128.177.105.224
  128.177.105.225
  128.187.32.223
-128.189.181.158
  128.197.128.198
  128.197.128.205
  128.197.128.210
@@ -36459,22 +34350,17 @@
  128.199.1.140
  128.199.10.155
  128.199.101.113
+128.199.101.63
  128.199.102.155
-128.199.102.178
  128.199.102.242
  128.199.103.206
  128.199.103.239
  128.199.104.83
-128.199.105.148
  128.199.105.239
-128.199.106.134
-128.199.106.169
  128.199.106.210
  128.199.106.232
  128.199.107.111
-128.199.107.114
  128.199.107.44
-128.199.108.159
  128.199.108.203
  128.199.109.108
  128.199.109.128
@@ -36487,24 +34373,18 @@
  128.199.111.21
  128.199.111.241
  128.199.112.211
-128.199.112.231
  128.199.112.240
-128.199.112.60
  128.199.113.233
  128.199.114.104
  128.199.114.138
  128.199.115.160
  128.199.115.175
-128.199.115.2
  128.199.117.43
  128.199.118.165
-128.199.118.170
-128.199.118.27
  128.199.118.61
  128.199.12.141
  128.199.12.76
  128.199.120.77
-128.199.121.132
  128.199.121.192
  128.199.121.32
  128.199.121.88
@@ -36513,6 +34393,7 @@
  128.199.123.139
  128.199.123.153
  128.199.123.170
+128.199.123.216
  128.199.124.197
  128.199.124.216
  128.199.124.53
@@ -36532,34 +34413,26 @@
  128.199.130.202
  128.199.131.150
  128.199.132.6
-128.199.133.143
  128.199.133.186
  128.199.133.235
  128.199.133.47
  128.199.133.8
  128.199.134.45
-128.199.135.243
  128.199.136.255
  128.199.136.56
-128.199.137.252
  128.199.137.80
-128.199.138.31
  128.199.138.67
  128.199.139.137
  128.199.139.195
-128.199.139.25
-128.199.14.135
  128.199.14.36
  128.199.141.181
  128.199.141.33
  128.199.142.0
  128.199.142.203
  128.199.142.33
-128.199.142.90
  128.199.143.157
  128.199.143.19
  128.199.143.208
-128.199.143.47
  128.199.144.113
  128.199.144.192
  128.199.144.54
@@ -36569,7 +34442,6 @@
  128.199.146.137
  128.199.147.39
  128.199.149.111
-128.199.149.164
  128.199.15.205
  128.199.15.85
  128.199.151.123
@@ -36577,20 +34449,16 @@
  128.199.151.198
  128.199.152.154
  128.199.154.189
-128.199.155.218
  128.199.156.159
  128.199.156.25
  128.199.157.160
  128.199.158.12
  128.199.159.148
-128.199.159.160
  128.199.16.4
  128.199.16.6
-128.199.160.168
  128.199.160.192
  128.199.161.209
  128.199.162.108
-128.199.162.2
  128.199.163.94
  128.199.164.132
  128.199.164.234
@@ -36602,28 +34470,21 @@
  128.199.168.32
  128.199.168.35
  128.199.17.119
-128.199.170.159
  128.199.170.33
-128.199.171.166
  128.199.171.183
  128.199.171.206
  128.199.171.224
-128.199.172.73
  128.199.173.129
  128.199.173.208
  128.199.173.97
  128.199.174.204
-128.199.175.242
-128.199.177.16
  128.199.177.176
-128.199.177.224
  128.199.177.249
  128.199.178.41
  128.199.179.164
  128.199.179.171
  128.199.180.123
  128.199.180.162
-128.199.180.63
  128.199.180.80
  128.199.182.19
  128.199.183.34
@@ -36633,7 +34494,6 @@
  128.199.186.230
  128.199.186.46
  128.199.187.177
-128.199.187.58
  128.199.19.101
  128.199.19.153
  128.199.19.31
@@ -36641,17 +34501,15 @@
  128.199.190.137
  128.199.190.189
  128.199.191.106
+128.199.191.160
  128.199.192.135
  128.199.193.174
  128.199.193.246
  128.199.196.171
-128.199.197.161
  128.199.197.21
-128.199.197.228
  128.199.197.238
  128.199.198.79
  128.199.199.117
-128.199.199.217
  128.199.2.33
  128.199.20.64
  128.199.200.209
@@ -36661,10 +34519,8 @@
  128.199.202.206
  128.199.204.164
  128.199.204.219
-128.199.204.26
  128.199.206.90
  128.199.207.33
-128.199.208.171
  128.199.208.93
  128.199.209.227
  128.199.209.250
@@ -36675,13 +34531,11 @@
  128.199.21.93
  128.199.210.101
  128.199.210.138
-128.199.211.2
  128.199.211.68
  128.199.212.15
  128.199.212.194
  128.199.212.225
  128.199.213.157
-128.199.213.24
  128.199.213.25
  128.199.213.59
  128.199.214.19
@@ -36689,23 +34543,15 @@
  128.199.216.36
  128.199.216.53
  128.199.218.126
-128.199.218.137
  128.199.219.186
-128.199.219.218
-128.199.219.68
  128.199.22.36
-128.199.220.197
-128.199.220.207
-128.199.220.232
  128.199.223.178
  128.199.223.233
  128.199.224.178
-128.199.224.215
  128.199.224.249
  128.199.225.104
  128.199.226.44
  128.199.226.68
-128.199.227.11
  128.199.227.155
  128.199.227.214
  128.199.227.236
@@ -36713,25 +34559,20 @@
  128.199.229.21
  128.199.23.243
  128.199.23.244
-128.199.23.6
  128.199.231.162
  128.199.232.56
  128.199.232.6
  128.199.233.87
  128.199.234.115
  128.199.235.176
-128.199.235.18
  128.199.237.216
  128.199.239.204
-128.199.239.52
  128.199.239.9
  128.199.24.29
-128.199.24.59
  128.199.240.120
  128.199.240.146
  128.199.241.165
  128.199.241.212
-128.199.241.231
  128.199.243.226
  128.199.244.148
  128.199.244.150
@@ -36748,14 +34589,12 @@
  128.199.25.120
  128.199.25.138
  128.199.25.223
-128.199.250.201
+128.199.250.167
  128.199.250.33
  128.199.251.65
-128.199.253.146
  128.199.253.208
  128.199.254.107
  128.199.254.188
-128.199.254.21
  128.199.26.250
  128.199.26.69
  128.199.26.97
@@ -36773,7 +34612,6 @@
  128.199.31.95
  128.199.32.51
  128.199.32.61
-128.199.33.116
  128.199.33.46
  128.199.33.65
  128.199.36.29
@@ -36786,7 +34624,6 @@
  128.199.42.220
  128.199.43.133
  128.199.43.76
-128.199.44.102
  128.199.44.20
  128.199.44.240
  128.199.45.10
@@ -36817,14 +34654,12 @@
  128.199.68.220
  128.199.68.43
  128.199.68.49
-128.199.69.169
  128.199.7.196
  128.199.70.58
  128.199.73.213
  128.199.73.94
  128.199.74.117
  128.199.75.179
-128.199.76.37
  128.199.78.225
  128.199.78.229
  128.199.79.158
@@ -36833,29 +34668,24 @@
  128.199.81.66
  128.199.81.8
  128.199.81.84
-128.199.82.232
  128.199.84.132
-128.199.84.143
  128.199.84.195
  128.199.84.201
  128.199.84.210
+128.199.84.243
  128.199.84.251
  128.199.85.193
-128.199.85.251
  128.199.87.107
  128.199.87.167
-128.199.87.229
  128.199.88.23
+128.199.89.47
  128.199.89.67
  128.199.9.24
-128.199.91.233
-128.199.91.26
  128.199.92.162
  128.199.92.187
  128.199.93.236
  128.199.93.4
  128.199.94.186
-128.199.95.161
  128.199.95.60
  128.199.95.74
  128.199.96.1
@@ -36863,10 +34693,10 @@
  128.199.98.15
  128.199.99.158
  128.199.99.204
+128.2.32.145
  128.201.100.84
  128.201.101.28
  128.201.103.24
-128.201.103.33
  128.201.161.2
  128.201.51.244
  128.201.52.38
@@ -36884,7 +34714,6 @@
  128.201.67.237
  128.201.67.254
  128.201.77.94
-128.201.78.220
  128.201.80.97
  128.201.81.152
  128.201.81.156
@@ -36906,21 +34735,16 @@
  128.65.178.186
  128.69.148.193
  128.69.244.122
-128.69.51.27
  128.70.38.184
  128.71.236.131
  128.71.92.84
-128.72.105.179
  128.72.107.45
  128.72.62.167
-128.72.85.127
  128.73.141.124
  128.75.151.66
  128.75.209.162
  128.78.170.162
  128.90.107.121
-128.90.108.19
-128.90.108.229
  128.90.132.188
  128.90.133.22
  128.90.144.241
@@ -36941,11 +34765,13 @@
  129.121.177.81
  129.122.16.156
  129.122.200.233
+129.126.100.158
  129.126.102.10
  129.126.102.14
  129.126.103.114
  129.126.146.118
  129.126.200.81
+129.126.207.90
  129.126.221.21
  129.126.221.37
  129.126.243.113
@@ -36961,54 +34787,39 @@
  129.144.181.142
  129.144.183.81
  129.144.9.93
-129.146.127.242
  129.146.159.205
-129.146.181.4
-129.146.19.86
-129.146.223.140
+129.146.171.142
+129.146.191.139
  129.146.246.249
  129.146.250.102
-129.146.253.35
-129.146.46.134
  129.146.67.85
-129.146.75.180
  129.146.81.43
-129.146.99.134
  129.150.194.230
  129.152.141.71
  129.152.43.85
  129.154.67.65
  129.158.74.141
-129.16.20.70
  129.170.192.41
  129.178.182.133
  129.178.182.140
  129.178.182.141
  129.178.182.142
-129.204.105.130
-129.204.109.127
  129.204.110.114
+129.204.113.101
  129.204.115.121
-129.204.115.246
  129.204.116.250
-129.204.119.35
  129.204.12.9
  129.204.121.113
  129.204.121.245
-129.204.122.242
  129.204.125.231
  129.204.125.51
-129.204.125.74
  129.204.129.170
  129.204.131.146
  129.204.131.218
  129.204.132.123
  129.204.137.145
  129.204.140.186
-129.204.147.84
  129.204.148.56
-129.204.15.121
-129.204.152.222
  129.204.152.84
  129.204.16.2
  129.204.166.67
@@ -37016,43 +34827,28 @@
  129.204.175.119
  129.204.175.252
  129.204.177.133
-129.204.177.177
-129.204.177.32
  129.204.177.7
  129.204.181.118
-129.204.181.186
  129.204.186.151
-129.204.188.93
  129.204.188.97
-129.204.19.9
  129.204.197.29
-129.204.2.157
  129.204.203.218
-129.204.205.125
-129.204.205.231
-129.204.207.104
  129.204.208.231
  129.204.208.34
  129.204.210.108
  129.204.212.52
  129.204.223.236
  129.204.225.65
-129.204.226.105
  129.204.23.5
  129.204.230.227
-129.204.231.225
  129.204.233.194
  129.204.233.214
-129.204.235.54
  129.204.236.136
  129.204.237.30
  129.204.238.250
-129.204.24.99
-129.204.240.42
  129.204.245.6
  129.204.249.11
  129.204.249.36
-129.204.250.129
  129.204.253.6
  129.204.253.70
  129.204.254.71
@@ -37061,22 +34857,12 @@
  129.204.35.171
  129.204.42.59
  129.204.45.118
-129.204.45.88
  129.204.46.170
  129.204.50.108
-129.204.63.100
  129.204.64.9
-129.204.65.174
-129.204.66.45
  129.204.67.133
-129.204.7.21
-129.204.74.158
-129.204.77.124
  129.204.77.136
-129.204.80.188
  129.204.82.4
-129.204.83.3
-129.204.84.252
  129.204.88.17
  129.204.88.29
  129.205.112.253
@@ -37087,19 +34873,15 @@
  129.205.201.27
  129.205.210.90
  129.205.244.158
-129.205.26.106
  129.205.98.54
+129.208.184.47
  129.208.5.132
-129.211.1.12
+129.208.7.22
  129.211.10.111
-129.211.104.34
  129.211.108.143
-129.211.108.201
  129.211.108.207
-129.211.108.240
  129.211.124.120
  129.211.124.29
-129.211.125.208
  129.211.13.226
  129.211.135.174
  129.211.137.239
@@ -37108,16 +34890,13 @@
  129.211.140.239
  129.211.146.50
  129.211.148.226
-129.211.157.209
  129.211.16.182
  129.211.162.33
  129.211.165.102
  129.211.167.92
  129.211.169.241
-129.211.17.22
  129.211.171.24
  129.211.171.31
-129.211.173.127
  129.211.174.145
  129.211.18.180
  129.211.18.65
@@ -37128,41 +34907,24 @@
  129.211.23.74
  129.211.24.104
  129.211.25.66
-129.211.26.131
  129.211.28.16
-129.211.29.98
  129.211.31.238
-129.211.32.25
  129.211.33.43
-129.211.33.59
  129.211.36.4
  129.211.37.91
-129.211.38.207
-129.211.41.234
  129.211.42.153
-129.211.45.88
  129.211.49.17
  129.211.49.227
  129.211.49.44
  129.211.50.239
-129.211.51.65
-129.211.52.192
  129.211.54.120
  129.211.54.147
-129.211.55.22
-129.211.60.17
-129.211.62.131
-129.211.62.194
-129.211.70.33
  129.211.72.48
  129.211.74.252
  129.211.75.184
  129.211.77.44
  129.211.79.208
-129.211.82.237
  129.211.84.224
-129.211.85.214
-129.211.86.49
  129.211.87.88
  129.211.91.114
  129.211.91.170
@@ -37171,82 +34933,62 @@
  129.211.94.145
  129.211.94.30
  129.211.99.254
-129.213.100.138
-129.213.101.176
  129.213.107.56
  129.213.117.100
  129.213.118.224
  129.213.145.100
-129.213.148.12
  129.213.15.42
  129.213.161.37
  129.213.162.120
  129.213.21.173
  129.213.213.245
  129.213.27.184
-129.213.38.54
  129.213.40.181
  129.213.92.194
  129.22.143.241
  129.226.112.181
  129.226.114.97
  129.226.119.176
-129.226.119.26
  129.226.12.233
  129.226.120.69
  129.226.123.203
-129.226.123.66
  129.226.125.10
-129.226.133.168
  129.226.134.112
  129.226.134.163
  129.226.138.179
  129.226.141.113
  129.226.149.146
-129.226.15.25
  129.226.150.37
  129.226.154.67
  129.226.156.168
-129.226.161.114
-129.226.164.96
+129.226.162.5
  129.226.165.250
  129.226.166.126
  129.226.168.238
  129.226.170.181
-129.226.174.139
  129.226.174.26
  129.226.174.44
  129.226.174.57
-129.226.176.5
-129.226.178.235
-129.226.179.187
  129.226.179.238
  129.226.181.229
  129.226.190.18
  129.226.190.74
-129.226.225.56
-129.226.225.93
  129.226.227.72
  129.226.51.112
-129.226.59.53
  129.226.61.157
-129.226.63.184
  129.226.63.78
  129.226.64.39
  129.226.64.51
-129.226.67.78
  129.226.67.92
  129.226.68.116
  129.226.68.181
  129.226.73.12
-129.226.73.26
-129.226.74.89
  129.226.77.119
  129.227.129.162
+129.227.129.163
  129.227.129.189
  129.227.129.190
  129.227.224.42
-129.227.61.248
  129.227.66.203
  129.227.96.174
  129.232.208.51
@@ -37255,67 +34997,46 @@
  129.232.208.60
  129.232.220.11
  129.28.103.85
-129.28.106.99
  129.28.12.228
  129.28.14.23
  129.28.146.168
  129.28.150.119
-129.28.150.45
  129.28.154.240
  129.28.155.113
-129.28.155.116
  129.28.157.148
  129.28.157.199
  129.28.157.97
-129.28.158.174
-129.28.158.43
  129.28.160.215
  129.28.160.44
-129.28.162.128
-129.28.162.182
  129.28.162.79
  129.28.163.90
  129.28.164.83
-129.28.165.178
  129.28.165.182
  129.28.165.213
-129.28.166.212
  129.28.169.194
  129.28.172.220
-129.28.173.105
  129.28.175.24
  129.28.176.171
  129.28.177.29
-129.28.178.138
  129.28.180.105
  129.28.180.174
-129.28.183.142
  129.28.183.62
  129.28.185.107
  129.28.185.31
-129.28.186.100
  129.28.187.11
  129.28.187.169
-129.28.188.115
  129.28.189.173
  129.28.192.71
-129.28.193.24
  129.28.195.191
-129.28.196.215
  129.28.198.205
-129.28.198.22
  129.28.199.85
-129.28.202.3
  129.28.203.122
-129.28.29.57
-129.28.30.54
+129.28.39.234
  129.28.41.113
-129.28.51.226
-129.28.58.6
-129.28.77.179
  129.28.78.8
  129.28.92.64
  129.46.232.65
+129.56.23.25
  129.66.12.135
  129.89.57.73
  129.89.65.82
@@ -37362,8 +35083,6 @@
  13.124.8.244
  13.124.80.3
  13.124.88.142
-13.125.110.137
-13.125.147.162
  13.125.149.103
  13.125.188.128
  13.125.202.178
@@ -37371,7 +35090,6 @@
  13.125.222.163
  13.125.223.31
  13.125.67.125
-13.125.71.42
  13.125.97.172
  13.126.144.12
  13.126.171.143
@@ -37379,7 +35097,6 @@
  13.126.218.145
  13.126.226.37
  13.126.242.142
-13.126.242.61
  13.126.249.215
  13.126.4.56
  13.126.42.55
@@ -37391,10 +35108,8 @@
  13.127.130.18
  13.127.153.0
  13.127.197.47
-13.127.249.46
  13.127.46.147
  13.127.47.128
-13.127.53.79
  13.127.8.76
  13.127.94.172
  13.209.0.41
@@ -37404,17 +35119,15 @@
  13.209.42.7
  13.209.48.72
  13.209.66.255
-13.209.68.125
  13.209.81.230
  13.210.137.84
  13.210.163.7
  13.210.77.106
  13.211.142.164
  13.211.157.229
-13.211.218.195
+13.212.103.132
  13.212.141.79
  13.212.166.0
-13.212.174.125
  13.212.182.30
  13.212.217.254
  13.212.4.107
@@ -37432,8 +35145,8 @@
  13.228.73.238
  13.228.91.206
  13.229.105.154
+13.229.105.27
  13.229.116.148
-13.229.122.127
  13.229.125.117
  13.229.126.201
  13.229.128.192
@@ -37444,7 +35157,6 @@
  13.229.135.249
  13.229.140.55
  13.229.150.245
-13.229.152.141
  13.229.154.1
  13.229.203.245
  13.229.227.15
@@ -37475,7 +35187,6 @@
  13.231.8.224
  13.231.85.192
  13.232.135.122
-13.232.156.59
  13.232.176.217
  13.232.178.180
  13.232.187.242
@@ -37484,21 +35195,16 @@
  13.232.198.16
  13.232.223.53
  13.232.238.113
-13.232.36.201
+13.232.245.17
  13.232.38.92
  13.232.39.95
  13.232.94.246
-13.233.1.145
  13.233.100.124
  13.233.104.103
-13.233.112.7
  13.233.14.14
-13.233.162.12
  13.233.176.4
  13.233.182.207
-13.233.207.215
  13.233.212.14
-13.233.227.201
  13.233.232.239
  13.233.255.195
  13.233.71.109
@@ -37506,11 +35212,9 @@
  13.233.95.178
  13.233.96.250
  13.233.97.177
-13.234.112.70
+13.234.112.103
  13.234.150.155
-13.234.66.85
  13.235.16.58
-13.235.229.84
  13.235.244.150
  13.235.246.134
  13.235.76.20
@@ -37529,7 +35233,6 @@
  13.239.131.117
  13.239.85.6
  13.244.108.188
-13.244.205.78
  13.244.63.90
  13.244.70.8
  13.245.27.50
@@ -37537,7 +35240,6 @@
  13.245.4.171
  13.250.106.56
  13.250.111.70
-13.250.113.244
  13.250.115.44
  13.250.116.243
  13.250.122.226
@@ -37571,11 +35273,9 @@
  13.49.240.49
  13.49.72.71
  13.49.77.201
-13.52.14.169
  13.52.179.116
  13.52.180.142
  13.52.185.39
-13.52.255.236
  13.52.60.115
  13.53.123.164
  13.53.125.154
@@ -37606,18 +35306,15 @@
  13.56.79.45
  13.57.129.84
  13.57.192.196
+13.57.207.98
  13.57.209.136
  13.57.224.254
  13.57.246.225
-13.57.29.229
-13.57.30.180
  13.57.51.100
  13.57.96.35
-13.58.107.178
  13.58.13.145
  13.58.134.165
  13.58.152.3
-13.58.16.201
  13.58.196.60
  13.58.198.168
  13.58.2.126
@@ -37632,7 +35329,6 @@
  13.58.80.103
  13.58.80.180
  13.58.91.93
-13.59.1.166
  13.59.11.163
  13.59.111.77
  13.59.13.13
@@ -37665,7 +35361,6 @@
  13.64.175.205
  13.64.183.197
  13.64.199.181
-13.64.65.0
  13.64.77.225
  13.64.91.141
  13.64.93.82
@@ -37675,19 +35370,18 @@
  13.65.190.193
  13.65.196.73
  13.65.201.35
-13.65.212.200
  13.65.215.106
  13.65.246.58
  13.65.42.254
  13.65.80.18
  13.66.128.69
  13.66.131.233
+13.66.139.130
  13.66.139.162
  13.66.139.2
  13.66.156.59
  13.66.165.164
  13.66.167.123
-13.66.169.218
  13.66.171.162
  13.66.18.39
  13.66.185.182
@@ -37700,28 +35394,21 @@
  13.66.248.91
  13.66.252.220
  13.66.255.220
-13.66.27.121
  13.66.28.137
  13.66.33.220
  13.66.39.248
  13.66.52.131
  13.67.106.218
-13.67.115.32
-13.67.143.51
  13.67.183.8
  13.67.209.202
  13.67.236.36
-13.67.32.172
  13.67.46.188
  13.67.54.103
  13.67.55.30
  13.67.63.143
  13.68.131.171
  13.68.153.168
-13.68.171.41
  13.68.174.21
-13.68.186.224
-13.68.193.165
  13.68.216.44
  13.68.225.165
  13.68.229.202
@@ -37732,7 +35419,6 @@
  13.69.153.185
  13.69.193.213
  13.69.50.143
-13.70.1.39
  13.70.199.80
  13.70.201.27
  13.70.40.14
@@ -37751,31 +35437,28 @@
  13.72.80.225
  13.72.81.198
  13.72.82.82
+13.72.84.236
  13.72.84.84
  13.73.1.69
  13.73.16.128
  13.73.16.134
  13.73.23.121
  13.74.157.69
-13.74.165.56
  13.74.170.74
+13.74.252.234
  13.74.46.65
  13.74.96.14
  13.75.111.42
-13.75.115.100
  13.75.125.174
  13.75.147.201
  13.75.193.159
  13.75.194.31
  13.75.220.102
-13.76.119.203
  13.76.131.243
  13.76.132.123
-13.76.132.127
  13.76.142.50
  13.76.165.246
  13.76.172.247
-13.76.185.44
  13.76.190.188
  13.76.191.188
  13.76.196.239
@@ -37785,22 +35468,17 @@
  13.76.242.146
  13.76.246.8
  13.76.248.36
-13.76.252.236
  13.76.34.31
  13.76.46.136
-13.76.5.76
  13.77.150.217
  13.77.151.83
  13.77.158.3
-13.77.174.134
  13.77.204.247
  13.77.205.248
  13.77.207.76
  13.77.70.66
  13.77.74.124
  13.78.126.105
-13.78.172.148
-13.78.183.53
  13.78.189.149
  13.78.190.103
  13.78.227.187
@@ -37815,8 +35493,6 @@
  13.78.8.216
  13.78.97.141
  13.78.99.2
-13.79.129.171
-13.79.192.98
  13.79.242.9
  13.79.28.233
  13.79.4.40
@@ -37827,17 +35503,14 @@
  13.80.29.111
  13.80.46.69
  13.80.67.162
-13.80.69.199
  13.81.101.205
-13.81.200.14
  13.81.223.168
-13.81.24.185
  13.81.251.173
  13.81.6.165
  13.82.0.119
+13.82.0.138
  13.82.102.20
  13.82.105.123
-13.82.127.108
  13.82.146.132
  13.82.149.166
  13.82.175.242
@@ -37869,7 +35542,6 @@
  13.84.231.75
  13.84.38.205
  13.84.48.87
-13.84.51.165
  13.84.52.63
  13.85.152.27
  13.85.18.13
@@ -37878,7 +35550,6 @@
  13.88.177.3
  13.88.18.211
  13.88.18.49
-13.88.191.250
  13.88.224.151
  13.88.249.148
  13.88.30.112
@@ -37896,7 +35567,6 @@
  13.90.26.128
  13.90.38.253
  13.90.56.153
-13.90.56.67
  13.90.73.131
  13.90.79.91
  13.90.98.107
@@ -37915,7 +35585,6 @@
  13.92.184.128
  13.92.232.23
  13.92.27.130
-13.92.27.6
  13.92.32.34
  13.92.38.69
  13.92.82.166
@@ -37934,15 +35603,12 @@
  13.94.200.157
  13.94.245.44
  13.94.39.125
-13.94.56.225
  13.94.58.212
-13.94.61.208
  13.95.130.2
  130.0.232.227
  130.0.234.16
  130.0.25.194
  130.105.197.224
-130.105.223.118
  130.105.68.165
  130.111.10.87
  130.149.80.199
@@ -37954,9 +35620,8 @@
  130.180.66.97
  130.180.99.26
  130.185.109.17
-130.185.122.238
  130.185.122.52
-130.185.123.140
+130.185.153.133
  130.185.155.10
  130.185.155.34
  130.185.155.74
@@ -37964,6 +35629,7 @@
  130.185.156.146
  130.185.156.170
  130.185.159.177
+130.185.159.209
  130.185.193.160
  130.185.206.248
  130.185.215.254
@@ -37971,12 +35637,13 @@
  130.185.250.76
  130.185.75.178
  130.185.76.142
-130.185.76.147
  130.185.77.105
+130.185.85.106
  130.185.86.194
  130.185.90.151
  130.193.112.146
  130.193.12.61
+130.193.123.162
  130.193.45.165
  130.204.105.4
  130.204.152.24
@@ -38009,6 +35676,7 @@
  130.214.215.187
  130.225.244.90
  130.226.140.102
+130.226.140.106
  130.226.169.137
  130.25.0.109
  130.25.138.14
@@ -38023,8 +35691,6 @@
  130.61.118.231
  130.61.130.207
  130.61.184.220
-130.61.217.222
-130.61.224.236
  130.61.227.100
  130.61.233.14
  130.61.234.182
@@ -38035,7 +35701,6 @@
  130.61.38.29
  130.61.47.75
  130.61.58.147
-130.61.59.163
  130.61.62.31
  130.61.83.191
  130.61.90.106
@@ -38044,6 +35709,7 @@
  130.61.98.193
  130.68.124.40
  130.76.24.29
+130.83.239.98
  130.zuole.ml
  1300345608.jclecardinal.com
  130163-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -38062,7 +35728,6 @@
  131.0.246.158
  131.0.87.225
  131.0.89.202
-131.1.217.143
  131.100.234.14
  131.100.234.20
  131.100.239.122
@@ -38072,6 +35737,7 @@
  131.100.239.94
  131.100.247.137
  131.100.38.226
+131.100.47.32
  131.100.47.47
  131.100.47.53
  131.100.47.64
@@ -38085,15 +35751,10 @@
  131.108.16.16
  131.108.16.173
  131.108.16.205
-131.108.166.146
  131.108.166.216
  131.108.166.217
  131.108.166.218
  131.108.202.247
-131.108.227.192
-131.108.244.216
-131.108.244.27
-131.108.244.29
  131.108.255.217
  131.108.32.147
  131.108.45.72
@@ -38109,10 +35770,10 @@
  131.147.17.149
  131.148.13.222
  131.148.180.189
-131.150.173.232
  131.150.232.218
  131.153.18.84
  131.153.22.134
+131.153.38.126
  131.153.49.120
  131.153.49.72
  131.161.10.200
@@ -38128,7 +35789,6 @@
  131.161.13.23
  131.161.189.120
  131.161.205.117
-131.161.219.242
  131.161.224.94
  131.161.238.14
  131.161.253.190
@@ -38157,6 +35817,7 @@
  131.191.37.85
  131.191.64.96
  131.191.93.39
+131.191.95.24
  131.191.98.172
  131.193.220.15
  131.196.130.188
@@ -38165,28 +35826,29 @@
  131.196.141.100
  131.196.141.102
  131.196.141.104
-131.196.141.114
  131.196.141.121
  131.196.141.128
+131.196.141.139
  131.196.141.146
+131.196.141.154
  131.196.141.157
  131.196.141.161
+131.196.141.162
  131.196.141.165
  131.196.141.193
-131.196.141.195
  131.196.141.208
-131.196.141.221
  131.196.141.229
  131.196.141.23
-131.196.141.251
  131.196.141.30
  131.196.141.37
  131.196.141.5
  131.196.141.50
  131.196.141.55
+131.196.141.90
  131.196.141.93
-131.196.143.102
+131.196.141.98
  131.196.143.12
+131.196.143.138
  131.196.143.141
  131.196.143.159
  131.196.143.164
@@ -38194,13 +35856,12 @@
  131.196.143.20
  131.196.143.200
  131.196.143.206
-131.196.143.222
-131.196.143.225
  131.196.143.251
  131.196.143.3
-131.196.143.38
+131.196.143.50
  131.196.143.56
  131.196.143.59
+131.196.143.67
  131.196.143.69
  131.196.143.79
  131.196.143.88
@@ -38208,11 +35869,12 @@
  131.196.143.92
  131.196.169.137
  131.196.219.90
+131.196.243.147
  131.196.4.226
  131.196.44.136
  131.196.87.198
+131.196.93.111
  131.196.93.123
-131.196.93.251
  131.213.42.193
  131.221.137.125
  131.221.174.82
@@ -38231,41 +35893,38 @@
  131.221.217.152
  131.221.217.174
  131.221.217.176
-131.221.32.138
+131.221.232.209
+131.221.31.36
  131.221.32.41
  131.221.32.54
  131.221.32.56
-131.221.64.152
  131.221.75.167
-131.221.80.129
  131.253.18.11
  131.253.18.12
  131.255.108.6
  131.255.152.2
  131.255.228.119
-131.255.237.118
  131.255.32.45
  131.255.32.69
  131.255.4.96
  131.255.82.36
  131.72.139.150
  131.72.205.98
+13123431043915105561.002.sh.cn
  131425.000webhostapp.com
  1314520bet.com
  1314huadian.com
  131987449-518886016577583774.preview.editmysite.com
  132.145.115.204
+132.145.125.81
  132.145.127.44
  132.145.128.157
+132.145.150.210
  132.145.159.137
  132.145.159.39
-132.145.160.32
-132.145.165.79
  132.145.165.9
-132.145.223.21
  132.145.236.84
  132.145.242.131
-132.145.242.238
  132.145.94.79
  132.147.104.183
  132.147.77.13
@@ -38274,7 +35933,7 @@
  132.148.144.101
  132.148.153.156
  132.148.154.8
-132.148.165.216
+132.148.159.44
  132.148.166.149
  132.148.166.225
  132.148.17.38
@@ -38295,46 +35954,38 @@
  132.232.11.218
  132.232.110.111
  132.232.112.96
-132.232.119.203
+132.232.115.212
  132.232.12.42
-132.232.12.62
  132.232.120.145
  132.232.129.118
  132.232.132.103
  132.232.137.62
-132.232.139.120
  132.232.14.157
  132.232.143.211
-132.232.154.58
  132.232.16.135
  132.232.161.51
-132.232.172.159
  132.232.18.219
  132.232.19.205
-132.232.19.28
  132.232.2.100
  132.232.2.249
  132.232.21.175
  132.232.21.19
  132.232.21.67
-132.232.21.72
  132.232.222.117
-132.232.23.135
  132.232.230.220
  132.232.237.213
-132.232.245.79
  132.232.25.117
  132.232.26.124
  132.232.26.42
+132.232.27.49
  132.232.29.131
  132.232.3.234
-132.232.30.87
  132.232.31.157
  132.232.31.9
  132.232.32.203
  132.232.32.228
  132.232.33.160
-132.232.35.108
+132.232.33.65
  132.232.35.199
  132.232.35.65
  132.232.37.219
@@ -38349,12 +36000,10 @@
  132.232.47.59
  132.232.48.82
  132.232.49.143
-132.232.5.125
-132.232.50.202
-132.232.51.177
  132.232.53.85
  132.232.55.173
  132.232.57.135
+132.232.58.9
  132.232.59.247
  132.232.59.78
  132.232.6.207
@@ -38363,23 +36012,16 @@
  132.232.63.73
  132.232.66.128
  132.232.66.227
-132.232.66.238
  132.232.67.52
  132.232.68.138
-132.232.68.26
  132.232.73.139
  132.232.75.27
-132.232.76.77
  132.232.77.85
-132.232.79.135
  132.232.79.28
  132.232.8.58
  132.232.80.87
-132.232.81.26
-132.232.82.22
  132.232.82.237
  132.232.82.240
-132.232.82.99
  132.232.84.44
  132.232.87.247
  132.232.88.59
@@ -38413,8 +36055,6 @@
  133.11.215.39
  133.123.144.201
  133.125.38.222
-133.130.102.148
-133.130.111.34
  133.130.114.137
  133.130.115.132
  133.130.118.55
@@ -38422,24 +36062,19 @@
  133.130.124.174
  133.130.127.253
  133.130.223.178
-133.130.89.210
  133.130.89.23
  133.130.91.37
  133.130.97.166
  133.167.100.251
  133.167.105.83
-133.167.115.76
  133.167.95.209
  133.175.138.221
-133.18.170.44
  133.205.164.92
  133.208.23.52
  133.232.70.132
  133.232.87.13
-133.242.142.175
  133.242.155.85
  133.242.231.162
-133.242.52.96
  133.27.228.131
  1336062-dot-oaao-274308.uc.r.appspot.com
  133627593977191-dot-wetransfer-auth-file-343.appspot.com
@@ -38449,11 +36084,9 @@
  134.0.119.176
  134.0.63.134
  134.101.130.46
-134.101.220.48
+134.101.179.140
  134.102.228.73
  134.119.179.146
-134.119.191.66
-134.119.192.229
  134.119.220.165
  134.119.220.174
  134.119.222.18
@@ -38463,7 +36096,6 @@
  134.122.102.131
  134.122.103.82
  134.122.105.123
-134.122.106.228
  134.122.107.126
  134.122.109.134
  134.122.109.176
@@ -38472,47 +36104,33 @@
  134.122.112.132
  134.122.113.222
  134.122.115.140
-134.122.117.231
  134.122.118.167
  134.122.118.230
-134.122.120.74
  134.122.121.4
  134.122.121.74
  134.122.121.86
  134.122.123.121
  134.122.124.193
  134.122.125.200
-134.122.125.255
-134.122.126.86
  134.122.130.216
  134.122.130.93
-134.122.134.228
-134.122.134.253
  134.122.135.150
  134.122.145.149
-134.122.15.250
  134.122.17.13
  134.122.17.146
  134.122.18.5
  134.122.18.94
  134.122.20.79
  134.122.21.243
-134.122.22.127
  134.122.22.241
-134.122.22.75
  134.122.25.101
  134.122.25.139
  134.122.25.32
  134.122.26.164
-134.122.28.208
  134.122.31.107
  134.122.32.207
  134.122.36.93
-134.122.37.103
-134.122.37.175
  134.122.37.214
-134.122.37.32
-134.122.37.52
  134.122.39.133
  134.122.39.157
  134.122.39.159
@@ -38537,28 +36155,23 @@
  134.122.46.176
  134.122.47.28
  134.122.47.5
-134.122.48.238
  134.122.49.69
  134.122.49.74
  134.122.49.77
  134.122.50.162
  134.122.50.29
-134.122.50.93
  134.122.54.200
  134.122.54.241
  134.122.56.204
  134.122.56.235
  134.122.56.44
  134.122.57.181
-134.122.58.6
  134.122.58.7
  134.122.58.96
  134.122.59.35
  134.122.62.253
-134.122.64.201
  134.122.64.219
  134.122.66.154
-134.122.66.188
  134.122.69.140
  134.122.69.7
  134.122.72.221
@@ -38566,15 +36179,12 @@
  134.122.76.222
  134.122.78.80
  134.122.78.89
-134.122.79.233
  134.122.81.145
  134.122.87.117
-134.122.88.78
  134.122.88.92
  134.122.90.113
  134.122.90.115
  134.122.90.158
-134.122.91.66
  134.122.94.113
  134.122.95.167
  134.122.95.213
@@ -38582,17 +36192,11 @@
  134.122.96.41
  134.17.179.26
  134.17.24.239
-134.17.26.116
  134.17.94.100
-134.17.94.158
-134.17.94.214
-134.17.94.55
-134.17.94.69
-134.175.102.133
  134.175.104.215
  134.175.111.215
+134.175.121.227
  134.175.121.80
-134.175.126.72
  134.175.129.204
  134.175.129.58
  134.175.13.243
@@ -38606,19 +36210,13 @@
  134.175.154.93
  134.175.157.55
  134.175.161.251
-134.175.166.167
  134.175.17.32
-134.175.178.118
  134.175.18.153
  134.175.19.39
-134.175.19.71
-134.175.190.226
-134.175.191.248
  134.175.196.241
  134.175.197.170
  134.175.199.232
  134.175.2.7
-134.175.20.81
  134.175.204.223
  134.175.217.161
  134.175.217.254
@@ -38627,50 +36225,37 @@
  134.175.223.22
  134.175.224.105
  134.175.227.112
-134.175.227.125
  134.175.230.209
  134.175.236.132
  134.175.236.187
  134.175.245.162
-134.175.249.204
  134.175.25.48
  134.175.28.62
  134.175.29.140
  134.175.37.159
  134.175.38.75
-134.175.44.216
  134.175.46.166
-134.175.5.70
-134.175.54.154
-134.175.55.10
  134.175.55.42
  134.175.59.225
  134.175.64.60
  134.175.70.122
  134.175.83.105
  134.175.89.31
-134.175.92.245
  134.175.99.237
  134.19.132.53
  134.19.146.45
-134.19.177.40
  134.19.231.200
  134.19.254.2
-134.19.32.170
+134.19.59.147
  134.208.10.111
-134.209.100.103
-134.209.100.26
-134.209.102.196
-134.209.102.44
-134.209.102.93
  134.209.103.101
-134.209.104.117
  134.209.104.197
  134.209.106.190
  134.209.107.228
  134.209.111.46
  134.209.117.155
  134.209.120.3
+134.209.123.101
  134.209.124.108
  134.209.127.180
  134.209.127.52
@@ -38687,7 +36272,6 @@
  134.209.151.96
  134.209.152.48
  134.209.152.76
-134.209.154.78
  134.209.155.213
  134.209.157.134
  134.209.157.198
@@ -38701,35 +36285,27 @@
  134.209.166.15
  134.209.168.41
  134.209.169.202
+134.209.17.181
  134.209.172.2
  134.209.172.77
  134.209.174.161
-134.209.176.160
-134.209.176.220
-134.209.178.109
-134.209.178.175
  134.209.179.57
  134.209.18.129
-134.209.18.220
  134.209.181.254
  134.209.181.49
  134.209.181.85
-134.209.182.198
  134.209.185.191
+134.209.186.229
  134.209.186.72
  134.209.187.158
-134.209.188.197
  134.209.188.212
  134.209.189.223
  134.209.193.65
-134.209.194.208
-134.209.194.217
  134.209.194.227
  134.209.194.46
  134.209.195.0
  134.209.196.169
  134.209.196.235
-134.209.197.218
  134.209.199.105
  134.209.20.107
  134.209.200.146
@@ -38761,20 +36337,15 @@
  134.209.234.99
  134.209.236.154
  134.209.236.191
+134.209.237.253
  134.209.238.164
-134.209.24.143
  134.209.24.86
  134.209.241.217
  134.209.241.227
  134.209.241.87
  134.209.248.200
-134.209.250.37
-134.209.250.9
-134.209.252.17
  134.209.254.186
-134.209.26.15
  134.209.27.151
-134.209.28.70
  134.209.30.141
  134.209.32.178
  134.209.35.77
@@ -38788,7 +36359,6 @@
  134.209.52.246
  134.209.53.17
  134.209.57.3
-134.209.58.167
  134.209.63.140
  134.209.64.111
  134.209.64.118
@@ -38797,16 +36367,15 @@
  134.209.64.28
  134.209.64.36
  134.209.64.47
-134.209.65.23
-134.209.65.43
  134.209.67.45
+134.209.67.87
  134.209.7.179
  134.209.71.190
-134.209.71.245
  134.209.72.119
  134.209.72.136
  134.209.72.145
  134.209.72.178
+134.209.72.81
  134.209.72.90
  134.209.72.96
  134.209.72.97
@@ -38817,10 +36386,10 @@
  134.209.76.144
  134.209.76.96
  134.209.77.3
+134.209.78.186
  134.209.79.119
  134.209.79.150
  134.209.79.59
-134.209.80.136
  134.209.81.15
  134.209.81.185
  134.209.82.166
@@ -38830,9 +36399,7 @@
  134.209.85.106
  134.209.85.26
  134.209.87.245
-134.209.87.9
  134.209.88.15
-134.209.90.139
  134.209.92.128
  134.209.92.152
  134.209.92.203
@@ -38842,7 +36409,6 @@
  134.209.96.131
  134.209.97.113
  134.209.97.199
-134.209.97.42
  134.209.98.180
  134.213.138.127
  134.213.138.137
@@ -38853,12 +36419,9 @@
  134.236.0.167
  134.236.0.29
  134.236.1.22
-134.236.1.26
  134.236.1.85
  134.236.1.88
-134.236.116.137
  134.236.116.6
-134.236.118.116
  134.236.16.234
  134.236.2.213
  134.236.2.230
@@ -38869,6 +36432,7 @@
  134.236.243.28
  134.236.247.106
  134.236.255.6
+134.236.53.21
  134.249.106.21
  134.249.114.27
  134.249.116.78
@@ -38887,13 +36451,13 @@
  134.249.54.230
  134.249.55.71
  134.249.96.246
+134.255.219.195
  134.255.225.20
  134.255.231.72
  134.255.232.155
-134.255.234.21
-134.255.235.192
  134.255.243.132
  134.255.254.39
+134.3.110.201
  134.3.227.7
  134.3.9.30
  134.35.112.50
@@ -38904,12 +36468,14 @@
  134.35.158.32
  134.35.19.136
  134.35.206.219
+134.35.211.157
  134.35.218.193
  134.35.233.27
+134.35.242.184
  134.35.247.31
-134.35.28.223
  134.35.42.31
  134.35.44.190
+134.35.51.176
  134.35.58.209
  134.35.58.229
  134.35.62.153
@@ -38920,6 +36486,7 @@
  134.41.140.61
  134.41.157.150
  134.41.173.238
+134.41.79.228
  134.6.65.22
  134.73.176.157
  134.73.199.154
@@ -38929,16 +36496,15 @@
  134.73.73.117
  134.73.91.130
  134.90.149.147
-134.90.149.148
-134.90.149.149
  134.90.229.237
-134.90.250.185
-134.90.250.198
  134.90.252.119
  134.90.252.129
-134.90.253.154
+134.90.252.233
  134.90.253.196
+134.90.253.218
+134.90.254.119
  134.90.254.173
+134.90.254.86
  134.96.118.195
  134.99.4.139
  13453765871837679316.googlegroups.com
@@ -38947,10 +36513,9 @@
  135.0.59.67
  135.148.3.218
  135.148.9.157
+135.180.140.113
  135.181.0.248
  135.181.0.35
-135.181.105.202
-135.181.105.94
  135.181.108.237
  135.181.109.126
  135.181.109.129
@@ -38969,6 +36534,7 @@
  135.181.114.108
  135.181.115.57
  135.181.115.59
+135.181.118.172
  135.181.15.104
  135.181.16.238
  135.181.18.180
@@ -38980,6 +36546,7 @@
  135.181.43.48
  135.181.49.56
  135.181.60.57
+135.181.61.21
  135.181.61.22
  135.181.61.24
  135.181.78.208
@@ -38994,13 +36561,13 @@
  135.23.249.167
  135.23.75.231
  135.23.95.229
+135.84.203.225
  1356657.servicesgsp1.club
  135athome.com
  136.0.16.235
  136.1.1.165
  136.1.1.173
  136.143.146.254
-136.143.147.192
  136.143.210.146
  136.143.43.222
  136.143.91.104
@@ -39050,6 +36617,7 @@
  136.228.161.67
  136.228.162.150
  136.228.163.150
+136.228.163.6
  136.228.168.18
  136.228.168.54
  136.232.105.34
@@ -39064,14 +36632,11 @@
  136.232.210.206
  136.232.214.110
  136.232.226.202
-136.232.236.6
  136.232.250.26
  136.232.30.174
  136.232.54.82
-136.232.66.174
  136.233.116.73
  136.233.136.41
-136.233.20.213
  136.233.7.157
  136.233.82.225
  136.24.119.249
@@ -39107,7 +36672,6 @@
  136.243.36.83
  136.243.36.93
  136.243.36.99
-136.243.38.37
  136.243.4.204
  136.243.4.68
  136.243.47.220
@@ -39124,6 +36688,7 @@
  136.243.70.195
  136.243.89.196
  136.243.91.230
+136.243.94.180
  136.243.94.221
  136.244.101.95
  136.244.106.192
@@ -39179,9 +36744,7 @@
  137.101.217.62
  137.101.76.252
  137.103.147.138
-137.103.17.204
-137.103.64.254
-137.116.128.105
+137.116.133.111
  137.116.144.63
  137.116.146.201
  137.116.165.64
@@ -39190,25 +36753,21 @@
  137.116.67.60
  137.116.69.218
  137.116.84.38
-137.117.141.228
-137.117.157.61
+137.117.146.117
  137.117.168.216
  137.117.179.133
  137.117.21.137
  137.117.212.72
-137.117.214.55
  137.117.41.57
  137.117.66.125
  137.117.69.106
  137.117.75.65
  137.118.108.10
-137.118.177.57
  137.119.36.33
  137.119.92.50
  137.135.101.9
  137.135.205.88
  137.135.208.147
-137.135.228.123
  137.175.13.129
  137.175.13.130
  137.175.13.65
@@ -39222,17 +36781,13 @@
  137.220.134.189
  137.220.137.247
  137.220.137.51
-137.220.138.252
  137.220.178.25
-137.220.215.41
  137.220.228.52
  137.220.233.48
-137.220.52.77
  137.220.62.152
  137.226.113.10
  137.226.113.56
  137.226.34.46
-137.25.101.102
  137.25.140.167
  137.25.230.156
  137.255.9.46
@@ -39248,7 +36803,6 @@
  137.59.184.38
  137.59.187.107
  137.59.19.132
-137.59.201.35
  137.59.225.8
  137.59.243.42
  137.59.253.52
@@ -39259,7 +36813,6 @@
  137.59.86.187
  137.59.87.84
  137.59.87.87
-137.63.195.20
  137.63.217.65
  137.74.0.3
  137.74.100.178
@@ -39274,9 +36827,7 @@
  137.74.137.211
  137.74.139.68
  137.74.139.74
-137.74.139.90
-137.74.155.56
-137.74.166.77
+137.74.167.133
  137.74.168.174
  137.74.169.241
  137.74.171.160
@@ -39285,52 +36836,46 @@
  137.74.199.180
  137.74.206.80
  137.74.21.195
-137.74.215.18
  137.74.219.112
  137.74.219.113
  137.74.219.114
  137.74.219.115
  137.74.227.71
-137.74.233.91
  137.74.243.161
  137.74.254.198
  137.74.254.242
+137.74.3.135
  137.74.3.145
  137.74.3.170
  137.74.3.172
  137.74.3.88
  137.74.4.69
  137.74.41.119
-137.74.44.162
  137.74.5.81
  137.74.50.116
  137.74.64.237
  137.74.77.15
-137.74.78.19
-137.74.80.246
-137.74.82.54
+137.74.82.44
  137.74.82.63
  137.74.85.74
  137.99.237.43
  13741.url.snwxn.com
  137645-securecheck-pp.icu
  138.0.102.246
-138.0.104.10
+138.0.198.250
  138.0.207.18
  138.0.210.114
  138.0.224.232
  138.0.230.49
  138.0.231.66
  138.0.253.194
-138.0.7.204
-138.0.7.231
+138.0.63.234
+138.0.7.171
  138.0.77.30
  138.0.89.218
-138.100.154.50
-138.100.155.167
+138.100.154.53
  138.117.143.226
  138.117.161.122
-138.117.179.134
  138.117.188.45
  138.117.224.2
  138.117.237.146
@@ -39343,12 +36888,11 @@
  138.117.84.133
  138.117.85.17
  138.117.85.97
-138.118.174.125
  138.118.223.103
  138.118.223.115
  138.118.224.36
-138.118.232.68
  138.118.232.69
+138.118.41.207
  138.118.56.22
  138.118.86.219
  138.121.104.49
@@ -39376,7 +36920,6 @@
  138.122.192.42
  138.122.192.53
  138.122.222.162
-138.122.222.184
  138.122.240.1
  138.122.38.113
  138.122.39.124
@@ -39385,23 +36928,22 @@
  138.122.8.49
  138.122.85.136
  138.122.97.155
-138.122.97.91
  138.124.183.132
  138.128.0.236
  138.128.1.146
  138.128.1.181
-138.128.1.187
+138.128.1.182
  138.128.1.189
-138.128.106.148
-138.128.11.130
+138.128.10.137
  138.128.11.181
  138.128.11.244
  138.128.11.70
  138.128.113.105
  138.128.12.29
  138.128.127.112
+138.128.13.52
+138.128.13.54
  138.128.14.103
-138.128.14.134
  138.128.14.184
  138.128.14.201
  138.128.14.208
@@ -39415,7 +36957,6 @@
  138.128.196.177
  138.128.201.92
  138.128.206.63
-138.128.208.245
  138.128.209.35
  138.128.212.218
  138.128.214.235
@@ -39426,20 +36967,18 @@
  138.128.30.245
  138.128.34.122
  138.128.34.147
-138.128.34.184
-138.128.34.190
  138.128.34.232
  138.128.34.244
  138.128.38.12
+138.128.4.231
  138.128.44.244
  138.128.45.103
-138.128.45.104
  138.128.51.219
  138.128.61.129
-138.128.63.43
  138.128.7.201
+138.128.77.90
+138.128.8.118
  138.128.84.158
-138.128.84.170
  138.128.84.172
  138.134.102.16
  138.16.225.81
@@ -39451,15 +36990,15 @@
  138.185.56.66
  138.185.75.195
  138.186.122.105
+138.186.138.14
+138.186.138.67
  138.186.156.214
  138.186.165.181
  138.186.177.212
  138.186.23.7
-138.186.239.182
+138.186.55.160
  138.186.55.237
  138.186.61.178
-138.186.63.2
-138.186.7.185
  138.186.88.86
  138.19.102.178
  138.19.115.47
@@ -39487,7 +37026,6 @@
  138.197.12.166
  138.197.12.179
  138.197.123.217
-138.197.129.253
  138.197.129.38
  138.197.129.94
  138.197.13.103
@@ -39496,7 +37034,6 @@
  138.197.130.68
  138.197.131.66
  138.197.132.117
-138.197.132.143
  138.197.132.225
  138.197.132.55
  138.197.135.102
@@ -39510,11 +37047,9 @@
  138.197.141.162
  138.197.142.81
  138.197.145.133
-138.197.145.26
  138.197.146.121
  138.197.146.132
  138.197.146.138
-138.197.147.128
  138.197.147.30
  138.197.148.250
  138.197.148.66
@@ -39535,8 +37070,8 @@
  138.197.154.132
  138.197.154.161
  138.197.155.159
+138.197.155.90
  138.197.157.80
-138.197.158.118
  138.197.158.127
  138.197.159.143
  138.197.159.226
@@ -39545,18 +37080,14 @@
  138.197.161.96
  138.197.162.193
  138.197.162.209
-138.197.162.28
-138.197.163.11
  138.197.163.127
  138.197.163.176
  138.197.163.59
  138.197.163.84
-138.197.164.222
  138.197.165.64
  138.197.166.40
  138.197.166.5
  138.197.166.66
-138.197.168.116
  138.197.168.65
  138.197.169.143
  138.197.170.198
@@ -39568,17 +37099,16 @@
  138.197.175.236
  138.197.176.173
  138.197.176.191
-138.197.179.111
  138.197.179.29
  138.197.180.102
  138.197.180.164
+138.197.181.191
  138.197.181.95
  138.197.182.126
  138.197.183.33
  138.197.184.77
  138.197.185.161
  138.197.185.5
-138.197.186.199
  138.197.187.166
  138.197.187.241
  138.197.189.136
@@ -39587,13 +37117,11 @@
  138.197.19.197
  138.197.190.145
  138.197.190.221
+138.197.190.255
  138.197.191.79
  138.197.194.27
  138.197.195.232
-138.197.195.52
-138.197.196.221
  138.197.196.28
-138.197.199.30
  138.197.2.46
  138.197.2.69
  138.197.200.105
@@ -39601,7 +37129,6 @@
  138.197.200.16
  138.197.200.62
  138.197.200.83
-138.197.202.164
  138.197.202.82
  138.197.203.33
  138.197.204.28
@@ -39617,7 +37144,6 @@
  138.197.213.122
  138.197.213.134
  138.197.213.160
-138.197.213.233
  138.197.213.241
  138.197.213.248
  138.197.213.78
@@ -39662,7 +37188,6 @@
  138.197.70.156
  138.197.73.253
  138.197.74.107
-138.197.75.165
  138.197.77.159
  138.197.78.167
  138.197.79.122
@@ -39672,7 +37197,6 @@
  138.197.89.212
  138.197.89.92
  138.197.94.209
-138.197.94.57
  138.197.96.114
  138.197.96.224
  138.197.97.134
@@ -39714,12 +37238,11 @@
  138.201.72.117
  138.201.83.78
  138.201.92.208
-138.204.100.70
+138.204.106.149
  138.204.123.30
  138.204.127.1
  138.204.140.199
  138.204.143.203
-138.204.145.247
  138.204.146.169
  138.204.171.108
  138.204.179.162
@@ -39728,10 +37251,8 @@
  138.204.227.14
  138.204.227.212
  138.204.240.46
-138.204.27.214
  138.204.69.179
  138.204.70.65
-138.204.71.152
  138.204.78.249
  138.204.84.208
  138.207.174.248
@@ -39744,7 +37265,6 @@
  138.210.231.22
  138.219.100.78
  138.219.108.15
-138.219.129.150
  138.219.133.22
  138.219.14.181
  138.219.147.197
@@ -39762,7 +37282,6 @@
  138.229.107.35
  138.229.109.162
  138.229.114.30
-138.229.171.233
  138.229.234.41
  138.229.26.42
  138.255.0.27
@@ -39770,6 +37289,7 @@
  138.255.14.231
  138.255.148.35
  138.255.207.136
+138.255.207.140
  138.255.213.77
  138.255.220.121
  138.255.222.10
@@ -39786,6 +37306,7 @@
  138.36.180.220
  138.36.180.34
  138.36.180.37
+138.36.193.21
  138.36.2.218
  138.36.20.43
  138.36.201.246
@@ -39795,6 +37316,7 @@
  138.36.41.116
  138.36.98.107
  138.41.16.66
+138.41.16.67
  138.41.16.68
  138.59.140.65
  138.59.140.75
@@ -39813,15 +37335,10 @@
  138.59.143.54
  138.59.143.56
  138.59.143.62
-138.59.17.40
  138.59.170.53
  138.59.176.243
  138.59.176.254
  138.59.18.110
-138.59.204.112
-138.59.204.38
-138.59.206.59
-138.59.207.98
  138.59.213.79
  138.59.233.97
  138.59.32.234
@@ -39833,15 +37350,12 @@
  138.68.102.241
  138.68.103.131
  138.68.105.150
-138.68.105.194
  138.68.105.209
  138.68.106.216
  138.68.106.62
  138.68.106.82
-138.68.107.225
  138.68.109.2
  138.68.11.111
-138.68.11.24
  138.68.110.166
  138.68.110.7
  138.68.113.98
@@ -39878,7 +37392,6 @@
  138.68.176.38
  138.68.178.64
  138.68.179.145
-138.68.18.232
  138.68.180.211
  138.68.180.225
  138.68.180.248
@@ -39894,12 +37407,10 @@
  138.68.20.158
  138.68.20.197
  138.68.21.125
-138.68.22.231
  138.68.224.230
  138.68.225.199
  138.68.226.125
  138.68.226.175
-138.68.226.234
  138.68.226.40
  138.68.227.120
  138.68.227.57
@@ -39908,22 +37419,17 @@
  138.68.231.196
  138.68.231.77
  138.68.232.42
-138.68.233.112
-138.68.234.162
  138.68.234.185
  138.68.234.74
  138.68.236.111
  138.68.236.147
  138.68.236.50
-138.68.237.12
  138.68.238.242
  138.68.239.219
  138.68.24.249
  138.68.24.88
-138.68.241.88
  138.68.242.14
  138.68.242.155
-138.68.242.220
  138.68.242.68
  138.68.244.244
  138.68.244.82
@@ -39932,11 +37438,9 @@
  138.68.245.255
  138.68.247.104
  138.68.247.194
-138.68.247.87
  138.68.250.106
  138.68.250.124
  138.68.250.4
-138.68.251.105
  138.68.251.176
  138.68.251.30
  138.68.253.149
@@ -39952,22 +37456,17 @@
  138.68.3.21
  138.68.30.35
  138.68.30.47
-138.68.31.105
  138.68.31.242
-138.68.4.131
  138.68.4.8
  138.68.40.92
  138.68.43.106
  138.68.44.18
-138.68.44.236
  138.68.44.55
  138.68.45.164
  138.68.47.77
  138.68.48.244
  138.68.49.191
  138.68.50.177
-138.68.50.18
-138.68.51.228
  138.68.52.34
  138.68.52.53
  138.68.52.58
@@ -39998,7 +37497,6 @@
  138.68.69.29
  138.68.70.116
  138.68.70.86
-138.68.71.188
  138.68.72.162
  138.68.72.167
  138.68.73.219
@@ -40012,7 +37510,6 @@
  138.68.81.162
  138.68.82.194
  138.68.83.46
-138.68.86.98
  138.68.87.112
  138.68.87.203
  138.68.87.218
@@ -40024,10 +37521,8 @@
  138.68.9.246
  138.68.92.121
  138.68.92.248
-138.68.93.14
  138.68.93.153
  138.68.93.86
-138.68.94.142
  138.68.94.173
  138.68.94.98
  138.68.95.204
@@ -40035,22 +37530,21 @@
  138.68.96.222
  138.68.97.63
  138.68.98.102
-138.68.99.46
  138.75.10.168
  138.75.16.42
  138.75.167.161
  138.75.192.123
  138.75.234.17
+138.75.239.104
  138.75.246.55
  138.75.28.161
+138.75.38.33
  138.75.77.200
  138.75.77.80
  138.75.92.250
  138.75.94.13
  138.75.94.169
  138.91.123.237
-138.91.125.75
-138.91.142.125
  138.91.145.18
  138.91.162.26
  138.91.186.213
@@ -40095,9 +37589,9 @@
  138.97.116.190
  138.97.12.150
  138.97.200.131
-138.97.225.0
-138.97.225.144
+138.97.22.186
  138.97.236.11
+138.97.236.12
  138.97.236.13
  138.97.236.14
  138.97.236.17
@@ -40107,7 +37601,6 @@
  138.97.236.3
  138.97.236.30
  138.97.236.33
-138.97.236.4
  138.97.236.6
  138.97.236.8
  138.97.244.130
@@ -40120,7 +37613,6 @@
  138.97.98.251
  138.99.200.88
  138.99.204.188
-138.99.204.224
  138.99.206.98
  138.99.216.104
  138.99.216.112
@@ -40130,10 +37622,7 @@
  138.99.216.171
  138.99.216.92
  138.99.224.223
-138.99.29.104
  138.99.6.177
-138.99.6.184
-138.99.6.198
  138.99.7.29
  138.99.7.75
  138.99.79.192
@@ -40150,11 +37639,9 @@
  139.0.77.165
  139.0.9.139
  139.129.108.135
+139.129.130.90
  139.129.206.8
-139.129.25.106
-139.129.29.57
  139.129.90.203
-139.129.94.95
  139.129.97.42
  139.130.140.184
  139.130.206.73
@@ -40165,18 +37652,14 @@
  139.138.65.250
  139.138.8.214
  139.153.255.107
-139.155.1.33
-139.155.1.62
  139.155.10.97
  139.155.102.123
  139.155.11.173
  139.155.115.197
  139.155.123.84
-139.155.127.59
  139.155.13.21
  139.155.13.245
  139.155.13.59
-139.155.13.93
  139.155.16.188
  139.155.17.13
  139.155.17.18
@@ -40187,15 +37670,8 @@
  139.155.175.148
  139.155.176.110
  139.155.181.145
-139.155.19.245
-139.155.2.133
-139.155.2.183
-139.155.2.218
  139.155.2.240
-139.155.20.90
  139.155.204.28
-139.155.21.186
-139.155.21.34
  139.155.224.175
  139.155.225.13
  139.155.225.246
@@ -40211,6 +37687,7 @@
  139.155.239.5
  139.155.24.139
  139.155.24.93
+139.155.240.73
  139.155.241.89
  139.155.242.21
  139.155.242.226
@@ -40233,7 +37710,6 @@
  139.155.35.47
  139.155.38.67
  139.155.39.22
-139.155.39.62
  139.155.41.161
  139.155.42.189
  139.155.42.30
@@ -40243,40 +37719,28 @@
  139.155.46.147
  139.155.54.93
  139.155.59.176
-139.155.6.26
  139.155.68.58
  139.155.7.147
-139.155.70.21
-139.155.71.154
  139.155.72.204
  139.155.73.60
  139.155.74.147
-139.155.74.240
  139.155.75.8
  139.155.76.42
+139.155.77.44
  139.155.79.24
-139.155.79.35
  139.155.79.7
  139.155.81.79
  139.155.82.119
-139.155.82.146
  139.155.83.18
  139.155.84.160
-139.155.84.213
-139.155.86.123
-139.155.86.130
-139.155.86.144
  139.155.86.214
-139.155.87.35
+139.155.87.237
  139.155.88.128
  139.155.89.11
-139.155.89.150
-139.155.90.108
-139.155.92.126
-139.155.93.180
  139.159.0.38
  139.159.1.1
  139.159.1.129
+139.159.118.14
  139.159.133.88
  139.159.136.243
  139.159.141.100
@@ -40318,16 +37782,16 @@
  139.162.121.165
  139.162.121.170
  139.162.121.251
+139.162.122.233
  139.162.122.33
  139.162.123.106
  139.162.123.29
  139.162.124.224
+139.162.124.226
  139.162.127.185
  139.162.128.181
  139.162.128.239
  139.162.13.114
-139.162.137.94
-139.162.141.252
  139.162.144.235
  139.162.145.250
  139.162.146.174
@@ -40346,7 +37810,6 @@
  139.162.163.167
  139.162.164.153
  139.162.164.90
-139.162.169.50
  139.162.17.152
  139.162.171.76
  139.162.174.82
@@ -40396,7 +37859,6 @@
  139.162.30.134
  139.162.31.115
  139.162.31.228
-139.162.31.31
  139.162.38.253
  139.162.39.15
  139.162.40.187
@@ -40443,6 +37905,7 @@
  139.162.91.117
  139.162.97.52
  139.162.98.244
+139.162.99.243
  139.162.99.58
  139.170.118.203
  139.170.150.189
@@ -40458,10 +37921,9 @@
  139.170.180.78
  139.170.229.124
  139.170.231.168
+139.170.40.12
  139.170.8.116
-139.170.8.128
  139.180.128.190
-139.180.131.182
  139.180.147.93
  139.180.184.162
  139.180.193.170
@@ -40470,91 +37932,68 @@
  139.180.202.99
  139.180.207.34
  139.180.212.34
+139.180.214.15
  139.180.214.151
  139.180.218.121
  139.180.220.15
  139.180.220.179
  139.186.122.226
  139.186.148.93
-139.186.15.254
  139.186.158.246
-139.186.22.12
  139.186.24.82
  139.186.4.114
  139.186.64.239
  139.186.65.24
-139.186.67.159
  139.186.67.94
  139.186.68.53
  139.186.69.133
-139.186.69.195
  139.186.69.92
-139.186.71.224
-139.186.71.62
  139.186.72.74
  139.186.73.140
-139.186.73.19
-139.186.73.65
  139.186.76.101
  139.186.77.46
-139.186.8.212
  139.186.82.43
  139.189.233.23
  139.189.235.70
  139.189.71.28
  139.190.238.15
+139.190.238.26
  139.190.238.49
-139.192.2.90
  139.192.236.122
  139.192.237.154
  139.192.237.253
-139.192.74.248
  139.192.76.221
-139.194.121.10
  139.194.207.25
-139.194.248.142
  139.196.102.42
  139.196.124.205
  139.196.156.254
+139.196.159.93
  139.196.16.10
  139.196.223.104
  139.196.230.184
  139.196.47.127
-139.196.53.132
  139.198.1.16
  139.198.120.226
  139.198.121.63
  139.198.122.116
  139.198.122.19
  139.198.122.76
-139.198.124.14
  139.198.125.172
-139.198.14.121
  139.198.15.41
-139.198.17.144
  139.198.17.31
  139.198.177.151
-139.198.18.184
+139.198.177.84
  139.198.18.230
-139.198.188.32
-139.198.189.40
-139.198.19.14
-139.198.190.182
  139.198.191.217
  139.198.191.86
  139.198.23.115
-139.198.4.217
  139.198.5.138
  139.198.5.79
-139.198.9.121
-139.199.0.28
-139.199.0.84
  139.199.1.166
+139.199.103.186
  139.199.103.55
-139.199.104.217
  139.199.104.65
  139.199.106.235
-139.199.108.83
  139.199.115.210
  139.199.119.76
  139.199.123.152
@@ -40563,14 +38002,10 @@
  139.199.14.128
  139.199.158.21
  139.199.160.102
-139.199.164.21
  139.199.164.31
  139.199.165.189
-139.199.168.18
  139.199.170.101
-139.199.18.194
  139.199.18.200
-139.199.183.14
  139.199.189.158
  139.199.19.100
  139.199.200.182
@@ -40578,13 +38013,10 @@
  139.199.208.176
  139.199.223.208
  139.199.228.133
-139.199.228.154
-139.199.229.228
  139.199.23.233
  139.199.248.156
  139.199.248.199
  139.199.25.110
-139.199.26.219
  139.199.29.114
  139.199.29.155
  139.199.30.155
@@ -40595,7 +38027,6 @@
  139.199.45.83
  139.199.48.124
  139.199.5.50
-139.199.59.31
  139.199.62.142
  139.199.62.48
  139.199.64.247
@@ -40604,13 +38035,10 @@
  139.199.78.228
  139.199.80.67
  139.199.80.75
-139.199.84.186
-139.199.85.241
  139.199.87.1
  139.199.88.244
  139.199.89.157
  139.199.94.100
-139.199.94.51
  139.199.99.77
  139.201.164.244
  139.203.19.129
@@ -40618,7 +38046,6 @@
  139.208.135.55
  139.208.145.200
  139.208.147.6
-139.208.148.224
  139.208.160.165
  139.208.163.242
  139.208.167.167
@@ -40644,16 +38071,15 @@
  139.211.142.197
  139.211.165.141
  139.211.193.186
+139.211.230.243
  139.211.43.74
  139.211.45.177
  139.211.47.57
  139.211.8.32
  139.211.87.152
  139.212.54.193
-139.212.64.149
  139.213.150.219
  139.213.18.93
-139.213.27.136
  139.213.64.215
  139.213.8.22
  139.213.93.243
@@ -40672,23 +38098,18 @@
  139.217.115.110
  139.217.218.93
  139.217.232.68
-139.217.233.15
  139.217.236.198
  139.217.82.115
  139.217.82.205
  139.218.110.204
-139.218.4.6
-139.219.0.102
  139.219.0.154
  139.219.0.186
-139.219.1.112
  139.219.1.61
  139.219.10.11
  139.219.10.167
  139.219.11.254
  139.219.12.104
  139.219.12.156
-139.219.13.163
  139.219.13.170
  139.219.14.134
  139.219.14.185
@@ -40718,18 +38139,20 @@
  139.220.192.57
  139.224.104.83
  139.224.18.116
+139.224.220.5
+139.224.222.38
+139.224.24.169
  139.224.24.215
  139.224.72.224
  139.226.33.245
-139.226.35.190
  139.226.75.66
  139.226.75.82
-139.227.180.184
  139.228.26.40
  139.228.64.77
  139.255.100.237
  139.255.100.238
  139.255.101.244
+139.255.102.242
  139.255.113.194
  139.255.116.122
  139.255.128.244
@@ -40743,7 +38166,6 @@
  139.255.31.210
  139.255.31.26
  139.255.34.178
-139.255.35.181
  139.255.35.99
  139.255.4.205
  139.255.40.138
@@ -40751,52 +38173,41 @@
  139.255.58.94
  139.255.69.149
  139.255.78.174
-139.255.83.52
  139.255.86.189
  139.255.86.19
-139.255.87.213
  139.255.87.234
  139.255.87.236
  139.255.91.122
  139.255.94.122
-139.255.94.123
-139.28.152.10
-139.28.206.11
  139.28.218.34
-139.28.220.186
  139.28.36.20
  139.45.168.4
  139.47.120.149
  139.47.130.253
  139.47.135.215
  139.5.132.105
-139.5.132.245
  139.5.152.81
  139.5.16.174
  139.5.16.217
  139.5.177.10
  139.5.237.163
+139.5.237.238
  139.5.29.97
  139.5.45.37
-139.5.71.46
  139.59.0.68
  139.59.1.195
-139.59.10.186
-139.59.10.42
  139.59.10.90
  139.59.100.50
  139.59.100.62
  139.59.101.59
  139.59.101.76
  139.59.102.170
-139.59.104.170
  139.59.104.33
  139.59.105.54
  139.59.106.53
  139.59.107.145
  139.59.107.34
  139.59.108.193
-139.59.108.237
  139.59.108.41
  139.59.109.146
  139.59.109.223
@@ -40819,7 +38230,6 @@
  139.59.129.216
  139.59.129.44
  139.59.129.45
-139.59.13.53
  139.59.130.184
  139.59.130.236
  139.59.131.37
@@ -40837,24 +38247,21 @@
  139.59.141.179
  139.59.141.60
  139.59.142.220
-139.59.145.130
  139.59.145.220
  139.59.145.231
  139.59.146.28
-139.59.146.42
+139.59.147.218
  139.59.148.209
  139.59.148.56
-139.59.15.47
  139.59.150.19
-139.59.151.124
  139.59.152.19
+139.59.153.133
  139.59.154.228
  139.59.154.235
  139.59.154.65
  139.59.158.239
  139.59.159.0
  139.59.16.118
-139.59.16.88
  139.59.161.202
  139.59.161.78
  139.59.162.225
@@ -40864,7 +38271,6 @@
  139.59.167.38
  139.59.168.182
  139.59.169.103
-139.59.169.37
  139.59.17.105
  139.59.172.23
  139.59.174.107
@@ -40879,13 +38285,11 @@
  139.59.186.178
  139.59.187.138
  139.59.187.232
-139.59.188.207
  139.59.19.157
  139.59.191.7
  139.59.196.82
  139.59.197.250
  139.59.2.146
-139.59.2.55
  139.59.20.81
  139.59.211.160
  139.59.211.245
@@ -40893,6 +38297,7 @@
  139.59.213.25
  139.59.215.171
  139.59.215.185
+139.59.215.241
  139.59.22.194
  139.59.22.201
  139.59.22.98
@@ -40915,7 +38320,9 @@
  139.59.239.104
  139.59.239.38
  139.59.24.62
+139.59.240.39
  139.59.240.40
+139.59.240.48
  139.59.240.51
  139.59.240.61
  139.59.241.143
@@ -40923,19 +38330,16 @@
  139.59.242.22
  139.59.242.50
  139.59.242.62
-139.59.243.224
  139.59.244.238
-139.59.247.201
  139.59.247.235
+139.59.248.105
  139.59.248.126
  139.59.248.84
  139.59.25.153
  139.59.25.238
  139.59.250.118
-139.59.250.67
  139.59.251.222
  139.59.254.44
-139.59.254.93
  139.59.255.101
  139.59.255.166
  139.59.26.39
@@ -40950,7 +38354,6 @@
  139.59.34.226
  139.59.35.52
  139.59.36.107
-139.59.36.23
  139.59.37.245
  139.59.38.252
  139.59.39.109
@@ -40963,55 +38366,41 @@
  139.59.40.187
  139.59.40.233
  139.59.40.240
+139.59.41.120
  139.59.43.196
  139.59.43.22
  139.59.43.246
-139.59.43.6
  139.59.43.75
  139.59.44.130
  139.59.45.128
-139.59.45.45
-139.59.45.82
-139.59.46.167
-139.59.46.243
  139.59.46.79
  139.59.46.88
  139.59.47.192
  139.59.47.247
  139.59.56.121
  139.59.56.149
-139.59.56.23
  139.59.57.2
  139.59.57.30
  139.59.57.39
-139.59.58.115
-139.59.58.155
  139.59.58.25
-139.59.59.102
  139.59.59.187
  139.59.59.210
  139.59.59.63
  139.59.59.68
  139.59.60.154
-139.59.60.220
  139.59.60.244
-139.59.60.40
-139.59.60.9
  139.59.61.103
+139.59.61.144
  139.59.61.186
  139.59.61.215
  139.59.61.241
  139.59.63.216
  139.59.65.77
-139.59.66.101
-139.59.66.245
  139.59.66.248
  139.59.66.79
  139.59.67.82
  139.59.68.67
-139.59.69.216
  139.59.69.76
-139.59.7.105
  139.59.7.177
  139.59.7.194
  139.59.7.208
@@ -41022,7 +38411,7 @@
  139.59.71.128
  139.59.72.96
  139.59.75.249
-139.59.76.99
+139.59.78.239
  139.59.79.216
  139.59.79.56
  139.59.8.10
@@ -41034,12 +38423,8 @@
  139.59.83.179
  139.59.84.189
  139.59.84.29
-139.59.84.55
  139.59.85.160
-139.59.85.222
-139.59.85.41
  139.59.86.47
-139.59.87.250
  139.59.87.254
  139.59.88.246
  139.59.88.86
@@ -41047,10 +38432,8 @@
  139.59.9.187
  139.59.9.200
  139.59.90.0
-139.59.90.141
  139.59.90.148
  139.59.90.210
-139.59.90.31
  139.59.91.78
  139.59.91.94
  139.59.92.135
@@ -41064,6 +38447,7 @@
  139.59.95.60
  139.59.96.235
  139.59.99.142
+139.59.99.35
  139.60.12.238
  139.60.12.89
  139.60.161.50
@@ -41083,7 +38467,6 @@
  139.9.177.227
  139.9.201.67
  139.9.212.83
-139.9.249.234
  139.9.47.7
  139.9.63.189
  139.9.64.237
@@ -41093,22 +38476,18 @@
  139.9.83.170
  139.99.102.114
  139.99.104.233
-139.99.105.138
-139.99.105.185
  139.99.105.186
  139.99.113.2
  139.99.114.108
  139.99.114.152
  139.99.118.62
  139.99.120.130
-139.99.121.22
  139.99.123.236
  139.99.123.61
  139.99.126.138
  139.99.133.150
  139.99.133.189
  139.99.133.226
-139.99.134.248
  139.99.140.52
  139.99.144.31
  139.99.148.4
@@ -41123,9 +38502,7 @@
  139.99.180.74
  139.99.185.81
  139.99.196.183
-139.99.2.132
  139.99.20.49
-139.99.20.54
  139.99.203.12
  139.99.208.34
  139.99.210.46
@@ -41134,10 +38511,7 @@
  139.99.219.208
  139.99.236.237
  139.99.237.109
-139.99.237.183
-139.99.237.186
  139.99.239.230
-139.99.253.120
  139.99.26.68
  139.99.33.94
  139.99.37.27
@@ -41147,16 +38521,15 @@
  139.99.42.75
  139.99.43.235
  139.99.5.210
-139.99.54.20
  139.99.66.210
  139.99.66.231
  139.99.69.189
  139.99.79.185
  139.99.8.31
  139.99.8.9
-139.99.84.85
  139.99.98.191
  139.99.98.248
+139.99.99.151
  13960999999.mer.lstest.siquality.com
  139644804765798-dot-we-secure-file-sh4456.appspot.com
  139banjia.com
@@ -41179,7 +38552,6 @@
  14.100.0.93
  14.102.101.102
  14.102.112.178
-14.102.113.120
  14.102.113.39
  14.102.150.246
  14.102.162.162
@@ -41198,11 +38570,11 @@
  14.102.71.10
  14.102.71.230
  14.102.73.254
-14.102.74.99
  14.102.76.182
  14.102.84.90
  14.102.93.109
  14.102.97.204
+14.104.220.52
  14.106.226.247
  14.106.98.76
  14.112.33.172
@@ -41211,25 +38583,18 @@
  14.114.33.19
  14.115.207.126
  14.115.30.180
-14.115.31.164
  14.116.146.15
  14.116.146.226
  14.116.147.204
-14.116.148.176
  14.116.148.235
  14.116.149.110
-14.116.150.230
  14.116.151.251
  14.116.152.11
  14.116.152.112
-14.116.154.173
  14.116.155.195
  14.116.185.238
  14.116.185.37
  14.116.186.243
-14.116.187.38
-14.116.188.151
-14.116.188.75
  14.116.189.156
  14.116.189.231
  14.116.190.241
@@ -41237,22 +38602,17 @@
  14.116.191.100
  14.116.191.159
  14.116.193.5
-14.116.195.173
  14.116.195.245
-14.116.200.226
  14.116.202.204
  14.116.203.123
  14.116.203.193
  14.116.207.130
  14.116.207.212
-14.116.208.72
  14.116.213.23
  14.116.214.215
  14.116.215.155
-14.116.216.176
+14.116.216.39
  14.116.219.141
-14.116.253.142
-14.116.255.229
  14.117.184.123
  14.117.188.169
  14.117.188.191
@@ -41264,15 +38624,15 @@
  14.117.190.58
  14.117.190.61
  14.117.191.144
-14.117.191.146
+14.117.191.86
  14.118.128.194
  14.118.212.169
-14.118.212.86
  14.118.214.62
  14.12.147.161
  14.120.182.126
  14.120.225.175
  14.126.125.125
+14.126.126.181
  14.126.126.224
  14.126.97.234
  14.127.248.19
@@ -41291,7 +38651,6 @@
  14.128.9.48
  14.128.9.51
  14.128.9.53
-14.134.185.196
  14.135.120.18
  14.135.120.19
  14.135.120.20
@@ -41304,7 +38663,6 @@
  14.136.184.36
  14.136.192.222
  14.136.201.82
-14.136.245.194
  14.136.249.138
  14.136.40.146
  14.136.42.159
@@ -41323,14 +38681,14 @@
  14.139.171.142
  14.139.181.195
  14.139.185.114
+14.139.194.24
  14.139.208.130
+14.139.209.14
  14.139.225.151
  14.139.229.34
  14.139.239.22
  14.139.242.247
  14.139.56.14
-14.139.86.166
-14.139.87.36
  14.14.202.140
  14.14.71.47
  14.140.106.201
@@ -41350,14 +38708,10 @@
  14.142.197.114
  14.142.20.142
  14.142.57.66
-14.143.107.226
  14.143.13.67
  14.143.168.230
  14.143.3.30
  14.143.37.68
-14.145.145.186
-14.145.145.189
-14.145.147.101
  14.145.164.93
  14.145.174.162
  14.145.174.178
@@ -41368,26 +38722,26 @@
  14.152.95.91
  14.154.28.199
  14.155.112.48
-14.155.17.209
  14.155.18.203
+14.155.19.129
+14.155.220.34
  14.156.51.14
-14.156.51.23
  14.156.51.232
  14.156.51.254
  14.157.105.213
  14.157.107.156
  14.157.107.231
  14.157.6.26
-14.160.147.188
+14.160.20.194
  14.160.23.139
  14.160.26.18
  14.160.33.254
+14.160.70.178
  14.160.93.230
  14.161.0.62
  14.161.1.46
  14.161.10.127
  14.161.11.238
-14.161.12.119
  14.161.13.61
  14.161.14.124
  14.161.147.32
@@ -41398,12 +38752,15 @@
  14.161.254.246
  14.161.29.242
  14.161.30.236
+14.161.38.107
  14.161.43.45
  14.161.44.120
  14.161.45.187
+14.161.45.78
  14.161.46.132
  14.161.47.128
  14.161.48.111
+14.161.48.201
  14.161.49.29
  14.161.5.68
  14.161.6.201
@@ -41412,21 +38769,19 @@
  14.162.145.116
  14.162.145.182
  14.162.146.128
+14.162.146.31
  14.162.146.38
  14.162.186.160
  14.162.208.231
-14.162.221.62
-14.162.27.197
  14.162.27.235
  14.163.156.97
  14.163.182.180
  14.163.226.70
-14.164.114.139
  14.164.188.114
  14.164.220.31
  14.164.78.61
+14.164.99.69
  14.165.109.150
-14.165.18.211
  14.167.135.86
  14.167.168.11
  14.167.198.133
@@ -41436,23 +38791,24 @@
  14.168.76.68
  14.168.80.136
  14.169.112.25
-14.169.113.112
-14.169.121.40
+14.169.140.51
+14.169.140.6
  14.169.168.219
  14.169.171.181
  14.169.175.165
  14.169.217.86
-14.169.233.174
+14.169.220.143
+14.169.229.152
+14.169.3.214
  14.169.31.13
  14.17.100.33
  14.17.114.65
  14.17.65.221
  14.17.70.74
  14.170.115.132
-14.170.141.160
  14.170.170.45
  14.171.199.142
-14.171.219.59
+14.171.71.101
  14.172.213.125
  14.172.26.84
  14.172.49.17
@@ -41460,74 +38816,55 @@
  14.173.114.52
  14.173.70.155
  14.175.255.151
-14.176.133.149
-14.176.162.197
-14.176.185.179
  14.176.186.48
  14.176.231.63
  14.177.0.56
-14.177.116.12
  14.177.13.226
  14.177.154.203
  14.177.164.172
-14.177.209.58
+14.177.180.214
  14.177.232.71
  14.177.235.178
-14.177.239.168
-14.177.66.70
  14.177.89.140
  14.179.127.17
  14.179.16.75
  14.18.101.26
-14.18.103.163
+14.18.105.163
  14.18.106.238
  14.18.107.116
  14.18.107.215
-14.18.107.236
-14.18.116.8
  14.18.117.15
-14.18.118.44
-14.18.118.64
  14.18.120.38
  14.18.136.118
  14.18.151.180
-14.18.154.186
  14.18.189.240
-14.18.190.116
-14.18.190.5
  14.18.236.43
-14.18.54.30
  14.18.73.174
-14.18.73.239
  14.18.79.61
  14.18.90.155
-14.18.92.6
  14.180.217.224
  14.181.145.4
+14.182.78.233
  14.183.53.139
-14.183.67.231
  14.186.142.52
-14.186.151.117
+14.186.154.251
  14.186.16.44
-14.186.174.251
-14.186.255.71
+14.186.199.172
  14.186.39.82
+14.186.48.26
  14.186.57.45
  14.187.136.76
  14.187.141.173
  14.187.142.66
-14.187.159.51
-14.187.163.121
-14.187.50.93
  14.187.56.237
  14.187.68.169
  14.189.207.200
+14.190.249.248
  14.191.172.204
  14.191.196.135
  14.191.87.61
  14.192.143.104
  14.192.153.84
-14.192.192.183
  14.192.197.164
  14.192.208.205
  14.192.209.136
@@ -41547,14 +38884,11 @@
  14.198.163.2
  14.198.5.221
  14.199.117.89
-14.199.133.237
  14.199.136.112
-14.199.138.131
  14.199.17.155
  14.199.208.122
  14.199.219.12
  14.199.40.24
-14.199.97.216
  14.2.71.61
  14.20.181.67
  14.20.182.35
@@ -41566,12 +38900,12 @@
  14.201.249.216
  14.203.30.225
  14.203.57.50
-14.204.136.125
  14.204.145.108
  14.204.211.122
-14.204.252.174
  14.204.5.250
  14.204.84.96
+14.207.0.35
+14.207.117.6
  14.207.121.90
  14.207.124.63
  14.207.124.78
@@ -41586,8 +38920,6 @@
  14.207.25.20
  14.207.26.232
  14.207.27.179
-14.207.27.232
-14.207.31.212
  14.207.36.110
  14.207.36.50
  14.207.44.179
@@ -41598,7 +38930,6 @@
  14.207.56.27
  14.207.56.68
  14.207.59.166
-14.207.64.210
  14.207.65.207
  14.207.65.41
  14.207.66.42
@@ -41607,7 +38938,6 @@
  14.207.84.172
  14.21.36.84
  14.21.42.158
-14.21.80.5
  14.21.81.13
  14.211.69.58
  14.213.136.126
@@ -41615,52 +38945,43 @@
  14.213.138.123
  14.213.138.194
  14.215.107.171
-14.215.113.59
  14.215.116.6
  14.215.158.100
-14.215.165.131
-14.215.165.133
  14.215.166.15
  14.215.166.17
  14.215.166.18
  14.215.166.25
-14.215.171.178
  14.215.213.142
  14.215.236.114
  14.215.237.205
-14.215.44.9
  14.215.46.100
  14.215.46.147
  14.215.49.234
  14.215.50.23
-14.215.51.241
+14.219.239.134
  14.221.176.31
-14.221.177.2
  14.221.177.225
-14.221.97.63
  14.221.97.65
+14.223.92.99
  14.224.131.26
  14.225.17.9
  14.226.200.143
-14.226.227.105
  14.226.232.179
  14.226.235.5
  14.226.247.178
-14.227.229.51
  14.23.110.173
  14.23.122.98
  14.23.170.234
  14.23.42.202
-14.23.81.42
  14.23.91.82
  14.230.78.115
+14.231.100.207
  14.231.138.97
  14.231.161.38
  14.231.206.160
  14.232.113.209
  14.232.152.81
  14.232.160.197
-14.232.160.213
  14.232.160.247
  14.232.160.252
  14.232.161.29
@@ -41672,10 +38993,8 @@
  14.232.214.138
  14.232.214.184
  14.232.245.245
-14.232.43.186
  14.233.190.122
  14.233.191.221
-14.233.253.209
  14.233.35.235
  14.234.238.180
  14.234.241.61
@@ -41684,65 +39003,58 @@
  14.235.71.139
  14.237.155.231
  14.237.200.131
-14.237.40.46
  14.237.98.161
-14.240.147.6
+14.239.250.114
  14.240.37.9
+14.241.122.23
  14.241.136.183
  14.241.209.27
  14.241.227.216
  14.241.228.19
  14.241.231.21
  14.241.240.245
-14.241.241.41
  14.241.245.179
  14.241.39.247
+14.241.39.98
  14.241.48.6
  14.241.63.2
  14.242.186.228
  14.242.189.126
  14.242.55.39
-14.243.53.189
  14.244.97.132
  14.245.113.139
-14.245.241.62
  14.245.6.41
  14.245.62.251
-14.246.16.199
+14.245.80.69
  14.246.230.130
  14.246.25.215
  14.247.90.193
+14.248.118.104
  14.248.137.211
+14.248.228.124
  14.248.73.219
  14.248.83.32
+14.248.85.39
  14.250.252.48
-14.252.118.197
+14.251.13.221
  14.252.15.14
-14.252.47.244
  14.253.145.213
  14.253.56.105
-14.254.100.93
  14.254.232.28
  14.29.118.34
  14.29.126.53
  14.29.148.201
  14.29.154.66
  14.29.156.197
-14.29.160.194
  14.29.162.139
-14.29.165.173
  14.29.171.172
  14.29.171.178
-14.29.171.50
-14.29.177.90
  14.29.179.228
  14.29.183.176
  14.29.184.45
  14.29.185.180
  14.29.185.205
  14.29.187.184
-14.29.192.160
-14.29.193.198
  14.29.196.157
  14.29.197.120
  14.29.201.72
@@ -41750,38 +39062,25 @@
  14.29.205.61
  14.29.207.2
  14.29.210.146
-14.29.213.136
-14.29.214.207
-14.29.214.233
  14.29.215.173
-14.29.215.205
  14.29.215.212
-14.29.215.5
-14.29.219.152
-14.29.219.2
  14.29.221.251
  14.29.222.225
-14.29.224.183
  14.29.227.56
  14.29.228.159
  14.29.232.148
-14.29.232.191
-14.29.232.45
  14.29.239.215
-14.29.241.29
  14.29.242.40
-14.29.243.32
  14.29.247.69
  14.29.250.224
  14.29.254.239
-14.29.255.9
-14.29.35.47
-14.29.50.74
  14.29.64.243
  14.29.64.91
  14.32.0.67
  14.32.164.26
+14.32.182.169
  14.32.43.193
+14.33.133.241
  14.33.231.237
  14.33.252.133
  14.33.28.222
@@ -41796,7 +39095,6 @@
  14.34.189.136
  14.34.189.228
  14.34.204.226
-14.34.207.70
  14.34.99.226
  14.35.229.148
  14.35.44.115
@@ -41825,10 +39123,13 @@
  14.39.178.136
  14.39.91.54
  14.40.10.202
+14.40.102.160bin.sh
+14.40.110.73
  14.40.114.215
  14.40.15.246
  14.40.23.66
  14.40.34.132
+14.40.78.167
  14.40.85.81
  14.41.119.147
  14.41.119.65
@@ -41836,6 +39137,7 @@
  14.42.131.21
  14.42.144.183
  14.42.144.228
+14.42.144.52
  14.42.155.140
  14.42.156.190
  14.42.163.125
@@ -41850,6 +39152,7 @@
  14.43.78.208
  14.44.34.164
  14.44.40.225
+14.44.52.218
  14.44.69.38
  14.44.91.83
  14.44.96.65
@@ -41873,7 +39176,9 @@
  14.47.229.118
  14.47.251.164
  14.47.77.176
+14.47.81.45
  14.48.12.132
+14.48.12.94
  14.48.140.134
  14.48.15.28
  14.48.150.144
@@ -41890,6 +39195,7 @@
  14.49.100.80
  14.49.114.5
  14.49.115.210
+14.49.123.152
  14.49.131.98
  14.49.135.248
  14.49.15.190
@@ -41901,7 +39207,6 @@
  14.5.77.21
  14.50.102.29
  14.50.129.248
-14.50.226.245
  14.51.107.118
  14.51.107.211
  14.51.108.179
@@ -41921,9 +39226,12 @@
  14.53.186.216
  14.53.191.139
  14.53.22.94
+14.53.220.222
  14.53.227.221
+14.53.31.205
  14.53.67.51
  14.53.8.112
+14.53.8.69
  14.54.119.87
  14.54.121.93
  14.54.143.73
@@ -41949,9 +39257,9 @@
  14.56.24.182
  14.56.24.204
  14.56.24.244
-14.56.245.211
  14.56.250.88
  14.56.3.52
+14.56.5.160
  14.56.9.97
  14.56.93.15
  14.58.114.122
@@ -41964,7 +39272,6 @@
  14.63.160.219
  14.63.162.98
  14.63.165.206
-14.63.165.49
  14.63.166.243
  14.63.167.192
  14.63.174.149
@@ -41974,13 +39281,12 @@
  14.63.5.35
  14.63.55.164
  14.7.65.80
+14.95.106.11
  14.98.112.126
  14.98.113.169
+14.98.115.50
  14.98.117.60
  14.98.134.74
-14.98.18.94
-14.98.213.14
-14.98.22.102
  14.98.4.82
  14.98.68.73
  14.99.117.194
@@ -42003,35 +39309,24 @@
  140.128.85.2
  140.143.0.121
  140.143.0.127
-140.143.126.224
  140.143.127.36
  140.143.128.66
  140.143.13.91
  140.143.134.171
-140.143.134.86
  140.143.136.41
  140.143.136.89
  140.143.139.81
  140.143.14.137
  140.143.140.61
  140.143.142.213
-140.143.143.164
-140.143.143.200
  140.143.144.140
  140.143.145.129
-140.143.145.55
-140.143.146.148
-140.143.146.45
  140.143.148.79
-140.143.149.71
-140.143.151.93
  140.143.152.200
  140.143.153.79
  140.143.155.17
  140.143.156.205
-140.143.16.248
  140.143.163.252
-140.143.167.2
  140.143.169.29
  140.143.17.113
  140.143.17.215
@@ -42043,30 +39338,23 @@
  140.143.189.58
  140.143.19.170
  140.143.19.237
-140.143.19.40
  140.143.19.92
  140.143.193.52
  140.143.195.181
  140.143.195.189
-140.143.198.182
-140.143.199.169
-140.143.2.108
  140.143.20.166
  140.143.200.251
-140.143.204.66
  140.143.206.191
  140.143.207.23
  140.143.207.57
  140.143.208.213
  140.143.210.92
  140.143.222.87
-140.143.224.23
  140.143.225.42
  140.143.226.19
  140.143.228.18
  140.143.228.227
  140.143.228.67
-140.143.23.142
  140.143.230.28
  140.143.233.133
  140.143.233.218
@@ -42075,13 +39363,10 @@
  140.143.236.227
  140.143.236.54
  140.143.238.108
-140.143.238.46
  140.143.239.86
  140.143.24.26
  140.143.24.35
-140.143.242.126
  140.143.243.27
-140.143.245.30
  140.143.247.30
  140.143.248.32
  140.143.249.234
@@ -42092,23 +39377,18 @@
  140.143.30.191
  140.143.30.93
  140.143.31.73
-140.143.34.98
-140.143.37.214
  140.143.39.177
  140.143.45.196
+140.143.45.215
  140.143.46.240
-140.143.5.72
  140.143.56.61
  140.143.57.159
  140.143.57.195
  140.143.57.203
-140.143.6.187
  140.143.61.200
  140.143.8.235
  140.143.8.92
  140.143.89.162
-140.143.9.142
-140.143.9.145
  140.143.9.175
  140.143.9.192
  140.143.90.154
@@ -42117,12 +39397,12 @@
  140.143.96.66
  140.147.236.194
  140.148.239.235
+140.148.252.190
  140.186.10.22
  140.186.115.170
  140.186.212.146
  140.186.235.254
  140.186.34.97
-140.186.61.178
  140.186.96.91
  140.190.17.138
  140.190.21.8
@@ -42139,77 +39419,56 @@
  140.206.86.125
  140.207.232.13
  140.207.35.3
-140.207.81.233
+140.207.48.242
  140.207.91.106
  140.207.96.235
  140.210.91.20
  140.210.91.8
-140.213.149.10
-140.213.197.73
-140.224.142.21
+140.213.188.66
+140.224.142.219
  140.224.183.105
-140.227.127.157
  140.237.242.32
  140.237.255.239
  140.237.75.158
  140.237.94.186
-140.238.13.149
-140.238.13.206
-140.238.15.149
+140.238.10.175
  140.238.172.33
  140.238.177.23
  140.238.177.83
-140.238.181.139
  140.238.241.53
  140.238.248.140
  140.238.25.151
  140.238.251.206
-140.238.253.177
  140.238.55.149
  140.238.7.133
  140.238.84.65
-140.240.105.243
+140.240.100.181
+140.240.134.124
  140.240.81.70
-140.246.124.36
  140.246.125.203
  140.246.129.208
-140.246.135.188
  140.246.144.54
  140.246.153.250
-140.246.155.37
-140.246.156.179
  140.246.163.218
-140.246.171.180
-140.246.182.127
-140.246.184.210
-140.246.215.19
-140.246.218.162
  140.246.225.169
-140.246.245.144
  140.246.88.226
  140.249.17.211
  140.249.17.94
  140.249.172.136
-140.249.18.118
  140.249.182.213
-140.249.19.110
  140.249.190.102
-140.249.193.85
  140.249.20.167
  140.249.202.226
  140.249.204.167
  140.249.205.58
  140.249.213.243
-140.249.22.238
  140.249.48.49
  140.249.50.18
-140.249.53.7
  140.250.55.144
+140.250.80.168
  140.255.122.159
-140.255.201.28
  140.255.57.146
  140.82.25.215
-140.82.30.233
  140.82.31.143
  140.82.32.116
  140.82.33.138
@@ -42227,8 +39486,6 @@
  140bd7dca2f0a46e46c62254903e7589-dot-dbenitonline.ey.r.appspot.com
  140teakwood.com
  141.0.11.244
-141.0.11.253
-141.0.146.227
  141.0.226.105
  141.101.143.12
  141.101.143.15
@@ -42240,17 +39497,22 @@
  141.101.143.60
  141.101.143.8
  141.101.25.191
-141.101.69.91
+141.101.68.62
+141.101.69.21
+141.101.69.7
  141.101.8.36
  141.101.98.130
-141.101.98.20
-141.101.98.222
+141.101.98.208
  141.101.98.52
+141.101.99.153
+141.101.99.243
  141.101.99.61
  141.105.105.113
+141.105.105.147
  141.105.105.15
+141.105.105.215
+141.105.105.31
  141.105.132.43
-141.105.137.155
  141.105.141.103
  141.105.197.178
  141.105.36.146
@@ -42265,7 +39527,6 @@
  141.136.11.152
  141.136.133.64
  141.138.141.208
-141.144.61.39
  141.149.36.27
  141.151.238.243
  141.154.10.37
@@ -42275,6 +39536,7 @@
  141.164.90.99
  141.168.109.22
  141.170.15.23
+141.170.28.44
  141.193.115.2
  141.193.155.171
  141.193.158.218
@@ -42300,6 +39562,7 @@
  141.226.1.11
  141.226.122.122
  141.226.18.9
+141.226.22.209
  141.226.27.148
  141.226.6.14
  141.237.5.197
@@ -42312,11 +39575,9 @@
  141.255.155.71
  141.255.157.130
  141.255.166.190
-141.255.167.123
  141.255.19.223
  141.255.24.163
  141.255.28.52
-141.48.223.253
  141.8.126.168
  141.8.143.138
  141.8.143.163
@@ -42326,7 +39587,6 @@
  141.8.143.228
  141.8.225.244
  141.8.226.58
-141.8.55.249
  141.8.55.249bin.sh
  141.85.192.66
  141.85.216.231
@@ -42352,15 +39612,15 @@
  141.98.134.135
  141.98.236.30
  141.98.252.161
+141.98.252.162
  141.98.252.163
  141.98.255.143
-141.98.255.144
  141.98.255.151
  141.98.80.0
  141.98.80.22
  141.98.80.227
  141.98.80.242
-141.98.80.74
+141.98.80.76
  141.98.80.78
  141.98.81.139
  141.98.81.141
@@ -42375,13 +39635,11 @@
  141.98.81.88
  141.98.82.19
  141.98.82.20
-141.98.83.187
-141.98.85.164
  141.98.85.172
  141.98.85.246
-141.98.85.78
  141.98.86.114
  141.98.86.235
+141.98.87.158
  141.98.87.235
  141.98.9.162
  141.98.9.163
@@ -42405,12 +39663,10 @@
  142.0.135.2
  142.0.138.34
  142.11.110.71
-142.11.194.165
  142.11.194.209
  142.11.195.117
  142.11.195.135
  142.11.195.68
-142.11.195.75
  142.11.200.42
  142.11.200.43
  142.11.202.177
@@ -42451,29 +39707,26 @@
  142.11.245.80
  142.11.249.206
  142.11.249.56
-142.11.252.34
-142.11.253.49
  142.11.68.68
-142.111.168.2
+142.111.168.145
  142.111.93.88
  142.111.93.92
  142.112.10.95
  142.112.29.171
  142.112.81.183
  142.113.171.113
-142.113.247.49
  142.114.128.13
  142.114.230.181
  142.115.18.234
+142.116.152.121
  142.120.100.207
  142.120.217.143
  142.122.122.48
-142.126.206.244
  142.127.171.192
  142.129.134.225
  142.129.31.183
+142.147.110.218
  142.163.206.24
-142.165.167.117
  142.165.181.78
  142.167.100.176
  142.169.145.97
@@ -42488,7 +39741,6 @@
  142.234.202.46
  142.234.203.218
  142.234.203.25
-142.234.203.29
  142.252.248.65
  142.4.102.226
  142.4.109.196
@@ -42500,7 +39752,6 @@
  142.4.212.121
  142.4.214.151
  142.4.214.153
-142.4.214.223
  142.4.215.194
  142.4.218.94
  142.4.223.125
@@ -42514,18 +39765,14 @@
  142.44.142.226
  142.44.146.33
  142.44.156.131
-142.44.160.173
-142.44.160.214
  142.44.160.40
  142.44.161.132
  142.44.162.161
-142.44.162.188
  142.44.162.232
  142.44.166.21
  142.44.167.113
  142.44.173.131
  142.44.173.134
-142.44.180.25
  142.44.184.205
  142.44.185.242
  142.44.199.30
@@ -42537,7 +39784,6 @@
  142.44.213.234
  142.44.214.3
  142.44.218.192
-142.44.223.237
  142.44.232.99
  142.44.242.38
  142.44.246.156
@@ -42570,24 +39816,19 @@
  142.91.62.232
  142.91.62.251
  142.93.0.252
-142.93.1.100
  142.93.1.103
  142.93.10.17
  142.93.100.171
  142.93.101.111
  142.93.101.148
-142.93.101.30
  142.93.102.204
  142.93.102.231
  142.93.103.141
-142.93.104.32
  142.93.104.92
-142.93.105.147
  142.93.106.56
  142.93.107.175
  142.93.109.153
  142.93.109.28
-142.93.109.76
  142.93.11.169
  142.93.11.193
  142.93.110.53
@@ -42597,12 +39838,9 @@
  142.93.113.159
  142.93.113.72
  142.93.113.75
-142.93.114.213
  142.93.115.12
-142.93.115.47
  142.93.116.106
  142.93.116.254
-142.93.117.69
  142.93.118.23
  142.93.118.74
  142.93.121.117
@@ -42615,26 +39853,21 @@
  142.93.127.16
  142.93.13.5
  142.93.130.169
-142.93.130.58
  142.93.131.1
  142.93.133.78
  142.93.134.141
  142.93.134.86
  142.93.135.171
-142.93.137.144
  142.93.137.184
  142.93.138.73
  142.93.139.122
  142.93.14.175
-142.93.140.242
  142.93.142.192
  142.93.143.85
  142.93.145.85
  142.93.146.198
  142.93.146.94
-142.93.15.179
  142.93.150.121
-142.93.150.175
  142.93.150.84
  142.93.151.62
  142.93.152.142
@@ -42644,19 +39877,15 @@
  142.93.153.132
  142.93.153.184
  142.93.153.203
-142.93.154.174
  142.93.154.212
  142.93.154.225
  142.93.155.50
-142.93.156.124
  142.93.158.162
  142.93.159.172
-142.93.159.29
  142.93.162.220
-142.93.162.84
  142.93.163.152
  142.93.166.13
-142.93.166.76
+142.93.168.119
  142.93.170.135
  142.93.171.37
  142.93.172.106
@@ -42677,7 +39906,6 @@
  142.93.192.43
  142.93.194.160
  142.93.194.76
-142.93.195.15
  142.93.195.157
  142.93.196.13
  142.93.196.163
@@ -42686,14 +39914,12 @@
  142.93.197.186
  142.93.198.133
  142.93.198.209
-142.93.200.252
  142.93.200.9
  142.93.201.1
  142.93.201.10
  142.93.202.228
  142.93.202.94
  142.93.203.102
-142.93.203.50
  142.93.206.202
  142.93.207.94
  142.93.208.205
@@ -42701,20 +39927,17 @@
  142.93.209.158
  142.93.21.188
  142.93.210.229
-142.93.211.44
-142.93.211.52
+142.93.211.36
  142.93.212.10
-142.93.212.213
  142.93.212.91
  142.93.213.210
  142.93.213.254
-142.93.214.21
  142.93.214.86
  142.93.215.82
  142.93.216.251
-142.93.216.68
  142.93.216.97
  142.93.217.166
+142.93.217.221
  142.93.217.46
  142.93.218.104
  142.93.220.102
@@ -42724,14 +39947,11 @@
  142.93.220.81
  142.93.222.121
  142.93.223.118
-142.93.223.33
  142.93.223.95
  142.93.224.234
  142.93.225.68
-142.93.226.18
  142.93.228.111
  142.93.23.235
-142.93.232.102
  142.93.235.118
  142.93.235.14
  142.93.235.47
@@ -42740,7 +39960,6 @@
  142.93.237.176
  142.93.237.57
  142.93.238.233
-142.93.239.197
  142.93.239.251
  142.93.240.141
  142.93.240.192
@@ -42749,7 +39968,6 @@
  142.93.241.19
  142.93.242.127
  142.93.242.246
-142.93.243.122
  142.93.244.184
  142.93.245.137
  142.93.245.208
@@ -42762,7 +39980,6 @@
  142.93.245.253
  142.93.245.61
  142.93.246.42
-142.93.247.221
  142.93.248.50
  142.93.249.29
  142.93.249.7
@@ -42780,7 +39997,6 @@
  142.93.37.1
  142.93.38.61
  142.93.40.98
-142.93.42.177
  142.93.43.120
  142.93.44.136
  142.93.44.155
@@ -42789,25 +40005,17 @@
  142.93.45.250
  142.93.46.198
  142.93.47.124
-142.93.48.155
  142.93.49.148
-142.93.49.164
+142.93.52.174
  142.93.52.3
-142.93.53.214
  142.93.55.166
-142.93.56.12
  142.93.56.221
  142.93.56.57
-142.93.57.0
  142.93.57.255
  142.93.57.37
  142.93.58.103
  142.93.58.97
-142.93.6.190
  142.93.6.38
-142.93.60.53
-142.93.60.92
-142.93.62.231
  142.93.62.240
  142.93.65.199
  142.93.65.72
@@ -42842,6 +40050,7 @@
  142.93.91.224
  142.93.94.49
  142.93.98.144
+142.93.99.114
  142.93.99.56
  142.ip-164-132-197.eu
  1423-thurman.com
@@ -42856,18 +40065,21 @@
  143.0.167.23
  143.0.177.198
  143.0.178.142
+143.0.179.138
+143.0.179.141
  143.0.179.55
  143.0.196.213
  143.0.20.247
  143.0.231.178
-143.0.232.36
  143.0.54.206
  143.0.56.227
  143.0.64.145
  143.0.87.101
+143.107.106.11
  143.107.117.11
  143.107.117.23
  143.110.128.19
+143.110.144.158
  143.110.147.127
  143.110.147.129
  143.110.147.13
@@ -42877,6 +40089,7 @@
  143.110.147.247
  143.110.150.192
  143.110.150.82
+143.110.154.3
  143.110.155.22
  143.110.157.100
  143.110.157.105
@@ -42887,7 +40100,6 @@
  143.110.159.212
  143.110.159.213
  143.110.159.221
-143.110.172.95
  143.110.177.114
  143.110.177.119
  143.110.177.17
@@ -42897,7 +40109,6 @@
  143.110.178.252
  143.110.179.185
  143.110.179.186
-143.110.181.0
  143.110.181.137
  143.110.181.250
  143.110.181.63
@@ -42939,6 +40150,7 @@
  143.110.191.247
  143.110.191.61
  143.110.200.144
+143.110.208.144
  143.110.208.29
  143.110.224.166
  143.110.224.212
@@ -42972,7 +40184,6 @@
  143.110.240.25
  143.110.99.104
  143.125.235.2
-143.137.117.127
  143.137.125.74
  143.137.125.82
  143.137.126.36
@@ -42981,11 +40192,9 @@
  143.137.127.46
  143.137.130.1
  143.137.145.75
-143.137.163.24
  143.137.30.165
  143.137.31.141
  143.137.31.168
-143.137.72.140
  143.159.111.211
  143.159.142.54
  143.176.224.104
@@ -43003,18 +40212,17 @@
  143.202.163.94
  143.202.164.84
  143.202.225.111
+143.202.226.112
  143.202.97.193
  143.208.126.174
  143.208.128.152
  143.208.128.175
  143.208.128.6
-143.208.135.240
  143.208.152.124
  143.215.130.33
  143.225.81.253
  143.244.37.238
-143.244.38.159
-143.244.39.198
+143.244.43.158
  143.244.54.103
  143.248.144.60
  143.248.230.86
@@ -43034,7 +40242,6 @@
  143.255.52.195
  143.255.52.198
  143.255.52.67
-143.255.8.2
  143.255.86.13
  143.59.105.199
  143.59.74.139
@@ -43054,12 +40261,9 @@
  143.92.61.230
  143.95.101.72
  143.95.156.174
-143.95.252.209
  144.121.29.100
  144.123.1.234
-144.123.160.252
  144.123.160.253
-144.123.160.254
  144.123.36.14
  144.123.5.178
  144.137.18.106
@@ -43073,7 +40277,7 @@
  144.139.56.105
  144.139.91.187
  144.168.107.2
-144.168.157.139
+144.168.138.29
  144.168.164.26
  144.168.201.194
  144.168.201.204
@@ -43084,7 +40288,6 @@
  144.172.118.2
  144.172.118.3
  144.172.126.116
-144.172.137.106
  144.172.156.145
  144.172.197.224
  144.172.241.69
@@ -43095,7 +40298,6 @@
  144.172.64.51
  144.172.64.57
  144.172.64.65
-144.172.70.144
  144.172.71.182
  144.172.73.35
  144.172.75.4
@@ -43108,7 +40310,6 @@
  144.2.73.168
  144.202.100.47
  144.202.108.244
-144.202.111.97
  144.202.120.7
  144.202.124.184
  144.202.124.211
@@ -43143,12 +40344,10 @@
  144.208.127.168
  144.208.127.210
  144.208.65.145
-144.217.0.43
  144.217.101.245
  144.217.105.118
  144.217.105.209
  144.217.117.146
-144.217.12.194
  144.217.12.95
  144.217.128.227
  144.217.13.109
@@ -43166,14 +40365,12 @@
  144.217.165.143
  144.217.172.41
  144.217.174.212
-144.217.19.109
-144.217.19.8
+144.217.183.134
  144.217.190.197
  144.217.190.215
  144.217.191.227
  144.217.197.6
  144.217.20.147
-144.217.203.24
  144.217.207.15
  144.217.207.37
  144.217.207.56
@@ -43181,7 +40378,6 @@
  144.217.211.2
  144.217.240.89
  144.217.241.5
-144.217.242.247
  144.217.243.216
  144.217.245.243
  144.217.252.18
@@ -43190,16 +40386,13 @@
  144.217.34.148
  144.217.34.151
  144.217.39.93
-144.217.42.212
  144.217.50.88
  144.217.54.7
-144.217.55.70
  144.217.60.211
  144.217.60.239
  144.217.65.241
  144.217.67.83
  144.217.7.33
-144.217.7.75
  144.217.70.190
  144.217.76.18
  144.217.80.80
@@ -43208,12 +40401,8 @@
  144.217.83.225
  144.217.84.164
  144.217.84.165
-144.217.85.4
  144.217.87.197
  144.217.89.55
-144.217.92.167
-144.217.94.188
-144.217.95.97
  144.22.108.33
  144.22.98.225
  144.224.27.66
@@ -43241,19 +40430,17 @@
  144.34.194.39
  144.34.196.101
  144.34.201.197
-144.34.202.244
  144.34.203.73
-144.34.210.56
  144.34.226.207
  144.34.234.6
  144.34.240.47
-144.34.248.219
  144.48.106.61
  144.48.109.179
  144.48.109.180
  144.48.109.182
  144.48.165.252
  144.48.168.121
+144.48.168.124
  144.48.168.128
  144.48.168.133
  144.48.168.141
@@ -43279,12 +40466,10 @@
  144.48.9.159
  144.48.9.207
  144.52.158.61
-144.52.162.152
  144.52.178.225
  144.64.12.241
  144.64.131.110
  144.64.177.197
-144.64.3.101
  144.64.5.177
  144.76.1.155
  144.76.1.20
@@ -43304,7 +40489,6 @@
  144.76.13.207
  144.76.134.212
  144.76.136.174
-144.76.14.153
  144.76.15.207
  144.76.15.232
  144.76.15.240
@@ -43349,7 +40533,6 @@
  144.76.45.132
  144.76.56.36
  144.76.58.227
-144.76.60.198
  144.76.60.200
  144.76.61.21
  144.76.61.238
@@ -43378,13 +40561,10 @@
  144.76.98.163
  144.76.99.197
  144.76.99.207
-144.91.108.175
  144.91.111.114
  144.91.116.44
  144.91.127.135
  144.91.66.137
-144.91.66.206
-144.91.67.1
  144.91.67.109
  144.91.67.228
  144.91.69.193
@@ -43392,11 +40572,10 @@
  144.91.71.27
  144.91.72.11
  144.91.73.41
-144.91.73.88
  144.91.77.184
-144.91.77.196
  144.91.82.22
  144.91.83.174
+144.91.84.228
  144.91.85.69
  144.91.87.106
  144.91.87.159
@@ -43406,24 +40585,18 @@
  1441518k4-85975353079.us-south.cf.appdomain.cloud
  1445.3190cfdae.com
  145-365.net
-145.100.57.17
  145.130.46.204
  145.131.152.152
  145.131.25.134
  145.131.25.239
  145.131.25.242
-145.131.4.90
  145.132.117.235
  145.132.50.204
  145.14.157.145
-145.14.172.2
-145.14.180.156
  145.14.192.206
  145.220.0.46
  145.220.25.28
-145.236.69.237
  145.236.82.17
-145.239.102.201
  145.239.103.151
  145.239.11.53
  145.239.110.129
@@ -43437,17 +40610,12 @@
  145.239.142.148
  145.239.144.188
  145.239.144.32
-145.239.154.240
-145.239.156.84
  145.239.16.78
  145.239.168.121
  145.239.176.47
  145.239.178.144
  145.239.184.38
  145.239.188.142
-145.239.188.66
-145.239.196.14
-145.239.198.218
  145.239.209.0
  145.239.21.235
  145.239.211.242
@@ -43476,11 +40644,9 @@
  145.239.51.233
  145.239.6.55
  145.239.64.167
+145.239.64.96
  145.239.67.61
  145.239.69.74
-145.239.72.142
-145.239.76.62
-145.239.78.59
  145.239.8.65
  145.239.80.14
  145.239.82.102
@@ -43491,10 +40657,8 @@
  145.239.82.192
  145.239.82.229
  145.239.82.87
-145.239.83.104
  145.239.85.21
  145.239.86.217
-145.239.86.227
  145.239.87.35
  145.239.88.43
  145.239.89.111
@@ -43503,7 +40667,6 @@
  145.239.91.191
  145.239.91.37
  145.239.91.73
-145.239.92.211
  145.239.92.26
  145.239.95.15
  145.239.95.219
@@ -43525,7 +40688,6 @@
  145.255.10.152
  145.255.11.158
  145.255.11.179
-145.255.141.80
  145.255.2.11
  145.255.2.211
  145.255.202.115
@@ -43534,7 +40696,6 @@
  145.255.28.2
  145.255.3.134
  145.255.3.84
-145.255.31.188
  145.255.4.150
  145.255.4.251
  145.31cf4fdae.com
@@ -43545,7 +40706,6 @@
  14577.000webhostapp.com
  146.0.36.43
  146.0.36.52
-146.0.41.70
  146.0.43.105
  146.0.43.107
  146.0.72.68
@@ -43562,25 +40722,17 @@
  146.0.77.96
  146.0.78.124
  146.0.78.51
-146.115.100.130
-146.115.166.2
  146.115.25.217
  146.115.40.98
  146.115.58.159
  146.120.101.114
  146.120.168.164
  146.120.168.165
-146.120.168.166
  146.120.168.167
-146.120.168.172
-146.120.168.174
  146.120.168.188
  146.120.168.191
  146.120.168.194
-146.120.197.77
  146.120.215.106
-146.120.91.249
-146.120.97.41
  146.148.101.151
  146.148.114.236
  146.148.122.132
@@ -43604,7 +40756,6 @@
  146.185.128.226
  146.185.129.107
  146.185.129.182
-146.185.129.216
  146.185.130.101
  146.185.130.42
  146.185.131.234
@@ -43622,7 +40773,6 @@
  146.185.142.71
  146.185.144.23
  146.185.145.128
-146.185.145.222
  146.185.146.127
  146.185.146.82
  146.185.146.99
@@ -43630,7 +40780,6 @@
  146.185.147.59
  146.185.149.93
  146.185.150.186
-146.185.151.233
  146.185.151.234
  146.185.152.13
  146.185.154.146
@@ -43648,10 +40797,10 @@
  146.185.170.116
  146.185.170.225
  146.185.172.229
-146.185.180.60
  146.185.181.64
  146.185.182.59
  146.185.200.101
+146.185.200.103
  146.185.200.104
  146.185.200.108
  146.185.200.110
@@ -43770,8 +40919,7 @@
  146.185.205.27
  146.185.206.166
  146.185.214.29
-146.185.218.240
-146.185.219.169
+146.185.219.168
  146.185.239.100
  146.185.251.188
  146.185.253.113
@@ -43790,6 +40938,7 @@
  146.196.98.156
  146.196.98.202
  146.199.25.233
+146.199.97.81
  146.20.103.191
  146.20.103.208
  146.20.110.77
@@ -43805,12 +40954,14 @@
  146.247.25.81
  146.247.49.146
  146.247.85.155
+146.255.110.230
  146.255.181.249
  146.255.24.28
  146.255.81.98
  146.255.96.214
  146.52.108.135
  146.52.205.151
+146.52.61.38
  146.56.192.60
  146.56.193.203
  146.56.196.229
@@ -43822,7 +40973,6 @@
  146.56.203.227
  146.56.203.75
  146.56.206.217
-146.56.207.141
  146.56.207.177
  146.56.209.252
  146.56.220.95
@@ -43834,6 +40984,7 @@
  146.59.146.249
  146.59.148.232
  146.59.153.189
+146.59.154.120
  146.59.154.68
  146.59.155.27
  146.59.157.40
@@ -43842,18 +40993,19 @@
  146.59.159.162
  146.59.160.240
  146.59.166.160
-146.59.172.62
  146.59.172.66
  146.59.196.157
  146.59.196.27
  146.59.217.53
+146.59.225.194
  146.59.225.195
+146.59.225.232
  146.59.226.110
  146.59.227.64
  146.59.228.212
  146.59.228.213
+146.60.249.184
  146.66.194.20
-146.66.244.246
  146.67.141.87
  146.71.112.18
  146.71.77.152
@@ -43867,12 +41019,9 @@
  146.88.78.130
  146.90.146.33
  1469-squid.com
-147.0.103.178
-147.0.22.179
  147.114.226.194
  147.135.1.79
  147.135.10.96
-147.135.105.22
  147.135.105.62
  147.135.11.41
  147.135.114.247
@@ -43893,42 +41042,37 @@
  147.135.182.62
  147.135.203.181
  147.135.207.246
+147.135.211.127
+147.135.211.73
  147.135.231.210
  147.135.246.41
  147.135.252.43
  147.135.3.105
-147.135.30.171
  147.135.39.240
  147.135.44.176
  147.135.6.179
  147.135.73.114
  147.135.76.206
  147.135.93.133
+147.139.134.59
  147.139.135.159
  147.139.135.223
  147.139.138.57
-147.139.160.218
  147.139.163.83
-147.139.165.98
-147.139.168.137
  147.139.171.156
-147.139.172.122
-147.139.179.112
-147.139.180.46
-147.139.189.77
+147.139.176.65
+147.139.180.189
  147.139.193.121
-147.139.31.203
-147.139.32.154
+147.139.195.117
+147.139.32.95
+147.139.33.149
  147.139.34.137
  147.139.34.238
  147.139.37.49
  147.139.5.160
-147.139.6.198
  147.139.6.81
  147.148.45.108
-147.158.191.174
  147.158.237.114
-147.158.4.183
  147.194.100.74
  147.203.238.18
  147.229.13.210
@@ -43943,16 +41087,15 @@
  147.30.92.35
  147.30.99.10
  147.46.40.220
-147.50.135.171
-147.75.118.230
+147.75.113.110
+147.75.118.226
+147.75.118.236
  147.75.47.199
-147.78.160.2
  147.78.65.100
  147.78.65.253
  147.78.66.172
  147.83.195.55
-147.91.111.133
-147.91.111.134
+147.91.111.100
  147.91.111.17
  147.91.249.14
  147.91.249.7
@@ -43961,18 +41104,17 @@
  148.0.237.76
  148.0.30.161
  148.0.35.69
+148.0.36.163
  148.0.45.180
  148.0.59.253
  148.0.84.6
-148.101.12.159
  148.101.25.153
  148.101.27.141
  148.101.66.160
-148.101.78.70
-148.102.17.19
  148.102.22.76
  148.102.25.170
  148.102.48.43
+148.102.83.42
  148.103.51.2
  148.103.9.41
  148.153.11.58
@@ -43997,14 +41139,10 @@
  148.217.94.54
  148.222.45.3
  148.223.120.122
-148.223.224.70
  148.228.214.141
  148.233.37.49
-148.233.85.165
  148.235.42.146
  148.235.42.147
-148.235.57.183
-148.235.57.184
  148.235.82.68
  148.235.92.34
  148.240.238.91
@@ -44019,7 +41157,6 @@
  148.243.72.112
  148.244.120.105
  148.244.120.68
-148.244.143.30
  148.245.13.21
  148.251.105.254
  148.251.110.53
@@ -44038,7 +41175,6 @@
  148.251.178.165
  148.251.178.72
  148.251.18.67
-148.251.186.234
  148.251.186.36
  148.251.19.205
  148.251.195.14
@@ -44047,7 +41183,6 @@
  148.251.22.104
  148.251.22.209
  148.251.22.59
-148.251.233.233
  148.251.236.212
  148.251.236.72
  148.251.237.73
@@ -44069,11 +41204,9 @@
  148.251.84.22
  148.251.87.112
  148.255.100.41
-148.255.41.120
  148.3.45.27
-148.56.239.38
+148.3.50.163
  148.56.84.67
-148.59.185.68
  148.59.220.62
  148.63.215.173
  148.66.129.112
@@ -44102,67 +41235,48 @@
  148.66.58.138
  148.66.58.146
  148.66.59.82
+148.66.62.114
  148.66.63.202
  148.69.222.213
  148.69.241.177
  148.70.102.225
  148.70.102.24
  148.70.102.69
-148.70.108.183
  148.70.112.177
  148.70.118.113
-148.70.118.201
  148.70.123.42
-148.70.125.42
  148.70.129.112
  148.70.132.213
-148.70.133.175
  148.70.14.121
  148.70.14.124
-148.70.141.98
  148.70.149.39
-148.70.15.205
-148.70.152.22
  148.70.153.21
  148.70.154.166
-148.70.157.213
  148.70.160.127
-148.70.161.115
  148.70.171.31
  148.70.173.252
  148.70.178.70
  148.70.18.216
  148.70.181.166
-148.70.183.250
-148.70.186.210
  148.70.195.242
  148.70.209.112
-148.70.223.115
-148.70.223.218
  148.70.227.100
-148.70.229.122
  148.70.229.221
-148.70.234.104
  148.70.241.101
  148.70.241.30
  148.70.250.254
-148.70.251.58
-148.70.29.56
  148.70.31.188
-148.70.34.160
-148.70.34.230
  148.70.38.183
  148.70.39.4
  148.70.52.161
-148.70.68.36
  148.70.7.149
+148.70.7.7
  148.70.70.55
-148.70.72.242
  148.70.77.116
  148.70.84.202
  148.70.89.212
+148.70.9.35
  148.70.93.176
-148.71.74.116
  148.72.105.246
  148.72.132.200
  148.72.133.152
@@ -44174,6 +41288,7 @@
  148.72.208.210
  148.72.208.36
  148.72.209.9
+148.72.210.140
  148.72.210.224
  148.72.211.177
  148.72.211.251
@@ -44188,60 +41303,49 @@
  148.72.232.35
  148.72.232.36
  148.72.232.63
-148.72.60.41
-148.72.64.192
-148.72.65.10
  148.72.65.173
  148.72.65.90
  148.74.192.37
+148.74.235.233
  148.75.116.82
  148.75.47.66
-148.77.14.106
  148.77.34.194
  148.77.34.196
  148.77.34.200
  148.81.111.91
  148117-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+149.0.218.169
  149.107.0.76
  149.115.213.163
  149.12.216.143
-149.12.217.235
  149.12.223.69
  149.129.101.217
  149.129.102.110
-149.129.128.16
  149.129.129.91
  149.129.184.49
-149.129.190.133
-149.129.191.205
  149.129.214.172
  149.129.222.49
  149.129.222.54
-149.129.222.60
-149.129.223.90
-149.129.225.229
-149.129.233.149
  149.129.233.28
  149.129.235.128
-149.129.242.144
+149.129.236.66
+149.129.241.21
+149.129.244.23
  149.129.244.83
-149.129.251.152
+149.129.245.133
  149.129.253.48
  149.129.255.214
  149.129.255.55
-149.129.36.71
+149.129.36.147
  149.129.39.164
  149.129.41.70
  149.129.52.124
  149.129.52.21
  149.129.53.156
-149.129.55.74
+149.129.54.153
  149.129.57.134
  149.129.58.51
-149.129.60.191
-149.129.61.202
  149.129.61.6
-149.129.63.20
  149.129.68.143
  149.129.69.148
  149.129.90.72
@@ -44252,19 +41356,20 @@
  149.154.154.156
  149.154.157.147
  149.156.236.68
-149.20.241.11
  149.200.135.160
  149.200.156.68
  149.200.158.211
  149.200.166.213
  149.200.177.3
  149.200.180.7
+149.200.183.96
  149.200.20.1
  149.200.212.227
  149.200.226.124
  149.200.233.111
  149.200.237.199
  149.200.244.120
+149.200.244.160
  149.200.251.0
  149.200.88.169
  149.202.102.36
@@ -44274,7 +41379,6 @@
  149.202.115.3
  149.202.12.9
  149.202.125.153
-149.202.133.43
  149.202.148.4
  149.202.152.178
  149.202.160.188
@@ -44307,11 +41411,8 @@
  149.202.247.161
  149.202.29.73
  149.202.38.124
-149.202.4.243
-149.202.40.210
  149.202.42.188
  149.202.44.177
-149.202.45.11
  149.202.47.15
  149.202.48.176
  149.202.48.192
@@ -44330,6 +41431,7 @@
  149.202.79.125
  149.202.8.66
  149.202.81.92
+149.202.82.11
  149.202.83.78
  149.202.86.18
  149.202.87.175
@@ -44342,17 +41444,17 @@
  149.210.160.125
  149.210.169.10
  149.210.189.102
+149.210.197.202
  149.224.123.238
  149.224.126.236
  149.224.138.183
-149.224.154.147
-149.224.177.30
+149.224.216.12
  149.224.241.236
  149.224.246.16
-149.224.248.20
  149.224.25.207
  149.224.46.222
  149.224.55.31
+149.224.59.109
  149.224.63.162
  149.224.82.201
  149.248.10.11
@@ -44362,20 +41464,20 @@
  149.248.63.2
  149.248.8.73
  149.248.9.85
+149.255.0.145
  149.255.104.205
  149.255.154.62
  149.255.31.216
  149.255.35.91
  149.255.36.133
-149.255.60.154
  149.255.62.89
  149.28.101.114
-149.28.105.198
  149.28.112.35
  149.28.113.236
  149.28.117.43
  149.28.118.60
  149.28.13.243
+149.28.130.42
  149.28.132.200
  149.28.132.214
  149.28.132.27
@@ -44384,6 +41486,7 @@
  149.28.149.164
  149.28.149.39
  149.28.150.224
+149.28.151.102
  149.28.155.253
  149.28.157.237
  149.28.159.30
@@ -44401,7 +41504,6 @@
  149.28.199.128
  149.28.204.170
  149.28.209.233
-149.28.215.180
  149.28.224.80
  149.28.24.180
  149.28.247.47
@@ -44456,18 +41558,16 @@
  149.34.3.55
  149.34.6.162
  149.56.1.48
-149.56.100.237
  149.56.101.170
  149.56.102.43
+149.56.108.216
  149.56.115.70
  149.56.115.99
  149.56.12.88
  149.56.128.135
-149.56.129.68
  149.56.13.111
  149.56.13.158
  149.56.130.248
-149.56.130.61
  149.56.131.140
  149.56.132.202
  149.56.133.137
@@ -44479,7 +41579,6 @@
  149.56.15.98
  149.56.151.196
  149.56.170.37
-149.56.172.224
  149.56.186.152
  149.56.19.4
  149.56.192.110
@@ -44520,7 +41619,6 @@
  149.62.173.247
  149.7.16.100
  149.7.16.30
-149.7.217.27
  149.71.33.201
  149.72.177.166
  149.74.120.231
@@ -44530,6 +41628,7 @@
  149.81.65.11
  149.90.137.174
  149.90.194.82
+149.91.114.90
  149.91.80.7
  149.91.88.136
  1493-security-dispatch.com
@@ -44543,6 +41642,7 @@
  15.161.128.6
  15.161.153.204
  15.161.245.6
+15.161.33.29
  15.161.54.116
  15.161.90.31
  15.161.92.197
@@ -44568,7 +41668,6 @@
  15.206.146.144
  15.206.159.210
  15.206.194.114
-15.206.194.92
  15.206.50.74
  15.206.67.217
  15.206.74.161
@@ -44580,14 +41679,12 @@
  15.207.111.189
  15.207.112.66
  15.207.116.17
-15.207.122.75
  15.207.19.192
  15.207.203.184
  15.207.42.217
  15.222.181.56
  15.223.114.10
  15.223.116.208
-15.228.13.166
  15.228.28.172
  15.228.41.112
  15.228.87.193
@@ -44628,7 +41725,6 @@
  150.109.146.32
  150.109.147.145
  150.109.15.69
-150.109.150.65
  150.109.150.77
  150.109.151.206
  150.109.16.122
@@ -44721,23 +41817,16 @@
  150.109.37.160
  150.109.39.213
  150.109.39.220
-150.109.4.232
  150.109.40.135
-150.109.45.228
  150.109.47.167
  150.109.5.248
-150.109.50.166
  150.109.50.64
-150.109.52.213
-150.109.53.204
  150.109.57.135
  150.109.57.43
-150.109.58.69
  150.109.61.134
  150.109.63.146
  150.109.63.204
  150.109.66.212
-150.109.74.11
  150.109.76.59
  150.109.82.109
  150.109.84.143
@@ -44748,7 +41837,7 @@
  150.116.126.14
  150.116.134.185
  150.116.155.35
-150.116.35.194
+150.116.20.16
  150.117.166.13
  150.117.193.63
  150.117.89.55
@@ -44765,18 +41854,13 @@
  150.129.250.28
  150.129.52.74
  150.129.54.111
-150.129.56.162
-150.129.56.4
  150.129.63.162
  150.129.8.10
  150.129.8.32
  150.129.8.7
  150.136.101.219
-150.136.102.101
-150.136.104.91
  150.136.105.202
  150.136.105.230
-150.136.111.213
  150.136.116.126
  150.136.12.28
  150.136.127.89
@@ -44788,19 +41872,16 @@
  150.136.152.190
  150.136.160.141
  150.136.169.139
-150.136.172.173
  150.136.183.102
  150.136.208.168
  150.136.21.3
  150.136.21.93
-150.136.213.168
-150.136.214.254
+150.136.214.215
  150.136.215.21
  150.136.220.58
  150.136.220.59
  150.136.238.74
  150.136.241.199
-150.136.245.92
  150.136.246.125
  150.136.248.42
  150.136.31.34
@@ -44810,10 +41891,7 @@
  150.136.40.83
  150.136.68.61
  150.136.74.148
-150.136.8.55
  150.136.81.55
-150.136.94.7
-150.136.95.152
  150.136.99.11
  150.138.106.174
  150.138.113.45
@@ -44822,10 +41900,8 @@
  150.138.153.52
  150.138.216.111
  150.138.253.71
-150.138.253.72
+150.142.255.103
  150.143.137.230
-150.147.215.30
-150.158.104.229
  150.158.110.27
  150.158.111.251
  150.158.113.106
@@ -44843,7 +41919,6 @@
  150.158.156.160
  150.158.156.214
  150.158.158.34
-150.158.159.125
  150.158.159.223
  150.158.159.37
  150.158.160.166
@@ -44855,7 +41930,6 @@
  150.158.165.191
  150.158.165.46
  150.158.167.200
-150.158.168.92
  150.158.171.232
  150.158.171.53
  150.158.172.110
@@ -44864,9 +41938,6 @@
  150.158.174.174
  150.158.174.230
  150.158.174.51
-150.158.175.63
-150.158.176.98
-150.158.178.137
  150.158.179.35
  150.158.181.16
  150.158.185.227
@@ -44888,21 +41959,17 @@
  150.187.5.100
  150.214.64.131
  150.223.13.155
-150.223.17.95
-150.223.8.92
-150.238.103.83
  150.242.15.81
  150.242.170.34
+150.242.182.98
  150.242.185.17
  150.242.219.5
-150.242.24.141
  150.242.24.152
  150.242.249.193
  150.242.254.51
  150.242.255.161
  150.242.255.208
  150.242.96.135
-150.242.97.109
  150.242.98.199
  150.242.98.20
  150.242.98.92
@@ -44923,7 +41990,6 @@
  150.95.132.74
  150.95.138.39
  150.95.141.172
-150.95.143.2
  150.95.148.208
  150.95.152.96
  150.95.153.82
@@ -44934,7 +42000,6 @@
  150.95.180.105
  150.95.204.25
  150.95.211.169
-150.95.212.62
  150.95.216.176
  150.95.220.180
  150.95.220.250
@@ -44955,16 +42020,13 @@
  150.95.54.138
  150.95.64.26
  150.95.66.29
-150.95.81.40
  150.95.82.42
  15006000001.mer.lstest.siquality.com
  150100.cn
  1504setup.com
  151-248-126-42.ovz.vps.regruhosting.ru
  151.0.10.59
-151.0.145.98
  151.0.173.145
-151.0.2.242
  151.0.218.243
  151.0.250.162
  151.0.56.78
@@ -44995,10 +42057,12 @@
  151.106.13.150
  151.106.13.158
  151.106.15.42
+151.106.3.179
  151.106.30.102
  151.106.34.139
  151.106.35.50
  151.106.53.199
+151.106.55.86
  151.106.57.35
  151.106.59.205
  151.106.6.142
@@ -45075,7 +42139,6 @@
  151.115.44.174
  151.115.44.179
  151.115.44.207
-151.115.44.28
  151.115.44.68
  151.115.45.104
  151.115.45.14
@@ -45121,7 +42184,6 @@
  151.115.52.240
  151.115.52.62
  151.115.52.83
-151.115.53.185
  151.115.53.20
  151.115.53.202
  151.115.53.216
@@ -45186,16 +42248,23 @@
  151.177.214.50
  151.177.225.150
  151.177.63.86
-151.18.184.243
+151.18.154.244
+151.18.166.229
+151.18.181.30
+151.18.186.27
  151.182.29.25
  151.182.44.17
  151.19.197.223
+151.19.205.120
  151.19.215.73
+151.19.22.217
+151.19.62.242
  151.192.151.213
  151.192.225.191
  151.192.248.125
  151.196.57.128
  151.197.61.55
+151.20.167.216
  151.20.232.201
  151.20.239.224
  151.20.44.147
@@ -45209,22 +42278,20 @@
  151.226.169.59
  151.227.87.117
  151.228.114.115
-151.229.223.153
-151.229.251.241
  151.230.166.202
  151.231.130.16
  151.232.151.176
  151.232.26.53
+151.234.158.84
+151.234.55.116
  151.236.193.195
  151.236.218.195
  151.236.33.74
  151.236.34.161
-151.236.38.206
  151.236.38.234
  151.236.58.222
  151.236.59.246
  151.236.60.57
-151.236.62.211
  151.237.141.196
  151.237.184.52
  151.237.185.110
@@ -45233,7 +42300,6 @@
  151.237.36.220
  151.237.80.166
  151.239.232.37
-151.24.245.156
  151.240.10.97
  151.241.215.128
  151.248.126.76
@@ -45249,7 +42315,6 @@
  151.250.59.60
  151.252.105.136
  151.252.108.224
-151.252.79.7
  151.252.85.90
  151.253.125.136
  151.253.125.137
@@ -45260,33 +42325,31 @@
  151.27.234.155
  151.27.31.107
  151.28.198.252
-151.29.20.243
  151.30.225.52
  151.31.201.99
  151.32.248.136
-151.32.76.227
  151.35.144.104
-151.35.217.29
-151.35.60.94
  151.36.2.158
-151.36.40.156
-151.36.70.97
+151.36.79.46
+151.36.93.28
+151.37.133.227
+151.38.174.198
  151.38.23.119
  151.40.125.91
  151.40.169.254
  151.40.77.245
-151.40.92.176
  151.41.110.41
  151.41.41.123
  151.41.45.1
-151.41.60.54
-151.45.233.1
+151.41.57.207
+151.43.199.61
+151.46.202.138
  151.48.122.146
  151.48.136.222
-151.48.168.114
  151.48.189.27
  151.49.170.162
  151.49.177.185
+151.49.206.222
  151.49.210.152
  151.50.142.80
  151.50.170.221
@@ -45300,24 +42363,23 @@
  151.52.93.48
  151.52.95.14
  151.55.117.0
-151.55.180.37
-151.55.185.248
  151.55.24.139
  151.55.84.241
  151.56.210.156
+151.57.162.5
  151.57.193.40
  151.57.196.44
  151.60.1.201
+151.61.89.241
  151.62.113.58
  151.62.121.83
  151.62.14.252
-151.62.236.151
-151.62.250.73
  151.62.64.222
-151.63.116.233
+151.62.72.101
  151.64.216.111
  151.64.238.218
  151.64.55.191
+151.65.124.157
  151.65.192.203
  151.67.162.63
  151.69.170.146
@@ -45329,14 +42391,12 @@
  151.72.111.171
  151.72.99.219
  151.73.170.146
-151.73.178.7
  151.73.48.127
  151.74.210.102
  151.74.56.174
  151.74.78.65
  151.75.102.207
  151.75.115.53
-151.75.116.97
  151.75.18.188
  151.76.122.104
  151.76.221.86
@@ -45354,7 +42414,6 @@
  151.80.142.33
  151.80.149.223
  151.80.149.75
-151.80.153.174
  151.80.155.98
  151.80.159.18
  151.80.162.250
@@ -45386,14 +42445,12 @@
  151.80.255.19
  151.80.26.227
  151.80.29.98
-151.80.34.22
  151.80.38.19
  151.80.40.72
  151.80.41.169
  151.80.41.64
-151.80.42.186
  151.80.44.115
-151.80.45.136
+151.80.45.51
  151.80.46.95
  151.80.58.175
  151.80.60.151
@@ -45401,7 +42458,6 @@
  151.80.65.175
  151.80.70.167
  151.80.80.7
-151.80.83.249
  151.80.9.153
  151.80.96.140
  151.80.99.2
@@ -45409,10 +42465,7 @@
  151.81.198.254
  151.81.199.147
  151.81.225.241
-151.82.180.43
-151.82.184.76
-151.84.105.118
-151.84.128.231
+151.82.191.231
  151.84.135.188
  151.93.216.36
  151.95.153.236
@@ -45426,17 +42479,13 @@
  152.0.244.175
  152.0.4.193
  152.0.6.182
+152.0.70.129
  152.114.1.50
  152.115.191.196
  152.136.100.204
  152.136.101.207
  152.136.101.65
-152.136.101.83
-152.136.103.204
  152.136.104.57
-152.136.105.190
-152.136.106.240
-152.136.106.94
  152.136.107.36
  152.136.109.116
  152.136.11.110
@@ -45446,13 +42495,10 @@
  152.136.113.227
  152.136.114.118
  152.136.116.72
-152.136.121.144
  152.136.121.150
  152.136.122.172
-152.136.126.100
  152.136.126.129
  152.136.127.178
-152.136.128.105
  152.136.128.30
  152.136.130.191
  152.136.130.218
@@ -45460,13 +42506,9 @@
  152.136.131.171
  152.136.131.242
  152.136.133.34
-152.136.133.70
  152.136.134.77
  152.136.137.62
  152.136.139.71
-152.136.139.74
-152.136.141.254
-152.136.141.88
  152.136.145.235
  152.136.145.25
  152.136.145.69
@@ -45477,12 +42519,8 @@
  152.136.151.194
  152.136.151.70
  152.136.152.45
-152.136.155.64
  152.136.156.14
-152.136.159.231
  152.136.165.226
-152.136.165.25
-152.136.169.198
  152.136.17.25
  152.136.170.159
  152.136.170.27
@@ -45490,52 +42528,35 @@
  152.136.173.58
  152.136.175.86
  152.136.177.129
-152.136.178.37
-152.136.181.217
  152.136.183.147
  152.136.183.151
  152.136.184.12
  152.136.184.156
-152.136.188.87
-152.136.189.81
-152.136.190.55
  152.136.196.155
  152.136.203.208
  152.136.204.118
  152.136.204.178
-152.136.207.121
-152.136.208.70
  152.136.212.92
  152.136.213.45
  152.136.213.72
  152.136.215.163
  152.136.215.222
  152.136.219.146
-152.136.22.63
  152.136.220.127
-152.136.226.156
  152.136.230.126
-152.136.231.89
  152.136.237.229
  152.136.237.47
  152.136.254.204
-152.136.31.184
  152.136.34.209
-152.136.34.52
  152.136.36.250
-152.136.45.81
-152.136.50.26
-152.136.58.127
  152.136.71.133
  152.136.90.196
  152.136.90.84
  152.136.96.220
  152.136.98.80
  152.165.38.171
-152.168.117.159
  152.168.160.138
  152.168.232.142
-152.168.247.82
  152.168.61.2
  152.169.106.145
  152.169.128.81
@@ -45544,7 +42565,6 @@
  152.169.19.143
  152.169.208.63
  152.169.22.67
-152.169.67.154
  152.170.205.196
  152.170.65.133
  152.170.66.244
@@ -45553,6 +42573,7 @@
  152.171.183.225
  152.171.208.189
  152.171.59.67
+152.172.188.54
  152.173.1.133
  152.186.46.233
  152.200.138.179
@@ -45577,56 +42598,38 @@
  152.231.89.226
  152.231.89.61
  152.231.93.130
-152.242.91.112
+152.237.74.251
  152.243.21.44
-152.245.189.178
  152.246.11.246
  152.247.110.41
  152.249.175.62
  152.250.243.148
-152.250.245.182
-152.250.252.179
  152.254.171.246
+152.254.223.145
  152.26.66.140
  152.32.129.40
  152.32.130.79
-152.32.133.67
-152.32.134.90
  152.32.144.204
  152.32.144.26
+152.32.147.166
  152.32.150.8
-152.32.161.81
  152.32.161.94
-152.32.164.141
-152.32.166.32
-152.32.167.129
-152.32.169.52
  152.32.175.24
  152.32.201.125
  152.32.201.203
-152.32.209.66
-152.32.213.86
-152.32.215.160
-152.32.222.196
-152.32.225.157
-152.32.226.223
-152.32.229.63
  152.32.239.128
  152.32.240.104
-152.32.240.76
  152.32.251.109
  152.32.253.118
-152.32.254.193
  152.32.64.105
  152.32.65.230
-152.32.72.122
  152.32.75.74
  152.32.78.24
  152.44.107.15
  152.65.45.28
  152.67.0.197
-152.67.12.90
  152.67.199.110
+152.67.232.151
  152.67.235.113
  152.67.24.187
  152.67.25.98
@@ -45636,7 +42639,6 @@
  152.67.47.139
  152.67.54.32
  152.67.62.97
-152.67.67.89
  152.67.8.114
  152.89.239.104
  152.89.239.115
@@ -45650,38 +42652,35 @@
  152asyabahis.com
  153.0.150.42
  153.0.164.251
+153.0.225.56
  153.101.167.242
  153.101.226.188
  153.101.232.10
  153.101.29.178
  153.101.37.132
+153.120.181.184
  153.120.33.139
-153.120.40.56
-153.121.34.246
-153.121.43.228
  153.121.64.16
  153.122.56.134
  153.122.62.117
  153.122.8.97
+153.124.168.213
  153.124.169.23
  153.124.169.24
  153.124.169.25
  153.125.76.154
-153.126.152.153
  153.126.156.217
+153.126.159.26
  153.126.179.109
  153.126.180.38
  153.126.187.46
-153.126.189.78
-153.126.209.200
-153.127.19.213
  153.127.24.8
  153.127.37.59
  153.127.39.196
  153.127.67.228
  153.127.68.121
-153.127.9.246
  153.129.15.63
+153.133.179.56
  153.133.85.110
  153.134.164.55
  153.134.172.245
@@ -45689,12 +42688,10 @@
  153.142.49.250
  153.145.134.55
  153.149.36.61
-153.153.170.28
  153.156.189.219
  153.156.71.130
  153.165.155.66
  153.168.51.231
-153.181.1.153
  153.183.25.24
  153.183.69.137
  153.186.211.178
@@ -45707,15 +42704,12 @@
  153.2.228.50
  153.204.122.254
  153.205.107.117
-153.211.125.248
  153.213.4.107
  153.215.12.52
  153.215.14.22
  153.215.76.99
  153.223.10.85
  153.229.219.1
-153.230.169.165
-153.246.145.238
  153.246.90.133
  153.254.105.16
  153.3.124.100
@@ -45726,6 +42720,7 @@
  153.3.56.162
  153.3.99.51
  153.3.99.51bin.sh
+153.34.126.68
  153.34.131.59
  153.34.135.92
  153.34.166.101
@@ -45734,9 +42729,7 @@
  153.34.65.168bin.sh
  153.34.67.119bin.sh
  153.35.217.243
-153.35.93.145
  153.35.93.175
-153.35.93.36
  153.35.93.44
  153.36.10.126
  153.36.132.84
@@ -45752,7 +42745,6 @@
  153.37.153.211
  153.37.181.92
  153.37.184.76
-153.37.192.4
  153.37.36.3
  153.46.243.100
  153.46.243.101
@@ -45774,40 +42766,28 @@
  153284594738391.statictab.com
  15333291-5189-4750-a96c-2f9deb7920f7.htmlcomponentservice.com
  153884c0b3f5e35925a6a8b37e6eccb3-dot-maintance-online-pass.ey.r.appspot.com
-154.0.161.99
  154.0.168.252
-154.0.172.19
-154.0.172.56
  154.0.175.203
  154.113.1.142
  154.113.122.218
  154.113.16.226
  154.113.65.34
  154.116.125.58
-154.117.126.249
-154.117.139.234
  154.117.143.126
  154.117.155.42
  154.117.159.228
  154.117.176.102
-154.117.199.3
-154.118.173.102
  154.118.52.216
  154.118.55.42
  154.119.7.3
  154.119.79.254
-154.120.101.147
  154.120.133.190
  154.120.227.206
  154.120.232.182
-154.120.72.225
  154.122.250.173
  154.123.185.118
  154.123.232.246
-154.124.135.213
-154.124.208.246
  154.124.227.30
-154.124.26.198
  154.124.37.68
  154.125.152.152
  154.126.32.138
@@ -45828,15 +42808,16 @@
  154.16.137.132
  154.16.138.48
  154.16.149.66
+154.16.168.6
  154.16.173.92
  154.16.2.197
  154.16.206.107
+154.16.206.117
  154.16.206.52
  154.16.206.83
  154.16.245.226
  154.16.3.100
  154.16.3.246
-154.16.36.198
  154.16.36.229
  154.16.37.122
  154.16.37.41
@@ -45853,20 +42834,19 @@
  154.16.49.148
  154.16.50.236
  154.16.53.182
-154.16.53.185
  154.16.53.186
  154.16.61.75
  154.16.62.140
+154.16.64.205
  154.16.89.54
  154.16.91.19
  154.160.24.254
-154.177.164.37
  154.177.197.215
  154.180.1.90
-154.180.56.251
+154.180.185.13
+154.180.74.106
  154.181.142.254
  154.196.129.93
-154.196.163.186
  154.197.4.114
  154.198.2.4
  154.20.182.195
@@ -45877,18 +42857,16 @@
  154.20.81.121
  154.20.94.22
  154.202.3.44
+154.204.26.121
  154.204.26.130
  154.204.31.234
+154.204.50.16
  154.204.53.81
-154.204.8.244
-154.208.143.15
  154.209.4.76
  154.209.5.157
  154.209.69.123
-154.209.70.42
  154.209.72.179
  154.209.77.59
-154.211.14.208
  154.211.14.244
  154.211.7.19
  154.212.191.35
@@ -46143,20 +43121,18 @@
  154.216.55.253
  154.216.55.254
  154.219.216.194
+154.220.3.218
  154.221.17.208
-154.221.18.237
  154.221.22.39
+154.221.23.18
  154.221.24.5
  154.221.25.187
-154.221.26.209
  154.221.27.21
-154.221.30.173
-154.221.31.153
-154.221.31.18
  154.223.189.86
  154.27.72.103
  154.27.72.195
  154.27.92.61
+154.3.250.134
  154.3.44.166
  154.30.211.130.bc.googleusercontent.com
  154.34.24.212
@@ -46183,7 +43159,6 @@
  154.66.193.57
  154.66.198.186
  154.66.208.12
-154.66.218.218
  154.66.240.106
  154.66.241.27
  154.66.245.47
@@ -46192,7 +43167,6 @@
  154.68.163.17
  154.68.195.101
  154.68.195.194
-154.68.39.6
  154.68.49.86
  154.68.5.166
  154.70.116.130
@@ -46203,11 +43177,9 @@
  154.70.236.34
  154.70.236.36
  154.70.32.103
-154.72.160.244
  154.72.167.21
  154.72.187.26
  154.72.188.230
-154.72.192.26
  154.72.197.106
  154.72.199.38
  154.72.201.190
@@ -46253,21 +43225,18 @@
  154.79.254.170
  154.79.254.176
  154.79.254.206
+154.8.137.248
  154.8.137.54
  154.8.144.203
-154.8.146.131
  154.8.146.181
  154.8.147.238
  154.8.149.4
  154.8.149.6
  154.8.151.45
  154.8.151.81
-154.8.159.88
-154.8.161.25
  154.8.167.100
  154.8.169.153
  154.8.169.66
-154.8.175.241
  154.8.176.223
  154.8.178.67
  154.8.183.204
@@ -46276,45 +43245,39 @@
  154.8.195.173
  154.8.195.36
  154.8.195.68
-154.8.196.30
  154.8.213.126
  154.8.221.159
  154.8.226.52
+154.8.227.18
  154.8.232.15
  154.8.232.212
  154.8.232.34
-154.83.12.23
-154.83.13.81
-154.83.14.206
  154.83.15.83
-154.85.35.253
-154.85.37.20
-154.85.38.237
  154.85.48.163
  154.85.49.196
  154.85.49.245
  154.85.50.185
-154.85.50.32
  154.85.55.104
  154.85.56.150
-154.9.204.184
+154.85.61.156
  154.90.14.41
  154.91.144.44
  154.91.146.158
+154.91.156.119
  154.91.157.121
  154.91.2.187
  154.91.33.137
  154.92.15.95
  154.92.16.191
-154.92.16.235
  154.92.99.51
-154.93.5.190
  155.0.161.250
  155.0.181.254
  155.0.202.254
  155.0.253.135
+155.12.21.118
  155.12.72.164
  155.12.78.102
+155.133.129.18
  155.133.131.208
  155.133.18.45
  155.133.83.1
@@ -46335,6 +43298,7 @@
  155.138.217.118
  155.138.222.174
  155.138.224.233
+155.138.224.71
  155.138.234.174
  155.138.237.187
  155.186.100.175
@@ -46356,7 +43320,6 @@
  155.4.184.91
  155.4.187.198
  155.4.200.211
-155.4.208.184
  155.4.221.222
  155.4.222.95
  155.4.240.169
@@ -46371,31 +43334,20 @@
  155.93.181.238
  155.94.128.249
  155.94.131.150
-155.94.140.178
-155.94.140.59
  155.94.141.74
-155.94.143.115
-155.94.143.121
-155.94.143.151
  155.94.145.193
  155.94.151.197
-155.94.158.21
  155.94.160.13
-155.94.169.229
+155.94.171.102
  155.94.171.103
-155.94.171.110
-155.94.171.112
+155.94.171.115
  155.94.171.122
  155.94.171.71
  155.94.171.97
  155.94.178.29
-155.94.180.140
-155.94.180.166
  155.94.180.167
-155.94.180.189
  155.94.182.121
  155.94.184.179
-155.94.201.99
  155.94.211.115
  155.94.224.207
  155.94.243.43
@@ -46406,29 +43358,33 @@
  1552477-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  155361.streeteone.com
  15565556239457741.us-south.cf.appdomain.cloud
+156.0.214.45
  156.0.229.194
  156.146.117.176
  156.146.34.65
  156.146.36.172
+156.146.36.72
  156.146.54.83
  156.146.55.183
  156.146.55.196
  156.146.57.38
  156.146.60.103
  156.155.163.232
+156.155.225.19
  156.17.118.225
  156.17.15.61
  156.19.19.90
  156.19.245.75
+156.194.211.165
  156.194.34.36
  156.195.199.76
  156.196.198.201
  156.199.209.13
-156.202.236.49
  156.204.210.90
-156.207.206.115
  156.212.108.176
  156.212.111.228
+156.213.100.209
+156.213.174.71
  156.213.233.188
  156.218.139.246
  156.218.180.42
@@ -46438,43 +43394,32 @@
  156.223.27.113
  156.230.55.124
  156.230.55.158
-156.230.55.192
  156.231.36.134
-156.236.118.49
-156.236.118.54
  156.236.70.73
  156.236.71.155
-156.236.71.206
  156.236.73.68
-156.236.74.161
  156.239.153.86
-156.241.132.167
-156.241.191.208
-156.241.5.151
  156.241.5.190
-156.245.17.102
  156.245.31.18
  156.247.12.158
  156.247.12.78
  156.247.12.91
  156.247.14.227
+156.251.125.148
  156.252.238.150
  156.255.213.198
  156.34.177.80
+156.38.74.9
  156.54.148.152
-156.54.164.58
  156.54.177.131
  156.67.106.36
+156.67.115.5
  156.67.214.80
-156.67.219.70
  156.67.221.92
  156.67.85.114
-156.96.105.250
-156.96.105.48
-156.96.106.18
+156.70.3.101
  156.96.107.219
  156.96.107.230
-156.96.107.232
  156.96.107.247
  156.96.107.252
  156.96.112.182
@@ -46483,7 +43428,6 @@
  156.96.112.69
  156.96.113.131
  156.96.113.99
-156.96.114.102
  156.96.114.73
  156.96.116.224
  156.96.117.151
@@ -46492,8 +43436,8 @@
  156.96.117.164
  156.96.117.166
  156.96.117.183
+156.96.117.191
  156.96.118.160
-156.96.118.167
  156.96.118.170
  156.96.118.172
  156.96.118.179
@@ -46509,33 +43453,30 @@
  156.96.128.218
  156.96.128.222
  156.96.128.235
-156.96.128.236
  156.96.150.119
  156.96.150.30
  156.96.150.32
  156.96.151.236
-156.96.153.41
  156.96.154.213
-156.96.154.35
  156.96.154.51
  156.96.155.226
  156.96.155.229
+156.96.155.233
  156.96.155.237
  156.96.155.239
  156.96.156.138
  156.96.156.218
  156.96.156.24
  156.96.156.240
+156.96.156.242
+156.96.156.244
  156.96.156.246
  156.96.156.248
-156.96.156.42
  156.96.156.48
  156.96.156.6
  156.96.156.75
  156.96.157.99
-156.96.44.161
  156.96.44.167
-156.96.44.214
  156.96.44.217
  156.96.45.165
  156.96.46.122
@@ -46549,8 +43490,6 @@
  156.96.56.102
  156.96.56.115
  156.96.56.12
-156.96.56.130
-156.96.56.143
  156.96.56.151
  156.96.56.180
  156.96.56.184
@@ -46561,24 +43500,23 @@
  156.96.56.35
  156.96.56.5
  156.96.56.71
+156.96.56.82
  156.96.56.9
  156.96.56.98
  156.96.58.114
  156.96.58.239
  156.96.58.71
  156.96.58.98
-156.96.59.33
  156.96.59.92
  156.96.60.4
  156.96.61.114
+156.96.61.117
  156.96.62.195
-156.96.62.198
  156.96.62.208
  156.96.62.215
-156.96.62.227
  156.96.62.68
+156.96.62.81
  156.96.62.82
-156.96.62.84
  156.96.62.91
  15688c.com
  1569webappssupport.com
@@ -46586,9 +43524,7 @@
  157.0.234.132
  157.0.35.221
  157.100.230.82
-157.100.33.90
  157.119.117.22
-157.119.121.161
  157.119.186.174
  157.119.207.10
  157.119.207.13
@@ -46601,10 +43537,10 @@
  157.119.234.144
  157.119.250.38
  157.119.250.57
-157.119.50.250
  157.119.50.49
  157.119.50.70
  157.119.50.74
+157.119.75.250
  157.119.83.234
  157.122.104.87
  157.13.61.66
@@ -46657,15 +43593,13 @@
  157.191.147.146
  157.230.0.185
  157.230.1.157
-157.230.10.212
  157.230.100.192
-157.230.101.65
+157.230.103.91
  157.230.104.14
  157.230.109.166
  157.230.11.65
  157.230.111.63
  157.230.112.195
-157.230.112.34
  157.230.117.175
  157.230.12.231
  157.230.121.242
@@ -46697,28 +43631,25 @@
  157.230.176.138
  157.230.176.48
  157.230.182.112
-157.230.183.163
  157.230.183.169
  157.230.184.206
  157.230.185.182
  157.230.185.88
+157.230.187.39
  157.230.189.177
  157.230.189.65
  157.230.19.72
-157.230.190.1
  157.230.190.90
  157.230.191.238
  157.230.2.161
  157.230.2.178
  157.230.2.208
-157.230.208.92
  157.230.209.141
  157.230.211.219
  157.230.214.244
  157.230.215.2
  157.230.215.87
  157.230.216.19
-157.230.216.233
  157.230.218.111
  157.230.219.122
  157.230.220.179
@@ -46727,7 +43658,6 @@
  157.230.221.194
  157.230.221.236
  157.230.222.75
-157.230.225.35
  157.230.225.72
  157.230.226.245
  157.230.226.7
@@ -46738,62 +43668,52 @@
  157.230.228.171
  157.230.229.23
  157.230.230.152
-157.230.230.153
  157.230.230.183
  157.230.230.9
  157.230.231.168
  157.230.231.39
  157.230.231.77
  157.230.233.14
-157.230.234.117
+157.230.234.222
  157.230.235.118
  157.230.235.207
-157.230.235.233
  157.230.235.243
-157.230.237.164
  157.230.238.1
  157.230.238.172
  157.230.238.19
  157.230.239.186
  157.230.239.99
-157.230.24.24
  157.230.240.140
+157.230.240.201
  157.230.240.76
  157.230.243.163
-157.230.244.147
  157.230.244.46
  157.230.245.91
  157.230.247.57
  157.230.248.89
  157.230.249.80
  157.230.249.90
-157.230.25.211
  157.230.251.115
  157.230.251.239
  157.230.251.61
  157.230.252.35
-157.230.253.85
+157.230.27.30
  157.230.3.19
-157.230.30.229
  157.230.30.98
-157.230.31.236
  157.230.31.237
-157.230.32.113
-157.230.32.164
  157.230.33.158
  157.230.34.160
  157.230.34.40
  157.230.34.76
  157.230.36.200
-157.230.37.16
  157.230.38.102
-157.230.38.112
  157.230.38.125
  157.230.39.223
  157.230.41.225
  157.230.42.11
  157.230.42.155
  157.230.42.76
+157.230.43.204
  157.230.45.31
  157.230.46.151
  157.230.46.26
@@ -46802,24 +43722,20 @@
  157.230.47.241
  157.230.47.57
  157.230.52.241
-157.230.53.57
  157.230.55.177
  157.230.55.192
  157.230.55.88
  157.230.57.43
  157.230.58.223
-157.230.6.169
  157.230.6.213
-157.230.61.132
  157.230.61.211
  157.230.62.50
  157.230.80.232
  157.230.80.53
  157.230.80.75
-157.230.81.179
  157.230.81.48
  157.230.82.214
-157.230.83.80
+157.230.82.79
  157.230.84.139
  157.230.85.106
  157.230.85.8
@@ -46830,6 +43746,7 @@
  157.230.93.237
  157.230.93.62
  157.230.94.83
+157.230.96.179
  157.231.102.250
  157.231.110.14
  157.231.113.130
@@ -46842,20 +43759,18 @@
  157.245.103.229
  157.245.103.90
  157.245.104.19
+157.245.105.31
  157.245.106.153
-157.245.108.109
  157.245.108.35
  157.245.109.222
  157.245.111.122
  157.245.113.214
-157.245.12.36
-157.245.120.102
+157.245.117.218
  157.245.121.142
  157.245.122.166
  157.245.123.27
  157.245.124.160
  157.245.124.217
-157.245.125.225
  157.245.127.232
  157.245.13.160
  157.245.130.232
@@ -46865,7 +43780,6 @@
  157.245.134.132
  157.245.134.78
  157.245.137.145
-157.245.137.211
  157.245.139.201
  157.245.140.204
  157.245.140.49
@@ -46887,6 +43801,7 @@
  157.245.162.63
  157.245.163.0
  157.245.164.148
+157.245.164.4
  157.245.164.84
  157.245.165.131
  157.245.166.156
@@ -46902,7 +43817,6 @@
  157.245.175.222
  157.245.176.134
  157.245.177.93
-157.245.178.100
  157.245.178.223
  157.245.178.61
  157.245.179.108
@@ -46916,11 +43830,8 @@
  157.245.182.234
  157.245.182.63
  157.245.182.75
-157.245.183.12
  157.245.184.13
  157.245.184.148
-157.245.184.205
-157.245.184.68
  157.245.184.96
  157.245.186.182
  157.245.186.41
@@ -46936,28 +43847,19 @@
  157.245.190.172
  157.245.190.86
  157.245.194.231
-157.245.194.38
  157.245.198.64
-157.245.2.58
-157.245.200.154
  157.245.201.119
-157.245.202.154
-157.245.202.159
  157.245.203.130
  157.245.203.17
-157.245.203.34
-157.245.207.198
-157.245.211.120
  157.245.211.180
  157.245.212.8
  157.245.214.204
  157.245.218.105
-157.245.219.63
  157.245.220.153
+157.245.221.80
  157.245.224.13
  157.245.224.29
  157.245.227.165
-157.245.231.155
  157.245.231.62
  157.245.231.94
  157.245.232.243
@@ -46967,33 +43869,23 @@
  157.245.237.33
  157.245.238.170
  157.245.238.196
-157.245.240.102
  157.245.241.51
  157.245.242.125
  157.245.242.172
-157.245.243.14
  157.245.244.123
-157.245.244.202
  157.245.245.159
  157.245.246.132
  157.245.249.158
  157.245.250.10
+157.245.250.251
  157.245.252.154
  157.245.252.34
  157.245.253.142
  157.245.253.184
  157.245.253.245
  157.245.254.14
-157.245.32.33
-157.245.34.156
  157.245.35.47
-157.245.37.160
-157.245.37.203
  157.245.39.243
-157.245.40.65
-157.245.41.151
-157.245.41.62
-157.245.42.253
  157.245.43.226
  157.245.45.99
  157.245.5.202
@@ -47015,12 +43907,9 @@
  157.245.74.101
  157.245.74.205
  157.245.74.28
-157.245.76.159
-157.245.76.169
  157.245.78.155
  157.245.79.186
  157.245.79.248
-157.245.81.56
  157.245.86.248
  157.245.87.206
  157.245.89.124
@@ -47032,7 +43921,6 @@
  157.245.92.141
  157.245.92.44
  157.245.94.69
-157.245.95.16
  157.245.96.239
  157.245.97.107
  157.245.97.17
@@ -47044,14 +43932,12 @@
  157.245.99.39
  157.25.23.231
  157.44.64.76
-157.49.251.106
  157.49.97.192
  157.52.151.84
  157.52.193.130
  157.52.252.141
  157.55.165.3
  157.55.175.69
-157.55.182.175
  157.55.188.111
  157.55.192.131
  157.55.39.0
@@ -47173,7 +44059,6 @@
  157.55.39.97
  157.55.39.98
  157.55.80.72
-157.55.83.107
  157.61.160.33
  157.65.25.144
  157.7.106.170
@@ -47191,7 +44076,6 @@
  157.97.132.46
  157.97.182.82
  157.97.2.215
-157.97.80.205
  15705924073.mer.lstest.siquality.com
  1572599.com
  15780.url.7878j.com
@@ -47202,9 +44086,7 @@
  158.101.12.235
  158.101.120.79
  158.101.124.78
-158.101.144.173
  158.101.151.37
-158.101.157.58
  158.101.173.116
  158.101.7.100
  158.101.97.4
@@ -47215,12 +44097,13 @@
  158.129.140.201
  158.130.48.250
  158.140.116.129
+158.140.136.26
  158.140.141.100
  158.140.144.78
  158.140.146.216
+158.140.167.148
  158.140.169.104
  158.140.173.212
-158.140.189.154
  158.140.237.153
  158.140.237.185
  158.140.63.162
@@ -47229,7 +44112,6 @@
  158.174.105.184
  158.174.107.222
  158.174.11.171
-158.174.111.37
  158.174.121.254
  158.174.122.199
  158.174.126.228
@@ -47244,6 +44126,7 @@
  158.174.187.34
  158.174.192.242
  158.174.193.163
+158.174.194.14
  158.174.195.7
  158.174.213.128
  158.174.215.140
@@ -47270,8 +44153,9 @@
  158.174.87.36
  158.175.132.168
  158.177.12.124
-158.177.72.62
  158.181.125.150
+158.181.149.71
+158.181.168.72
  158.181.18.158
  158.181.226.33
  158.222.1.191
@@ -47281,12 +44165,14 @@
  158.222.11.17
  158.222.11.205
  158.222.11.43
-158.222.14.117
+158.222.14.184
  158.222.14.44
+158.222.165.33
  158.222.4.16
-158.222.4.3
+158.222.4.60
  158.222.6.119
  158.222.6.61
+158.222.8.91
  158.222.90.98
  158.247.209.198
  158.248.198.75
@@ -47296,7 +44182,6 @@
  158.255.23.146
  158.255.249.58
  158.255.26.229
-158.255.27.233
  158.255.31.93
  158.255.51.213
  158.255.57.174
@@ -47308,11 +44193,8 @@
  158.255.7.61
  158.39.30.218
  158.46.127.222
-158.46.187.139
  158.51.121.143
  158.51.124.112
-158.51.126.15
-158.51.126.157
  158.51.126.41
  158.51.126.50
  158.51.126.6
@@ -47325,7 +44207,6 @@
  158.58.168.61
  158.58.170.186
  158.58.170.222
-158.58.184.51
  158.58.188.37
  158.58.197.227
  158.64.79.183
@@ -47333,20 +44214,16 @@
  158.69.100.192
  158.69.100.194
  158.69.110.31
-158.69.115.206
  158.69.116.169
  158.69.127.117
  158.69.128.56
  158.69.137.105
-158.69.138.23
  158.69.138.27
  158.69.146.146
  158.69.153.243
-158.69.154.64
  158.69.156.170
  158.69.158.101
  158.69.158.103
-158.69.159.170
  158.69.165.176
  158.69.170.217
  158.69.173.134
@@ -47357,40 +44234,34 @@
  158.69.194.115
  158.69.194.36
  158.69.195.248
-158.69.197.113
  158.69.197.236
  158.69.197.49
  158.69.199.225
-158.69.200.170
  158.69.201.47
  158.69.202.69
-158.69.203.160
  158.69.208.131
-158.69.208.137
-158.69.210.168
  158.69.211.201
  158.69.218.145
-158.69.22.197
  158.69.220.67
  158.69.222.2
  158.69.223.85
-158.69.223.91
  158.69.225.34
  158.69.225.35
  158.69.225.36
  158.69.225.37
-158.69.226.107
  158.69.226.175
  158.69.227.12
  158.69.228.225
  158.69.236.148
+158.69.236.151
  158.69.236.40
  158.69.240.159
  158.69.242.115
  158.69.243.148
  158.69.244.40
  158.69.245.223
-158.69.245.78
+158.69.248.120
+158.69.250.210
  158.69.252.83
  158.69.254.105
  158.69.26.144
@@ -47409,7 +44280,6 @@
  158.69.72.200
  158.69.72.5
  158.69.74.240
-158.69.78.32
  158.69.79.136
  158.69.87.231
  158.69.87.97
@@ -47423,7 +44293,6 @@
  158makrobet.com
  159-365.net
  159.0.106.98
-159.0.67.26
  159.100.168.51
  159.100.242.254
  159.100.245.237
@@ -47433,6 +44302,7 @@
  159.100.254.107
  159.100.255.18
  159.117.65.167
+159.118.253.106
  159.122.144.23
  159.122.222.207
  159.122.254.235
@@ -47441,6 +44311,7 @@
  159.138.102.231
  159.138.11.107
  159.138.117.89
+159.138.153.168
  159.138.158.249
  159.138.175.167
  159.138.21.170
@@ -47451,20 +44322,18 @@
  159.138.44.245
  159.138.5.222
  159.138.57.38
-159.138.65.107
  159.138.87.18
  159.138.9.109
+159.146.108.80
  159.146.30.117
  159.146.31.110
  159.146.90.232
  159.147.128.92
  159.147.214.29
  159.147.63.35
-159.148.186.192
  159.148.186.196
  159.148.202.53
  159.148.3.177
-159.180.227.2
  159.192.104.253
  159.192.104.53
  159.192.105.152
@@ -47479,9 +44348,9 @@
  159.192.142.42
  159.192.143.249
  159.192.146.250
-159.192.148.139
  159.192.148.4
  159.192.153.174
+159.192.167.85
  159.192.167.86
  159.192.169.226
  159.192.203.228
@@ -47499,17 +44368,12 @@
  159.192.240.31
  159.192.246.137
  159.192.246.34
-159.192.249.126
  159.192.249.25
  159.192.250.152
-159.192.250.203
-159.192.253.189
+159.192.253.174
  159.192.253.212
  159.192.253.225
  159.192.253.230
-159.192.253.65
-159.192.8.4
-159.192.82.249
  159.192.88.184
  159.192.97.181
  159.192.97.80
@@ -47527,7 +44391,6 @@
  159.203.11.3
  159.203.110.210
  159.203.111.100
-159.203.112.185
  159.203.114.189
  159.203.115.201
  159.203.115.215
@@ -47546,26 +44409,22 @@
  159.203.121.11
  159.203.122.57
  159.203.124.134
-159.203.124.234
  159.203.124.98
  159.203.125.129
  159.203.126.65
  159.203.128.202
  159.203.128.47
-159.203.13.64
  159.203.130.215
  159.203.130.254
  159.203.135.82
  159.203.14.64
  159.203.141.163
-159.203.142.91
  159.203.143.21
  159.203.146.21
  159.203.150.100
  159.203.150.195
  159.203.152.90
  159.203.161.124
-159.203.162.186
  159.203.162.190
  159.203.163.149
  159.203.163.19
@@ -47576,7 +44435,6 @@
  159.203.167.242
  159.203.168.167
  159.203.17.107
-159.203.17.176
  159.203.17.75
  159.203.172.110
  159.203.172.159
@@ -47593,19 +44451,15 @@
  159.203.179.230
  159.203.181.173
  159.203.181.19
-159.203.181.218
  159.203.181.50
  159.203.181.94
  159.203.182.42
-159.203.183.20
  159.203.184.19
  159.203.186.23
  159.203.188.141
-159.203.188.156
  159.203.188.173
  159.203.188.175
  159.203.188.51
-159.203.189.152
  159.203.189.23
  159.203.189.250
  159.203.189.74
@@ -47613,7 +44467,6 @@
  159.203.190.189
  159.203.191.2
  159.203.196.79
-159.203.198.34
  159.203.2.156
  159.203.2.227
  159.203.2.230
@@ -47630,6 +44483,7 @@
  159.203.230.136
  159.203.232.29
  159.203.234.176
+159.203.241.101
  159.203.241.242
  159.203.242.122
  159.203.242.199
@@ -47638,12 +44492,9 @@
  159.203.255.95
  159.203.26.120
  159.203.26.252
-159.203.27.146
-159.203.27.98
  159.203.28.251
  159.203.30.113
  159.203.30.127
-159.203.30.208
  159.203.30.226
  159.203.30.48
  159.203.30.50
@@ -47653,7 +44504,6 @@
  159.203.33.48
  159.203.34.81
  159.203.35.141
-159.203.36.154
  159.203.36.241
  159.203.37.43
  159.203.38.172
@@ -47679,8 +44529,6 @@
  159.203.59.114
  159.203.59.173
  159.203.59.199
-159.203.59.38
-159.203.6.38
  159.203.60.236
  159.203.61.247
  159.203.62.189
@@ -47710,7 +44558,6 @@
  159.203.81.93
  159.203.82.104
  159.203.82.146
-159.203.82.173
  159.203.82.179
  159.203.82.183
  159.203.82.201
@@ -47719,8 +44566,6 @@
  159.203.85.196
  159.203.87.13
  159.203.87.130
-159.203.87.46
-159.203.87.95
  159.203.87.96
  159.203.88.118
  159.203.91.6
@@ -47733,7 +44578,6 @@
  159.203.96.11
  159.203.96.147
  159.203.98.128
-159.203.98.228
  159.224.112.227
  159.224.121.221
  159.224.162.104
@@ -47756,6 +44600,8 @@
  159.226.165.67
  159.226.73.176
  159.226.73.79
+159.242.234.15
+159.242.234.181
  159.246.29.101
  159.246.29.103
  159.246.29.104
@@ -47788,7 +44634,6 @@
  159.255.163.238
  159.255.167.89
  159.255.250.241
-159.28.132.130
  159.28.170.60
  159.45.146.133
  159.45.146.135
@@ -47804,11 +44649,11 @@
  159.65.100.95
  159.65.101.201
  159.65.102.195
+159.65.102.72
  159.65.107.160
  159.65.107.251
  159.65.108.129
  159.65.108.19
-159.65.109.52
  159.65.11.115
  159.65.11.5
  159.65.110.10
@@ -47817,7 +44662,6 @@
  159.65.111.89
  159.65.112.7
  159.65.114.233
-159.65.116.87
  159.65.119.132
  159.65.119.25
  159.65.12.108
@@ -47839,33 +44683,25 @@
  159.65.134.185
  159.65.134.244
  159.65.135.148
-159.65.136.141
+159.65.135.75
  159.65.136.194
  159.65.136.196
-159.65.136.241
  159.65.136.44
  159.65.137.109
  159.65.137.122
  159.65.137.48
  159.65.137.80
-159.65.138.22
  159.65.138.86
  159.65.139.163
  159.65.139.237
  159.65.140.182
  159.65.140.194
-159.65.140.38
  159.65.141.206
-159.65.142.103
  159.65.142.19
  159.65.142.192
  159.65.142.92
-159.65.143.227
  159.65.144.102
-159.65.144.152
  159.65.144.233
-159.65.144.36
-159.65.144.64
  159.65.146.132
  159.65.147.235
  159.65.148.192
@@ -47874,35 +44710,24 @@
  159.65.150.135
  159.65.150.139
  159.65.150.151
+159.65.150.181
  159.65.151.183
  159.65.152.201
  159.65.153.147
  159.65.154.48
  159.65.155.229
-159.65.155.255
  159.65.156.139
  159.65.156.65
  159.65.157.238
  159.65.157.70
  159.65.158.141
-159.65.158.30
  159.65.159.1
  159.65.159.134
-159.65.160.37
-159.65.161.197
  159.65.162.189
-159.65.164.178
-159.65.166.228
-159.65.166.83
  159.65.169.25
  159.65.169.76
-159.65.170.181
  159.65.171.69
-159.65.172.117
-159.65.172.240
  159.65.172.36
-159.65.174.217
-159.65.174.81
  159.65.176.104
  159.65.176.156
  159.65.177.139
@@ -47912,11 +44737,10 @@
  159.65.181.185
  159.65.181.225
  159.65.181.26
-159.65.183.47
  159.65.184.162
+159.65.184.79
  159.65.186.147
  159.65.187.247
-159.65.189.115
  159.65.19.39
  159.65.19.77
  159.65.196.143
@@ -47927,9 +44751,7 @@
  159.65.207.22
  159.65.207.32
  159.65.216.84
-159.65.216.94
  159.65.217.56
-159.65.219.210
  159.65.220.54
  159.65.221.193
  159.65.221.28
@@ -47941,14 +44763,13 @@
  159.65.227.64
  159.65.227.80
  159.65.228.105
+159.65.228.224
  159.65.229.162
  159.65.229.200
  159.65.233.97
  159.65.234.65
  159.65.234.71
-159.65.236.182
  159.65.236.252
-159.65.236.52
  159.65.236.67
  159.65.236.82
  159.65.237.31
@@ -47969,8 +44790,6 @@
  159.65.30.66
  159.65.33.28
  159.65.34.36
-159.65.35.14
-159.65.37.144
  159.65.39.11
  159.65.4.119
  159.65.4.159
@@ -47984,8 +44803,6 @@
  159.65.52.66
  159.65.53.246
  159.65.54.221
-159.65.59.41
-159.65.6.244
  159.65.63.101
  159.65.64.115
  159.65.64.76
@@ -48008,19 +44825,15 @@
  159.65.78.139
  159.65.78.3
  159.65.79.191
-159.65.8.65
  159.65.8.71
  159.65.81.246
  159.65.81.49
-159.65.84.164
  159.65.84.183
-159.65.86.239
  159.65.86.243
  159.65.86.35
  159.65.88.193
  159.65.88.87
  159.65.88.97
-159.65.89.63
  159.65.91.105
  159.65.95.133
  159.65.97.8
@@ -48038,11 +44851,9 @@
  159.69.167.254
  159.69.193.12
  159.69.196.197
-159.69.250.184
-159.69.250.222
+159.69.215.236
  159.69.26.123
  159.69.29.193
-159.69.54.164
  159.69.57.170
  159.69.7.135
  159.69.85.172
@@ -48065,12 +44876,10 @@
  159.89.108.149
  159.89.108.3
  159.89.108.68
-159.89.109.12
  159.89.109.125
  159.89.109.195
  159.89.109.20
  159.89.11.236
-159.89.112.83
  159.89.114.160
  159.89.114.255
  159.89.114.40
@@ -48091,14 +44900,12 @@
  159.89.126.84
  159.89.127.168
  159.89.129.144
-159.89.129.36
  159.89.13.100
  159.89.13.131
  159.89.13.244
  159.89.13.80
  159.89.130.126
  159.89.130.178
-159.89.131.172
  159.89.131.205
  159.89.132.200
  159.89.133.126
@@ -48116,13 +44923,10 @@
  159.89.143.31
  159.89.145.59
  159.89.145.93
-159.89.147.229
  159.89.148.164
  159.89.148.29
  159.89.148.68
  159.89.150.116
-159.89.150.155
-159.89.151.209
  159.89.152.81
  159.89.154.178
  159.89.154.57
@@ -48130,31 +44934,23 @@
  159.89.156.175
  159.89.156.190
  159.89.157.126
-159.89.16.10
  159.89.16.122
  159.89.16.167
  159.89.16.226
-159.89.160.101
  159.89.162.217
  159.89.163.226
-159.89.163.38
  159.89.163.42
  159.89.163.5
-159.89.164.199
  159.89.165.127
-159.89.165.5
  159.89.166.172
  159.89.166.26
  159.89.166.91
  159.89.167.183
  159.89.168.216
-159.89.169.125
-159.89.169.68
  159.89.17.149
  159.89.170.1
  159.89.170.154
  159.89.170.5
-159.89.171.121
  159.89.171.165
  159.89.171.81
  159.89.172.207
@@ -48162,19 +44958,18 @@
  159.89.172.68
  159.89.173.165
  159.89.174.9
-159.89.177.46
  159.89.178.135
  159.89.18.157
  159.89.18.80
-159.89.180.30
  159.89.182.64
-159.89.183.168
  159.89.183.74
  159.89.184.25
  159.89.184.37
  159.89.187.165
  159.89.188.167
  159.89.19.171
+159.89.191.39
+159.89.192.50
  159.89.193.223
  159.89.194.103
  159.89.194.160
@@ -48198,7 +44993,6 @@
  159.89.200.80
  159.89.202.113
  159.89.203.135
-159.89.203.193
  159.89.205.184
  159.89.205.186
  159.89.210.220
@@ -48214,13 +45008,11 @@
  159.89.230.175
  159.89.230.220
  159.89.231.172
-159.89.231.2
  159.89.231.85
  159.89.234.49
  159.89.235.15
  159.89.236.71
  159.89.237.201
-159.89.237.235
  159.89.237.254
  159.89.239.14
  159.89.24.170
@@ -48238,23 +45030,18 @@
  159.89.42.118
  159.89.42.205
  159.89.44.62
-159.89.46.11
  159.89.47.106
  159.89.47.115
  159.89.48.237
  159.89.48.31
  159.89.48.56
-159.89.48.63
  159.89.48.69
-159.89.49.139
  159.89.49.225
  159.89.49.44
  159.89.5.237
  159.89.50.148
  159.89.51.228
-159.89.52.92
  159.89.53.183
-159.89.53.92
  159.89.54.88
  159.89.55.36
  159.89.7.14
@@ -48262,14 +45049,11 @@
  159.89.82.29
  159.89.84.231
  159.89.85.200
-159.89.86.142
  159.89.86.176
  159.89.87.139
-159.89.88.119
  159.89.89.191
  159.89.89.224
  159.89.89.44
-159.89.89.65
  159.89.9.140
  159.89.9.84
  159.89.9.86
@@ -48278,8 +45062,6 @@
  159.89.91.67
  159.89.92.217
  159.89.94.13
-159.89.96.224
-159.89.97.23
  159.89.98.96
  159.89.99.68
  1590373098298.takeby.xyz
@@ -48302,29 +45084,25 @@
  15w12pa9khzfq658043xrdgv7e2yi84sb076.xyz
  160.0.197.35
  160.0.201.137
+160.0.203.18
  160.0.203.200
  160.0.203.33
  160.0.203.94
-160.0.204.160
  160.0.204.6
  160.0.204.80
  160.1.93.241
-160.116.78.94
  160.119.128.102
  160.119.128.70
  160.119.131.114
  160.119.181.189
  160.119.249.24
  160.119.249.240
-160.119.253.194
  160.119.253.232
  160.119.254.19
  160.119.50.93
  160.119.79.12
  160.120.191.115
  160.124.140.153
-160.124.15.108
-160.124.156.67
  160.124.157.76
  160.124.236.218
  160.124.236.219
@@ -48348,23 +45126,18 @@
  160.153.156.137
  160.153.203.129
  160.153.234.236
-160.153.234.75
  160.153.235.106
  160.153.245.175
  160.153.251.133
  160.153.251.87
  160.153.252.187
  160.153.252.9
-160.154.145.43
-160.154.39.67
  160.154.43.146
-160.155.113.19
  160.155.113.22
  160.155.161.229
  160.155.193.220
  160.155.197.194
  160.155.37.149
-160.155.53.22
  160.155.57.79
  160.16.0.30
  160.16.101.124
@@ -48374,21 +45147,17 @@
  160.16.133.38
  160.16.136.28
  160.16.145.25
-160.16.148.161
  160.16.198.89
-160.16.202.140
  160.16.203.190
  160.16.219.87
  160.16.230.197
  160.16.235.128
-160.16.61.235
  160.16.63.41
  160.16.68.239
  160.16.76.83
  160.173.212.29
  160.174.130.100
-160.176.2.135
-160.176.244.202
+160.178.237.7
  160.179.32.54
  160.19.246.57
  160.2.52.234
@@ -48431,15 +45200,12 @@
  160.251.2.239
  160.251.3.228
  160.251.4.170
-160.251.5.172
-160.251.6.155
  160.251.8.225
  160.251.9.25
  160.3.126.158
  160.3.19.6
  160.39.48.77
  160.40.53.136
-160.46.252.109
  160.80.87.201
  160.97.12.177
  160holiganbet.com
@@ -48448,25 +45214,15 @@
  161.117.10.46
  161.117.11.230
  161.117.176.46
-161.117.178.197
  161.117.180.40
  161.117.181.101
-161.117.182.3
  161.117.186.48
-161.117.189.115
  161.117.189.30
-161.117.189.94
  161.117.235.45
-161.117.250.93
  161.117.255.189
-161.117.44.57
-161.117.57.88
-161.117.59.101
  161.117.63.168
+161.117.7.137
  161.117.7.172
-161.117.80.102
-161.117.83.239
-161.117.86.120
  161.117.88.24
  161.117.9.216
  161.117.9.99
@@ -48475,7 +45231,6 @@
  161.129.65.93
  161.129.67.114
  161.132.113.242
-161.132.175.195
  161.132.181.182
  161.132.181.238
  161.132.78.98
@@ -48487,9 +45242,7 @@
  161.156.160.12
  161.184.145.158
  161.189.109.42
-161.189.140.115
  161.189.141.133
-161.189.84.212
  161.200.98.10
  161.202.124.146
  161.202.197.118
@@ -48497,25 +45250,21 @@
  161.202.41.12
  161.22.35.210
  161.22.53.33
+161.22.61.13
  161.230.111.128
  161.29.182.234
  161.29.183.77
-161.35.0.47
  161.35.1.144
  161.35.10.226
  161.35.10.34
  161.35.10.55
-161.35.101.70
  161.35.103.43
-161.35.104.211
  161.35.104.249
-161.35.104.35
  161.35.106.120
  161.35.106.253
  161.35.107.210
  161.35.108.241
  161.35.108.41
-161.35.109.11
  161.35.11.118
  161.35.111.169
  161.35.115.189
@@ -48526,9 +45275,7 @@
  161.35.121.130
  161.35.122.197
  161.35.124.171
-161.35.125.159
  161.35.126.230
-161.35.126.76
  161.35.127.147
  161.35.13.123
  161.35.13.134
@@ -48536,11 +45283,8 @@
  161.35.132.178
  161.35.134.63
  161.35.138.131
-161.35.140.204
  161.35.148.134
  161.35.148.203
-161.35.148.213
-161.35.148.218
  161.35.148.75
  161.35.15.187
  161.35.15.34
@@ -48552,14 +45296,10 @@
  161.35.161.91
  161.35.162.137
  161.35.162.192
-161.35.162.213
  161.35.164.109
  161.35.165.80
  161.35.166.100
-161.35.166.154
  161.35.167.148
-161.35.169.65
-161.35.17.177
  161.35.170.120
  161.35.172.109
  161.35.172.251
@@ -48570,9 +45310,9 @@
  161.35.174.187
  161.35.18.102
  161.35.18.28
+161.35.19.188
  161.35.193.16
  161.35.193.6
-161.35.194.6
  161.35.197.166
  161.35.2.238
  161.35.2.242
@@ -48580,7 +45320,6 @@
  161.35.205.180
  161.35.207.11
  161.35.212.246
-161.35.217.81
  161.35.218.147
  161.35.225.155
  161.35.225.49
@@ -48606,17 +45345,15 @@
  161.35.3.18
  161.35.32.111
  161.35.32.43
-161.35.34.115
  161.35.36.120
-161.35.37.0
  161.35.38.18
  161.35.39.170
  161.35.4.101
-161.35.4.190
+161.35.42.14
  161.35.42.29
+161.35.44.153
  161.35.45.62
  161.35.47.220
-161.35.47.72
  161.35.49.47
  161.35.49.78
  161.35.5.47
@@ -48632,14 +45369,10 @@
  161.35.6.188
  161.35.6.6
  161.35.60.129
-161.35.60.51
  161.35.61.129
  161.35.7.122
  161.35.72.39
-161.35.75.40
-161.35.77.82
  161.35.8.39
-161.35.80.37
  161.35.81.89
  161.35.82.220
  161.35.82.38
@@ -48655,7 +45388,6 @@
  161.35.85.52
  161.35.85.93
  161.35.86.226
-161.35.87.70
  161.35.89.88
  161.35.9.18
  161.35.9.85
@@ -48720,13 +45452,10 @@
  161.97.75.168
  161.97.76.214
  161.97.78.179
-161.97.82.201
  161.97.83.114
  161.97.84.78
-161.97.85.245
  161.97.87.96
  161.97.88.253
-161.97.91.103
  161.97.92.89
  161.97.94.184
  161.97.94.32
@@ -48734,7 +45463,6 @@
  161.97.95.63
  161.97.97.115
  161.97.97.244
-161.97.97.3
  161.97.98.137
  1615559.hnuconnect1.club
  1619services.com
@@ -48756,15 +45484,11 @@
  162.0.233.227
  162.0.234.152
  162.0.234.154
-162.0.234.195
-162.0.234.196
  162.0.234.96
-162.0.238.137
  162.0.239.23
  162.104.245.234
  162.112.41.65
  162.13.14.243
-162.133.76.199
  162.134.72.6
  162.14.11.184
  162.14.134.114
@@ -48800,6 +45524,7 @@
  162.142.125.39
  162.142.125.40
  162.142.125.53
+162.142.125.54
  162.142.125.55
  162.142.125.56
  162.142.125.64
@@ -48857,6 +45582,7 @@
  162.144.51.3
  162.144.57.196
  162.144.60.237
+162.144.63.2
  162.144.65.201
  162.144.68.100
  162.144.76.55
@@ -48865,6 +45591,7 @@
  162.144.96.64
  162.144.99.9
  162.154.207.147
+162.154.47.13
  162.155.10.150
  162.156.106.124
  162.156.106.150
@@ -48879,48 +45606,46 @@
  162.157.210.88
  162.157.238.86
  162.157.245.39
-162.158.111.55
-162.158.118.172
-162.158.119.117
+162.157.98.9
  162.158.134.59
+162.158.134.87
  162.158.142.101
  162.158.154.101
  162.158.154.107
  162.158.154.167
  162.158.154.53
+162.158.155.204
+162.158.158.137
  162.158.158.165
  162.158.158.185
  162.158.158.217
  162.158.158.225
-162.158.158.237
-162.158.159.136
+162.158.159.128
+162.158.159.38
  162.158.159.94
  162.158.165.129
  162.158.165.131
  162.158.165.133
  162.158.165.157
-162.158.165.163
  162.158.165.167
+162.158.165.17
  162.158.165.175
-162.158.165.189
-162.158.165.193
  162.158.165.219
  162.158.165.221
  162.158.165.231
  162.158.165.233
-162.158.165.251
  162.158.165.37
  162.158.165.41
  162.158.165.47
  162.158.166.104
  162.158.166.120
-162.158.166.156
  162.158.166.158
  162.158.166.164
  162.158.166.166
  162.158.166.194
  162.158.166.210
  162.158.166.224
+162.158.166.232
  162.158.166.250
  162.158.166.76
  162.158.166.84
@@ -48933,14 +45658,15 @@
  162.158.167.197
  162.158.167.51
  162.158.167.53
+162.158.167.57
  162.158.178.206
  162.158.178.38
  162.158.178.52
  162.158.179.115
-162.158.183.221
-162.158.183.233
-162.158.255.76
-162.158.62.13
+162.158.183.165
+162.158.183.208
+162.158.183.214
+162.158.62.65
  162.158.63.191
  162.158.88.135
  162.158.91.54
@@ -48952,11 +45678,8 @@
  162.17.143.229
  162.17.143.234
  162.17.167.210
-162.17.228.45
  162.17.252.5
  162.191.49.51
-162.193.172.115
-162.196.204.142
  162.198.89.189
  162.199.19.25
  162.200.143.124
@@ -48970,7 +45693,6 @@
  162.209.1.233
  162.209.102.100
  162.209.106.135
-162.209.246.80
  162.209.251.110
  162.209.4.125
  162.209.75.193
@@ -48980,7 +45702,6 @@
  162.210.173.109
  162.210.196.100
  162.210.196.129
-162.210.242.47
  162.210.97.60
  162.211.225.98
  162.211.226.228
@@ -49039,6 +45760,9 @@
  162.212.115.95
  162.212.168.115
  162.212.168.76
+162.212.169.146
+162.212.169.153
+162.212.169.156
  162.212.169.190
  162.212.169.213
  162.212.169.225
@@ -49078,7 +45802,6 @@
  162.214.55.183
  162.214.64.156
  162.214.64.229
-162.214.64.46
  162.214.74.239
  162.214.74.253
  162.214.77.143
@@ -49092,9 +45815,9 @@
  162.216.19.80
  162.216.46.117
  162.217.175.208
+162.217.42.68
  162.217.55.161
  162.217.77.15
-162.218.194.73
  162.218.234.56
  162.219.122.165
  162.219.179.101
@@ -49115,7 +45838,6 @@
  162.220.67.241
  162.220.8.224
  162.221.200.177
-162.221.206.10
  162.222.183.190
  162.222.215.164
  162.222.81.10
@@ -49124,7 +45846,6 @@
  162.223.88.243
  162.223.88.251
  162.223.88.42
-162.223.89.142
  162.223.89.221
  162.223.89.69
  162.223.90.202
@@ -49153,12 +45874,10 @@
  162.241.200.72
  162.241.214.166
  162.241.226.34
-162.241.235.78
  162.241.242.173
  162.241.244.134
  162.241.33.176
  162.241.41.111
-162.241.65.175
  162.241.65.37
  162.241.66.190
  162.241.66.242
@@ -49181,7 +45900,6 @@
  162.242.249.21
  162.242.253.206
  162.243.1.77
-162.243.10.64
  162.243.106.242
  162.243.114.242
  162.243.116.41
@@ -49318,21 +46036,19 @@
  162.243.156.130
  162.243.157.103
  162.243.157.200
-162.243.158.198
  162.243.161.215
  162.243.161.222
  162.243.163.122
  162.243.164.40
  162.243.165.205
-162.243.170.252
  162.243.171.112
  162.243.172.179
+162.243.173.202
  162.243.173.29
  162.243.174.115
  162.243.174.206
  162.243.174.228
  162.243.175.55
-162.243.175.86
  162.243.18.87
  162.243.185.137
  162.243.186.46
@@ -49348,7 +46064,6 @@
  162.243.224.222
  162.243.225.74
  162.243.23.246
-162.243.23.57
  162.243.231.148
  162.243.232.174
  162.243.233.102
@@ -49359,9 +46074,7 @@
  162.243.241.183
  162.243.243.223
  162.243.25.182
-162.243.25.25
  162.243.251.166
-162.243.253.67
  162.243.28.212
  162.243.30.140
  162.243.31.140
@@ -49378,21 +46091,19 @@
  162.243.49.119
  162.243.5.209
  162.243.50.8
-162.243.55.188
  162.243.6.103
  162.243.62.118
  162.243.62.246
  162.243.64.154
  162.243.69.215
  162.243.69.38
-162.243.74.129
  162.243.74.227
-162.243.76.161
  162.243.76.66
  162.243.8.125
  162.243.81.182
  162.243.82.78
  162.243.84.55
+162.243.91.84
  162.243.92.165
  162.243.93.167
  162.243.96.238
@@ -49427,6 +46138,7 @@
  162.246.61.20
  162.247.132.167
  162.247.155.129
+162.247.210.132
  162.247.214.99
  162.247.72.199
  162.247.72.216
@@ -49445,13 +46157,9 @@
  162.247.74.7
  162.247.74.74
  162.248.160.220
-162.248.164.69
-162.248.164.72
  162.248.225.40
  162.248.242.254
  162.248.243.41
-162.248.52.82
-162.248.52.99
  162.248.53.224
  162.248.55.137
  162.249.220.190
@@ -49468,17 +46176,14 @@
  162.251.18.223
  162.251.18.235
  162.252.57.132
-162.252.57.173
  162.252.57.90
  162.252.58.188
+162.252.58.189
  162.252.84.26
  162.253.168.86
  162.253.66.50
  162.253.66.76
-162.254.130.68
-162.254.200.123
  162.254.250.6
-162.255.113.57
  162.255.116.244
  162.255.117.11
  162.255.117.34
@@ -49532,11 +46237,10 @@
  162.62.26.56
  162.62.26.7
  162.62.27.117
-162.62.29.207
  162.62.52.34
  162.62.53.163
  162.72.157.113
-162.83.143.149
+162.83.253.137
  162.95.160.16
  162.95.160.237
  162.95.200.11
@@ -49600,13 +46304,12 @@
  162783-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  162840-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  163.121.188.3
+163.125.206.162
  163.13.182.105
  163.131.167.23
  163.131.64.105
  163.131.66.106
  163.139.169.79
-163.139.233.235
-163.142.70.143
  163.152.219.201
  163.152.223.25
  163.153.214.50
@@ -49617,7 +46320,6 @@
  163.171.130.78
  163.171.132.59
  163.171.132.60
-163.171.134.25
  163.171.139.132
  163.171.142.18
  163.171.142.37
@@ -49626,27 +46328,21 @@
  163.172.101.112
  163.172.101.137
  163.172.101.48
-163.172.103.147
  163.172.108.37
  163.172.109.132
  163.172.11.160
  163.172.111.182
-163.172.113.169
  163.172.113.177
  163.172.113.19
-163.172.113.47
  163.172.114.14
-163.172.114.29
  163.172.114.31
  163.172.115.25
  163.172.117.155
  163.172.117.248
+163.172.118.16
+163.172.120.204
  163.172.121.98
-163.172.122.161
-163.172.123.20
  163.172.125.47
-163.172.127.248
-163.172.127.251
  163.172.128.177
  163.172.128.98
  163.172.129.131
@@ -49673,7 +46369,7 @@
  163.172.143.114
  163.172.144.206
  163.172.145.119
-163.172.145.149
+163.172.145.156
  163.172.145.74
  163.172.146.49
  163.172.147.94
@@ -49687,13 +46383,11 @@
  163.172.152.52
  163.172.154.105
  163.172.154.178
-163.172.154.211
  163.172.154.72
  163.172.155.137
  163.172.156.230
  163.172.157.193
  163.172.158.208
-163.172.158.40
  163.172.160.125
  163.172.160.182
  163.172.160.62
@@ -49718,23 +46412,18 @@
  163.172.177.121
  163.172.178.167
  163.172.179.208
-163.172.179.64
  163.172.180.18
  163.172.181.191
  163.172.181.94
  163.172.182.234
-163.172.183.250
  163.172.185.11
-163.172.185.51
  163.172.187.114
  163.172.187.225
  163.172.189.32
  163.172.190.160
-163.172.191.141
  163.172.191.144
  163.172.192.170
  163.172.193.248
-163.172.197.211
  163.172.198.85
  163.172.209.130
  163.172.209.46
@@ -49753,11 +46442,10 @@
  163.172.223.177
  163.172.226.142
  163.172.226.90
+163.172.229.166
  163.172.229.188
-163.172.235.51
  163.172.237.18
  163.172.24.40
-163.172.251.80
  163.172.27.213
  163.172.27.234
  163.172.28.22
@@ -49772,22 +46460,24 @@
  163.172.35.247
  163.172.35.49
  163.172.37.72
+163.172.37.95
  163.172.38.173
  163.172.40.191
  163.172.40.218
+163.172.40.246
  163.172.41.179
  163.172.41.228
  163.172.42.123
+163.172.42.173
  163.172.42.71
  163.172.43.109
+163.172.43.208
  163.172.43.52
  163.172.44.173
  163.172.44.194
  163.172.44.42
  163.172.46.195
  163.172.48.194
-163.172.48.94
-163.172.49.56
  163.172.49.61
  163.172.5.199
  163.172.5.210
@@ -49801,11 +46491,10 @@
  163.172.60.25
  163.172.61.154
  163.172.61.214
+163.172.61.220
  163.172.61.48
-163.172.62.124
  163.172.62.175
  163.172.7.233
-163.172.7.235
  163.172.7.51
  163.172.72.233
  163.172.72.36
@@ -49815,19 +46504,15 @@
  163.172.81.70
  163.172.81.79
  163.172.82.118
+163.172.82.220
  163.172.83.41
  163.172.86.64
  163.172.88.136
  163.172.88.67
  163.172.91.139
-163.172.93.131
-163.172.93.71
  163.172.95.196
  163.172.97.112
  163.172.97.118
-163.177.97.2
-163.178.170.13
-163.179.126.39
  163.179.157.182
  163.179.97.16
  163.180.96.123
@@ -49838,27 +46523,24 @@
  163.23.77.126
  163.24.100.249
  163.24.142.52
-163.24.19.100
  163.24.30.124
  163.26.57.88
  163.27.127.131
  163.27.182.223
  163.44.149.204
-163.44.150.59
  163.44.152.32
  163.44.159.123
  163.44.159.154
  163.44.167.208
  163.44.168.207
  163.44.169.18
+163.44.171.194
  163.44.193.95
  163.44.194.47
-163.44.194.62
  163.44.196.132
  163.44.197.129
  163.44.198.43
  163.44.198.59
-163.44.206.136
  163.47.140.122
  163.47.146.118
  163.47.146.233
@@ -49874,13 +46556,13 @@
  163.47.158.6
  163.47.158.73
  163.47.158.77
+163.47.214.186
  163.47.32.110
  163.47.35.102
  163.47.87.98
  163.53.150.138
  163.53.168.122
  163.53.180.115
-163.53.183.34
  163.53.204.182
  163.53.206.228
  163.53.207.3
@@ -49908,16 +46590,11 @@
  164.115.41.170
  164.115.5.63
  164.125.234.121
-164.128.158.164
  164.132.101.10
  164.132.103.232
-164.132.103.245
-164.132.107.110
  164.132.107.245
  164.132.108.171
-164.132.108.195
  164.132.108.204
-164.132.110.238
  164.132.126.140
  164.132.145.70
  164.132.147.116
@@ -49928,9 +46605,7 @@
  164.132.183.197
  164.132.195.231
  164.132.195.233
-164.132.196.47
  164.132.196.98
-164.132.197.108
  164.132.199.114
  164.132.200.121
  164.132.202.92
@@ -49938,7 +46613,6 @@
  164.132.222.249
  164.132.224.68
  164.132.225.151
-164.132.225.250
  164.132.228.134
  164.132.229.117
  164.132.23.15
@@ -49955,19 +46629,17 @@
  164.132.38.166
  164.132.40.238
  164.132.41.167
-164.132.41.67
  164.132.42.32
  164.132.44.25
  164.132.45.213
  164.132.46.14
-164.132.46.197
  164.132.47.139
  164.132.47.55
+164.132.48.179
  164.132.49.140
  164.132.54.215
  164.132.56.243
  164.132.57.16
-164.132.7.120
  164.132.73.220
  164.132.75.217
  164.132.9.199
@@ -49977,7 +46649,6 @@
  164.132.95.220
  164.132.97.196
  164.132.98.75
-164.138.23.149
  164.138.236.227
  164.155.117.138
  164.155.117.144
@@ -49985,8 +46656,6 @@
  164.155.231.251
  164.155.64.21
  164.155.67.28
-164.155.77.134
-164.155.93.17
  164.160.128.100
  164.160.128.104
  164.160.128.90
@@ -49994,13 +46663,13 @@
  164.163.201.80
  164.163.21.10
  164.163.23.19
+164.163.231.215
  164.163.239.168
  164.163.250.18
  164.177.104.186
  164.177.158.227
  164.177.60.173
  164.39.137.193
-164.52.106.199
  164.52.116.2
  164.52.24.164
  164.52.24.165
@@ -50021,9 +46690,6 @@
  164.52.24.181
  164.52.24.182
  164.52.24.189
-164.52.29.3
-164.52.42.6
-164.52.7.74
  164.58.29.186
  164.68.104.88
  164.68.106.226
@@ -50043,10 +46709,8 @@
  164.68.122.239
  164.68.123.12
  164.68.124.225
-164.68.125.133
  164.68.126.94
  164.68.97.15
-164.68.97.19
  164.70.241.160
  164.77.112.125
  164.77.114.165
@@ -50065,11 +46729,9 @@
  164.90.146.149
  164.90.146.175
  164.90.149.48
-164.90.150.19
  164.90.150.240
  164.90.151.31
  164.90.152.130
-164.90.152.224
  164.90.152.90
  164.90.155.145
  164.90.155.244
@@ -50077,27 +46739,21 @@
  164.90.158.82
  164.90.160.211
  164.90.164.165
-164.90.177.220
  164.90.181.196
  164.90.183.212
-164.90.190.199
  164.90.190.224
  164.90.194.89
  164.90.201.56
  164.90.208.125
  164.90.210.8
-164.90.212.105
  164.90.212.168
  164.90.214.238
  164.90.215.39
  164.90.216.206
  164.90.217.167
-164.90.222.254
  164.90.224.231
  164.90.225.28
-164.90.225.91
  164.90.227.92
-164.90.238.53
  164.90.241.64
  1643.31cf4fdae.com
  165.0.102.27
@@ -50131,8 +46787,6 @@
  165.16.54.254
  165.16.69.26
  165.16.74.159
-165.16.80.121
-165.16.80.122
  165.165.128.37
  165.165.132.60
  165.165.134.1
@@ -50153,17 +46807,12 @@
  165.22.103.237
  165.22.104.247
  165.22.104.67
-165.22.107.105
  165.22.110.2
-165.22.112.45
  165.22.112.46
  165.22.113.66
  165.22.117.255
-165.22.121.41
  165.22.121.56
-165.22.122.104
  165.22.122.243
-165.22.122.246
  165.22.123.19
  165.22.123.86
  165.22.125.82
@@ -50171,9 +46820,7 @@
  165.22.129.117
  165.22.13.92
  165.22.132.86
-165.22.134.111
  165.22.138.106
-165.22.143.3
  165.22.148.191
  165.22.154.213
  165.22.156.21
@@ -50183,9 +46830,6 @@
  165.22.171.67
  165.22.186.178
  165.22.192.133
-165.22.193.235
-165.22.195.215
-165.22.195.233
  165.22.196.119
  165.22.199.252
  165.22.199.47
@@ -50198,26 +46842,19 @@
  165.22.207.116
  165.22.208.192
  165.22.209.132
-165.22.209.138
  165.22.210.128
  165.22.210.35
  165.22.210.69
  165.22.211.26
-165.22.211.74
  165.22.211.86
-165.22.213.129
  165.22.213.197
  165.22.213.55
-165.22.214.75
-165.22.215.129
  165.22.215.189
  165.22.215.192
  165.22.215.28
  165.22.215.89
  165.22.215.99
  165.22.216.228
-165.22.216.238
-165.22.218.211
  165.22.219.167
  165.22.22.250
  165.22.221.230
@@ -50230,7 +46867,6 @@
  165.22.223.72
  165.22.224.212
  165.22.224.53
-165.22.224.88
  165.22.225.195
  165.22.226.147
  165.22.226.249
@@ -50238,7 +46874,9 @@
  165.22.229.136
  165.22.229.200
  165.22.23.23
+165.22.231.13
  165.22.231.149
+165.22.232.236
  165.22.233.194
  165.22.235.189
  165.22.235.227
@@ -50252,18 +46890,14 @@
  165.22.24.71
  165.22.242.174
  165.22.242.243
-165.22.243.42
  165.22.246.254
  165.22.247.221
  165.22.250.142
  165.22.250.226
  165.22.250.229
  165.22.251.121
-165.22.252.126
  165.22.253.164
-165.22.253.190
  165.22.254.134
-165.22.254.70
  165.22.255.105
  165.22.255.213
  165.22.26.140
@@ -50271,35 +46905,28 @@
  165.22.28.239
  165.22.33.32
  165.22.33.47
-165.22.35.107
  165.22.35.21
  165.22.35.80
  165.22.36.75
  165.22.38.171
  165.22.40.128
-165.22.40.147
  165.22.46.248
  165.22.48.140
  165.22.49.42
  165.22.50.208
-165.22.51.14
-165.22.51.37
  165.22.52.83
-165.22.54.171
-165.22.56.115
+165.22.53.233
  165.22.57.164
  165.22.57.175
  165.22.58.237
  165.22.59.208
  165.22.60.7
  165.22.61.205
-165.22.61.82
  165.22.62.238
  165.22.63.151
-165.22.63.27
+165.22.67.110
  165.22.68.41
  165.22.68.84
-165.22.69.147
  165.22.69.98
  165.22.71.185
  165.22.71.24
@@ -50308,12 +46935,10 @@
  165.22.76.190
  165.22.76.96
  165.22.77.163
-165.22.78.222
  165.22.81.128
  165.22.81.30
  165.22.88.129
  165.22.89.96
-165.22.92.57
  165.22.94.14
  165.22.94.141
  165.22.98.186
@@ -50340,7 +46965,6 @@
  165.227.115.226
  165.227.116.136
  165.227.116.183
-165.227.117.255
  165.227.117.43
  165.227.12.184
  165.227.12.218
@@ -50351,7 +46975,6 @@
  165.227.122.212
  165.227.122.24
  165.227.124.168
-165.227.126.190
  165.227.126.48
  165.227.127.126
  165.227.127.49
@@ -50363,23 +46986,21 @@
  165.227.132.156
  165.227.132.234
  165.227.132.8
-165.227.133.181
  165.227.133.48
-165.227.135.34
  165.227.136.123
  165.227.136.151
+165.227.136.35
  165.227.137.216
  165.227.138.16
  165.227.140.245
-165.227.140.41
  165.227.140.76
  165.227.141.145
  165.227.141.39
  165.227.141.85
  165.227.142.62
+165.227.144.173
  165.227.144.49
  165.227.145.138
-165.227.146.232
  165.227.149.83
  165.227.150.80
  165.227.151.102
@@ -50388,8 +47009,6 @@
  165.227.152.230
  165.227.153.143
  165.227.153.219
-165.227.153.73
-165.227.154.14
  165.227.155.135
  165.227.156.155
  165.227.156.235
@@ -50404,9 +47023,7 @@
  165.227.166.67
  165.227.169.12
  165.227.169.7
-165.227.17.54
  165.227.170.182
-165.227.171.126
  165.227.171.142
  165.227.171.177
  165.227.173.181
@@ -50414,24 +47031,19 @@
  165.227.175.52
  165.227.175.57
  165.227.175.74
-165.227.179.138
  165.227.180.243
  165.227.181.9
  165.227.182.136
  165.227.184.221
-165.227.187.185
  165.227.189.115
  165.227.19.191
  165.227.191.15
  165.227.193.157
  165.227.193.66
-165.227.194.176
-165.227.195.122
  165.227.195.204
  165.227.195.71
  165.227.197.136
  165.227.197.244
-165.227.198.144
  165.227.199.191
  165.227.2.127
  165.227.2.169
@@ -50451,18 +47063,14 @@
  165.227.205.38
  165.227.205.85
  165.227.206.114
-165.227.206.243
  165.227.207.17
  165.227.209.252
  165.227.21.246
  165.227.21.85
  165.227.210.190
  165.227.210.52
-165.227.210.71
-165.227.211.13
  165.227.211.241
  165.227.213.143
-165.227.214.37
  165.227.216.117
  165.227.216.194
  165.227.218.79
@@ -50484,7 +47092,6 @@
  165.227.247.74
  165.227.248.222
  165.227.25.162
-165.227.25.239
  165.227.252.233
  165.227.26.69
  165.227.28.204
@@ -50498,15 +47105,14 @@
  165.227.34.214
  165.227.34.70
  165.227.35.21
-165.227.35.46
  165.227.36.162
  165.227.38.68
  165.227.4.106
+165.227.4.144
  165.227.4.30
  165.227.4.60
  165.227.40.15
  165.227.40.74
-165.227.42.106
  165.227.42.51
  165.227.45.150
  165.227.45.249
@@ -50517,29 +47123,24 @@
  165.227.5.45
  165.227.50.84
  165.227.51.247
-165.227.51.249
  165.227.52.184
  165.227.53.107
  165.227.53.241
  165.227.54.195
  165.227.58.190
-165.227.58.61
  165.227.6.12
  165.227.6.20
  165.227.61.152
  165.227.61.35
-165.227.62.103
  165.227.62.249
  165.227.63.165
  165.227.63.41
-165.227.66.224
  165.227.68.198
  165.227.69.151
  165.227.7.187
  165.227.7.218
  165.227.7.27
  165.227.7.29
-165.227.7.5
  165.227.71.30
  165.227.72.166
  165.227.72.37
@@ -50550,21 +47151,17 @@
  165.227.76.8
  165.227.78.77
  165.227.8.84
-165.227.80.114
  165.227.80.194
  165.227.80.57
  165.227.81.93
  165.227.82.23
  165.227.84.200
  165.227.85.253
-165.227.85.62
  165.227.86.14
  165.227.86.155
  165.227.86.158
-165.227.86.199
  165.227.87.251
  165.227.88.137
-165.227.88.167
  165.227.89.190
  165.227.9.101
  165.227.91.215
@@ -50576,7 +47173,6 @@
  165.227.94.27
  165.227.95.201
  165.227.96.127
-165.227.96.190
  165.228.14.173
  165.228.23.22
  165.231.101.137
@@ -50597,17 +47193,12 @@
  165.231.105.90
  165.231.105.98
  165.231.120.168
-165.231.120.235
-165.231.120.253
  165.231.120.90
-165.231.13.13
  165.231.130.222
  165.231.130.69
  165.231.143.105
  165.231.143.107
-165.231.143.123
-165.231.143.125
-165.231.143.132
+165.231.143.115
  165.231.143.134
  165.231.143.145
  165.231.143.148
@@ -50615,30 +47206,27 @@
  165.231.143.159
  165.231.143.161
  165.231.143.163
-165.231.143.170
  165.231.143.178
-165.231.143.181
  165.231.143.186
  165.231.143.19
  165.231.143.200
  165.231.143.202
-165.231.143.217
-165.231.143.247
+165.231.143.227
  165.231.143.249
  165.231.143.39
+165.231.143.48
  165.231.168.142
-165.231.212.203
  165.231.37.183
  165.231.45.122
  165.231.45.177
  165.231.45.217
-165.231.45.61
-165.231.45.94
  165.231.54.131
  165.231.54.135
  165.231.54.249
  165.231.54.26
  165.231.92.10
+165.231.92.11
+165.231.92.147
  165.231.92.149
  165.231.95.109
  165.231.95.149
@@ -50647,28 +47235,30 @@
  165.231.98.36
  165.232.100.193
  165.232.100.234
-165.232.101.66
+165.232.101.128
+165.232.101.19
  165.232.102.53
  165.232.102.75
+165.232.103.11
  165.232.103.152
  165.232.103.3
-165.232.105.107
-165.232.105.59
  165.232.105.80
+165.232.105.92
  165.232.106.115
  165.232.106.175
-165.232.106.33
  165.232.107.168
  165.232.107.250
  165.232.108.13
-165.232.108.213
-165.232.108.94
+165.232.109.152
+165.232.109.171
  165.232.109.179
  165.232.109.184
-165.232.109.47
-165.232.110.120
+165.232.109.190
+165.232.110.189
+165.232.110.214
  165.232.110.39
  165.232.110.83
+165.232.111.75
  165.232.113.27
  165.232.122.135
  165.232.122.187
@@ -50685,10 +47275,10 @@
  165.232.39.170
  165.232.40.249
  165.232.41.55
+165.232.42.238
  165.232.43.17
  165.232.43.49
  165.232.44.141
-165.232.44.168
  165.232.47.112
  165.232.47.122
  165.232.47.2
@@ -50699,25 +47289,20 @@
  165.232.70.243
  165.232.76.218
  165.232.96.180
-165.232.97.162
-165.232.97.174
  165.232.97.194
  165.232.97.247
-165.232.97.252
+165.232.97.26
  165.232.97.51
  165.232.97.68
-165.232.97.75
  165.232.97.78
  165.232.98.175
-165.232.99.140
-165.232.99.163
  165.255.254.204
-165.255.87.67
  165.255.89.147
  165.255.89.25
  165.255.99.116
  165.3.86.134
  165.3.86.227
+165.3.87.110
  165.3.87.121
  165.3.87.123
  165.3.87.162
@@ -50735,12 +47320,10 @@
  165.3.92.2
  165.3.92.240
  165.3.93.81
-165.56.182.223
  165.73.102.17
  165.73.108.186
  165.73.136.153
  165.73.43.154
-165.84.180.109
  165.84.180.33
  165.84.180.37
  165.84.180.38
@@ -50755,6 +47338,7 @@
  166.111.131.20
  166.111.152.230
  166.111.60.108
+166.130.73.79
  166.137.10.116
  166.137.10.23
  166.137.10.85
@@ -50784,17 +47368,15 @@
  166.137.8.113
  166.137.90.15
  166.152.153.137
-166.153.157.69
-166.153.157.90
  166.166.84.239
  166.170.0.117
  166.170.14.108
  166.170.14.59
  166.170.15.75
  166.170.5.47
+166.210.64.249
  166.216.165.124
  166.216.165.58
-166.239.158.127
  166.48.211.21
  166.48.40.134
  166.48.72.219
@@ -50816,7 +47398,6 @@
  166.70.198.180
  166.70.202.88
  166.70.207.2
-166.70.66.32
  166.70.83.208
  166.70.94.106
  166.78.101.169
@@ -50835,32 +47416,24 @@
  167.114.1.58
  167.114.10.97
  167.114.103.140
-167.114.113.141
-167.114.113.16
  167.114.113.219
-167.114.114.193
  167.114.114.66
-167.114.115.201
  167.114.115.33
  167.114.118.135
  167.114.118.31
  167.114.12.138
-167.114.12.244
  167.114.122.37
  167.114.124.91
  167.114.129.9
-167.114.131.19
+167.114.136.27
  167.114.140.235
  167.114.144.159
-167.114.144.96
  167.114.150.100
-167.114.152.249
+167.114.152.170
  167.114.153.111
-167.114.153.43
  167.114.155.2
  167.114.159.159
  167.114.169.194
-167.114.17.255
  167.114.173.10
  167.114.173.119
  167.114.174.95
@@ -50870,6 +47443,7 @@
  167.114.197.46
  167.114.203.163
  167.114.203.73
+167.114.204.152
  167.114.209.198
  167.114.209.38
  167.114.210.127
@@ -50881,7 +47455,6 @@
  167.114.221.238
  167.114.224.218
  167.114.224.6
-167.114.226.137
  167.114.229.188
  167.114.23.185
  167.114.235.41
@@ -50917,7 +47490,6 @@
  167.114.49.252
  167.114.52.115
  167.114.52.16
-167.114.55.91
  167.114.57.119
  167.114.64.60
  167.114.65.240
@@ -50933,7 +47505,6 @@
  167.132.252.225
  167.140.19.231
  167.142.123.129
-167.142.132.35
  167.142.179.234
  167.146.208.16
  167.146.208.8
@@ -50943,31 +47514,25 @@
  167.160.72.223
  167.160.74.223
  167.160.74.225
-167.160.74.236
  167.160.76.60
  167.160.78.36
  167.172.0.218
  167.172.102.128
-167.172.103.224
  167.172.109.12
  167.172.110.159
  167.172.114.202
-167.172.115.193
  167.172.117.13
  167.172.117.26
  167.172.118.210
-167.172.119.104
  167.172.120.182
-167.172.121.115
+167.172.121.253
  167.172.124.2
-167.172.125.148
  167.172.125.15
  167.172.126.253
  167.172.127.13
  167.172.130.157
  167.172.130.49
  167.172.131.7
-167.172.133.119
  167.172.133.221
  167.172.134.157
  167.172.135.131
@@ -50979,7 +47544,8 @@
  167.172.142.103
  167.172.142.125
  167.172.142.39
-167.172.142.98
+167.172.144.31
+167.172.145.145
  167.172.145.148
  167.172.145.168
  167.172.146.98
@@ -50989,20 +47555,15 @@
  167.172.151.136
  167.172.151.80
  167.172.152.143
-167.172.152.212
  167.172.152.76
-167.172.153.137
  167.172.153.163
  167.172.154.66
  167.172.155.101
  167.172.155.146
  167.172.155.217
-167.172.155.39
  167.172.155.86
  167.172.156.12
  167.172.156.227
-167.172.157.75
-167.172.158.186
  167.172.158.68
  167.172.16.169
  167.172.16.47
@@ -51010,21 +47571,20 @@
  167.172.163.167
  167.172.164.37
  167.172.167.211
+167.172.167.250
  167.172.167.26
  167.172.171.189
  167.172.173.54
-167.172.175.9
  167.172.179.135
  167.172.181.231
-167.172.184.220
+167.172.185.137
  167.172.186.163
-167.172.187.179
+167.172.186.32
  167.172.191.249
  167.172.193.202
  167.172.193.245
  167.172.193.249
  167.172.194.231
-167.172.195.227
  167.172.195.99
  167.172.20.158
  167.172.20.25
@@ -51034,31 +47594,23 @@
  167.172.204.125
  167.172.205.116
  167.172.207.139
-167.172.207.89
  167.172.209.140
  167.172.209.209
  167.172.212.150
  167.172.213.83
-167.172.214.200
  167.172.215.83
  167.172.216.125
-167.172.216.29
  167.172.22.209
  167.172.222.127
  167.172.226.175
  167.172.23.70
  167.172.235.137
  167.172.235.25
-167.172.235.94
-167.172.238.157
  167.172.238.159
-167.172.239.116
  167.172.24.172
  167.172.241.44
-167.172.241.91
  167.172.242.210
  167.172.242.220
-167.172.243.126
  167.172.246.93
  167.172.247.19
  167.172.247.37
@@ -51071,7 +47623,6 @@
  167.172.255.123
  167.172.255.140
  167.172.31.31
-167.172.32.22
  167.172.33.0
  167.172.33.229
  167.172.34.114
@@ -51092,31 +47643,23 @@
  167.172.55.57
  167.172.55.6
  167.172.56.36
+167.172.57.1
  167.172.57.10
-167.172.57.75
  167.172.58.67
  167.172.59.163
  167.172.61.145
  167.172.61.172
-167.172.62.15
  167.172.63.17
-167.172.69.52
  167.172.78.207
  167.172.78.73
-167.172.98.198
  167.172.98.89
-167.179.113.231
-167.179.116.33
  167.179.13.185
  167.179.13.196
  167.179.139.79
  167.179.153.249
-167.179.156.20
  167.179.161.32
  167.179.4.134
-167.179.4.142
  167.179.64.113
-167.179.67.20
  167.179.77.92
  167.179.78.187
  167.179.80.162
@@ -51126,7 +47669,6 @@
  167.179.96.13
  167.179.96.172
  167.233.7.66
-167.233.7.67
  167.248.133.16
  167.248.133.17
  167.248.133.18
@@ -51145,9 +47687,7 @@
  167.248.133.31
  167.248.133.37
  167.248.133.38
-167.248.133.39
  167.248.133.40
-167.248.133.53
  167.248.133.54
  167.248.133.55
  167.248.133.56
@@ -51183,21 +47723,21 @@
  167.248.133.93
  167.248.133.94
  167.248.133.95
+167.249.10.73
  167.249.11.57
  167.249.170.26
  167.249.212.17
+167.249.220.68
  167.249.252.50
  167.249.254.1
  167.249.255.129
  167.249.66.0
  167.249.9.37
  167.250.11.234
-167.250.127.235
  167.250.140.145
  167.250.140.146
  167.250.160.206
  167.250.206.195
-167.250.219.166
  167.250.49.155
  167.250.65.246
  167.250.81.54
@@ -51216,11 +47756,9 @@
  167.71.102.201
  167.71.102.95
  167.71.103.23
+167.71.104.1
  167.71.104.233
-167.71.105.241
-167.71.106.105
  167.71.106.29
-167.71.109.97
  167.71.11.115
  167.71.11.57
  167.71.110.14
@@ -51253,14 +47791,10 @@
  167.71.131.200
  167.71.132.175
  167.71.132.210
-167.71.134.241
  167.71.139.119
  167.71.140.178
-167.71.140.57
  167.71.143.138
-167.71.143.63
  167.71.145.201
-167.71.146.220
  167.71.146.237
  167.71.147.212
  167.71.149.139
@@ -51281,34 +47815,23 @@
  167.71.168.194
  167.71.172.18
  167.71.172.39
-167.71.173.237
  167.71.174.63
  167.71.175.10
-167.71.176.84
  167.71.177.236
  167.71.184.89
  167.71.185.113
  167.71.186.157
-167.71.192.77
  167.71.196.176
  167.71.197.10
  167.71.202.109
-167.71.202.162
  167.71.202.40
  167.71.202.93
-167.71.203.197
-167.71.203.215
  167.71.204.250
-167.71.207.168
  167.71.209.115
-167.71.209.152
  167.71.209.158
+167.71.209.193
  167.71.209.2
-167.71.209.43
-167.71.210.34
  167.71.210.7
-167.71.211.85
-167.71.212.3
  167.71.213.125
  167.71.213.179
  167.71.213.19
@@ -51321,7 +47844,6 @@
  167.71.220.147
  167.71.223.147
  167.71.224.129
-167.71.224.182
  167.71.225.166
  167.71.225.60
  167.71.226.130
@@ -51329,13 +47851,10 @@
  167.71.226.179
  167.71.228.222
  167.71.228.224
-167.71.228.227
  167.71.228.241
  167.71.230.63
  167.71.230.77
  167.71.231.77
-167.71.232.61
-167.71.233.4
  167.71.233.60
  167.71.233.75
  167.71.234.134
@@ -51346,7 +47865,7 @@
  167.71.237.128
  167.71.237.130
  167.71.238.204
-167.71.242.140
+167.71.239.181
  167.71.243.218
  167.71.246.105
  167.71.250.215
@@ -51356,35 +47875,26 @@
  167.71.37.163
  167.71.38.104
  167.71.39.132
-167.71.39.63
  167.71.4.250
  167.71.41.253
-167.71.43.17
  167.71.43.36
-167.71.45.35
  167.71.46.139
  167.71.46.162
  167.71.46.185
  167.71.5.86
  167.71.50.123
  167.71.51.223
-167.71.52.241
  167.71.52.95
  167.71.53.124
-167.71.53.185
-167.71.55.150
  167.71.59.56
  167.71.6.91
  167.71.63.130
+167.71.63.47
  167.71.64.192
-167.71.67.238
  167.71.69.142
-167.71.69.193
  167.71.69.26
  167.71.7.109
-167.71.7.191
  167.71.70.36
-167.71.71.147
  167.71.72.205
  167.71.72.70
  167.71.72.77
@@ -51393,17 +47903,12 @@
  167.71.73.6
  167.71.74.39
  167.71.75.102
-167.71.76.122
  167.71.76.254
  167.71.77.120
-167.71.78.207
  167.71.81.215
  167.71.83.150
-167.71.83.6
  167.71.86.88
-167.71.89.108
  167.71.9.180
-167.71.91.205
  167.71.91.58
  167.71.95.157
  167.71.96.148
@@ -51414,31 +47919,26 @@
  167.86.100.98
  167.86.101.64
  167.86.102.174
+167.86.103.221
  167.86.105.53
  167.86.109.171
-167.86.109.29
  167.86.110.76
-167.86.112.25
-167.86.113.187
  167.86.113.5
  167.86.116.198
  167.86.116.202
-167.86.117.236
  167.86.120.160
-167.86.122.102
  167.86.66.45
  167.86.67.67
  167.86.73.32
  167.86.73.56
-167.86.75.232
  167.86.78.148
+167.86.79.150
  167.86.79.47
  167.86.80.173
  167.86.81.74
  167.86.85.191
  167.86.87.90
  167.86.88.228
-167.86.88.34
  167.86.90.239
  167.86.93.224
  167.86.94.107
@@ -51449,10 +47949,10 @@
  167.86.99.118
  167.88.112.108
  167.88.114.245
+167.88.12.157
  167.88.125.122
  167.88.15.198
  167.88.161.51
-167.88.170.2
  167.88.177.213
  167.88.178.19
  167.88.179.86
@@ -51462,10 +47962,8 @@
  167.88.181.219
  167.88.7.134
  167.89.100.139
-167.89.27.74
  167.89.38.99
  167.89.72.11
-167.89.84.44
  167.98.119.77
  167.99.1.98
  167.99.101.77
@@ -51483,15 +47981,14 @@
  167.99.110.179
  167.99.110.42
  167.99.112.243
+167.99.12.47
  167.99.128.199
  167.99.13.63
  167.99.13.90
  167.99.131.243
  167.99.131.74
  167.99.133.17
-167.99.134.25
  167.99.134.58
-167.99.137.196
  167.99.137.75
  167.99.139.208
  167.99.139.36
@@ -51504,11 +48001,8 @@
  167.99.144.235
  167.99.148.145
  167.99.148.91
-167.99.149.32
-167.99.15.232
-167.99.153.200
+167.99.149.105
  167.99.155.36
-167.99.157.37
  167.99.159.142
  167.99.160.14
  167.99.160.9
@@ -51523,20 +48017,17 @@
  167.99.170.83
  167.99.170.91
  167.99.172.154
-167.99.172.247
  167.99.174.205
  167.99.177.38
-167.99.179.192
  167.99.179.226
  167.99.181.33
+167.99.181.63
  167.99.182.171
  167.99.182.209
  167.99.183.120
  167.99.183.137
-167.99.183.237
  167.99.184.107
  167.99.185.209
-167.99.185.216
  167.99.185.235
  167.99.186.115
  167.99.186.182
@@ -51565,13 +48056,11 @@
  167.99.219.72
  167.99.220.148
  167.99.224.109
-167.99.224.160
  167.99.224.27
  167.99.228.58
  167.99.229.150
  167.99.230.48
  167.99.232.215
-167.99.234.170
  167.99.234.199
  167.99.234.59
  167.99.235.21
@@ -51581,14 +48070,12 @@
  167.99.240.141
  167.99.240.185
  167.99.241.108
-167.99.241.94
  167.99.242.1
  167.99.242.54
-167.99.243.61
+167.99.242.91
  167.99.246.116
  167.99.247.183
  167.99.247.80
-167.99.249.11
  167.99.249.229
  167.99.250.59
  167.99.251.157
@@ -51628,12 +48115,12 @@
  167.99.64.181
  167.99.64.81
  167.99.65.231
+167.99.66.107
  167.99.66.2
  167.99.66.74
  167.99.67.142
  167.99.67.209
  167.99.68.65
-167.99.69.130
  167.99.69.167
  167.99.7.149
  167.99.7.190
@@ -51644,8 +48131,6 @@
  167.99.70.54
  167.99.71.171
  167.99.72.149
-167.99.73.254
-167.99.74.187
  167.99.74.227
  167.99.75.174
  167.99.75.240
@@ -51655,12 +48140,9 @@
  167.99.77.94
  167.99.78.164
  167.99.78.74
-167.99.78.90
  167.99.82.226
  167.99.83.190
-167.99.87.226
  167.99.87.4
-167.99.87.82
  167.99.88.218
  167.99.88.37
  167.99.88.51
@@ -51682,9 +48164,9 @@
  167.99.98.92
  167.99.99.10
  168.0.149.216
+168.0.149.44
  168.0.155.138
  168.0.175.247
-168.0.176.23
  168.0.68.116
  168.0.68.218
  168.0.7.27
@@ -51709,6 +48191,7 @@
  168.119.154.14
  168.119.155.116
  168.119.156.9
+168.119.160.17
  168.119.161.159
  168.119.161.168
  168.119.161.172
@@ -51749,6 +48232,7 @@
  168.119.176.228
  168.119.18.7
  168.119.225.139
+168.119.225.152
  168.119.226.170
  168.119.226.174
  168.119.226.176
@@ -51766,12 +48250,10 @@
  168.119.96.193
  168.119.98.106
  168.121.104.115
-168.121.106.3
  168.121.137.64
  168.121.139.199
  168.121.139.31
  168.121.175.149
-168.121.224.125
  168.121.224.140
  168.121.224.163
  168.121.54.139
@@ -51788,7 +48270,6 @@
  168.126.187.88
  168.126.250.1
  168.128.130.59
-168.128.70.151
  168.138.137.117
  168.138.14.139
  168.138.219.129
@@ -51800,11 +48281,16 @@
  168.144.170.33
  168.144.91.77
  168.149.227.132
+168.151.226.149
+168.151.226.57
+168.151.226.71
  168.151.228.148
+168.151.228.153
  168.151.228.219
  168.151.228.228
  168.151.228.34
  168.151.228.51
+168.151.228.97
  168.151.229.122
  168.151.229.138
  168.151.229.215
@@ -51821,13 +48307,11 @@
  168.181.123.117
  168.181.128.130
  168.181.128.132
+168.181.128.134
  168.181.128.137
  168.181.128.138
  168.181.128.140
  168.181.128.144
-168.181.128.152
-168.181.128.156
-168.181.128.158
  168.181.128.160
  168.181.128.165
  168.181.128.166
@@ -51849,21 +48333,20 @@
  168.181.245.129
  168.181.254.241
  168.181.36.135
-168.181.48.236
-168.181.51.180
+168.181.48.240
  168.181.56.38
  168.181.62.74
  168.184.14.14
+168.194.108.131
+168.194.108.132
  168.194.112.88
-168.194.13.19
  168.194.13.4
  168.194.14.126
-168.194.154.139
  168.194.157.250
+168.194.161.75
  168.194.164.46
  168.194.165.74
  168.194.201.6
-168.194.207.58
  168.194.229.55
  168.194.25.206
  168.194.251.75
@@ -51875,7 +48358,6 @@
  168.195.135.46
  168.195.181.14
  168.195.182.62
-168.195.187.34
  168.195.196.14
  168.195.196.18
  168.195.196.25
@@ -51896,7 +48378,6 @@
  168.196.114.7
  168.196.12.27
  168.196.152.138
-168.196.165.26
  168.196.255.38
  168.196.52.80
  168.196.52.82
@@ -51908,13 +48389,11 @@
  168.197.17.29
  168.197.18.197
  168.197.18.93
-168.197.226.235
  168.197.252.162
-168.197.31.14
  168.197.52.224
  168.197.72.212
  168.205.102.146
-168.205.108.149
+168.205.109.11
  168.205.111.6
  168.205.124.51
  168.205.125.65
@@ -51922,9 +48401,6 @@
  168.205.190.237
  168.205.190.4
  168.205.192.150
-168.205.192.160
-168.205.192.185
-168.205.192.190
  168.205.192.200
  168.205.217.196
  168.205.217.202
@@ -51932,6 +48408,7 @@
  168.205.218.101
  168.205.218.113
  168.205.218.138
+168.205.218.143
  168.205.218.167
  168.205.218.209
  168.205.218.230
@@ -51940,7 +48417,6 @@
  168.205.220.135
  168.205.221.137
  168.205.223.139
-168.205.92.82
  168.215.65.65
  168.215.65.66
  168.215.65.67
@@ -51966,22 +48442,17 @@
  168.227.158.9
  168.227.169.12
  168.227.212.130
-168.227.213.83
-168.227.224.30
  168.227.76.101
  168.227.76.103
  168.227.78.112
  168.227.78.251
  168.227.88.39
-168.227.99.10
  168.227.99.11
  168.228.118.25
-168.228.150.5
  168.228.157.25
  168.228.165.17
  168.228.179.254
  168.228.192.13
-168.228.197.216
  168.228.204.250
  168.228.207.98
  168.228.51.197
@@ -51993,10 +48464,10 @@
  168.232.115.166
  168.232.12.123
  168.232.128.5
+168.232.13.50
  168.232.14.202
  168.232.15.162
  168.232.15.186
-168.232.167.58
  168.232.172.4
  168.232.189.138
  168.232.189.243
@@ -52005,7 +48476,6 @@
  168.232.197.36
  168.232.198.149
  168.232.198.195
-168.232.198.218
  168.232.198.246
  168.232.20.155
  168.232.20.39
@@ -52018,27 +48488,21 @@
  168.235.67.138
  168.235.69.202
  168.235.69.21
-168.235.70.188
  168.235.74.110
  168.235.80.87
  168.235.83.139
  168.235.89.145
  168.235.90.188
-168.235.93.165
  168.235.98.150
  168.243.166.195
  168.244.164.90
  168.245.28.80
-168.245.96.169
  168.253.114.247
  168.253.114.43
  168.253.117.138
  168.61.181.202
-168.61.208.222
  168.61.39.125
-168.61.48.144
  168.61.52.35
-168.62.166.87
  168.62.174.233
  168.62.175.22
  168.62.218.152
@@ -52049,19 +48513,14 @@
  168.63.151.21
  168.63.154.243
  168.63.204.229
-168.63.213.144
  168.63.54.181
-168.63.68.147
-168.63.76.243
  168.70.109.97
  168.70.37.71
  168.70.51.139
  168.70.53.206
  168.70.62.74
  168.70.8.188
-168.83.76.7
  168.90.113.136
-168.90.114.175
  168.90.139.20
  168.90.169.244
  168.90.196.105
@@ -52098,13 +48557,12 @@
  169.0.81.76
  169.0.96.25
  169.1.23.11
+169.1.24.161
  169.1.39.242
  169.149.133.127
-169.159.130.225
  169.239.120.11
  169.239.120.86
  169.239.120.93
-169.239.128.152
  169.239.166.134
  169.239.169.190
  169.239.171.59
@@ -52133,8 +48591,8 @@
  169.255.68.148
  169.255.75.117
  169.255.79.47
-169.38.96.39
  169.44.34.203
+169.45.86.221
  169.45.99.51
  169.47.2.89
  169.48.163.176
@@ -52152,9 +48610,7 @@
  169.56.71.185
  169.56.82.101
  169.60.128.104
-169.60.175.182
  169.61.217.70
-169.62.102.6
  169.62.121.197
  16acc1ba3b3001611.temporary.link
  16julpdtr-moviesplsnetfflx.com
@@ -52164,24 +48620,20 @@
  17.5studio.eu
  170.0.126.252
  170.0.154.189
-170.0.190.155
  170.0.190.5
  170.0.198.103
  170.0.202.6
  170.0.203.0
  170.0.203.117
-170.0.236.142
  170.0.52.146
  170.0.52.226
  170.0.52.29
  170.0.52.6
  170.0.54.253
  170.106.104.152
+170.106.143.105
  170.106.151.211
-170.106.153.63
  170.106.155.8
-170.106.3.225
-170.106.33.194
  170.106.33.223
  170.106.33.94
  170.106.34.74
@@ -52218,7 +48670,6 @@
  170.106.38.159
  170.106.38.178
  170.106.38.182
-170.106.38.190
  170.106.38.205
  170.106.38.214
  170.106.38.23
@@ -52276,7 +48727,6 @@
  170.106.84.238
  170.106.84.58
  170.106.84.83
-170.106.9.125
  170.11.34.100
  170.11.34.101
  170.11.34.104
@@ -52386,14 +48836,13 @@
  170.146.220.230
  170.146.221.13
  170.146.221.230
-170.150.1.150
  170.150.101.224
  170.150.102.69
+170.150.103.93
  170.150.2.92
  170.150.52.210
  170.150.52.5
  170.150.52.65
-170.150.53.125
  170.150.72.28
  170.150.8.1
  170.151.0.4
@@ -52406,9 +48855,9 @@
  170.178.163.218
  170.178.178.194
  170.185.68.14
+170.199.77.67
  170.199.81.81
  170.210.121.208
-170.210.121.66
  170.210.136.56
  170.210.192.78
  170.210.203.201
@@ -52417,21 +48866,19 @@
  170.210.214.51
  170.210.221.48
  170.210.4.222
-170.210.52.126
  170.210.71.10
-170.210.83.119
  170.231.187.209
  170.231.220.148
  170.231.232.97
  170.231.247.151
  170.231.247.202
  170.231.56.3
+170.233.117.110
  170.233.136.55
  170.233.136.69
  170.233.136.87
  170.233.138.115
  170.233.138.50
-170.233.36.178
  170.233.47.12
  170.233.47.14
  170.233.69.126
@@ -52449,7 +48896,7 @@
  170.239.109.186
  170.239.118.175
  170.239.128.7
-170.239.148.253
+170.239.138.21
  170.239.223.14
  170.239.223.240
  170.239.223.38
@@ -52462,22 +48909,25 @@
  170.244.176.26
  170.244.180.28
  170.244.188.29
-170.244.44.51
  170.244.64.12
  170.244.64.129
  170.244.64.130
  170.244.64.198
  170.244.64.225
-170.244.76.199
+170.244.68.106
+170.244.76.224
  170.244.88.67
  170.245.127.170
  170.245.127.172
+170.245.216.117
  170.245.241.65
  170.245.241.76
  170.245.243.74
  170.245.244.70
  170.245.249.13
  170.246.204.52
+170.246.205.174
+170.246.206.236
  170.246.85.106
  170.246.85.108
  170.246.85.38
@@ -52492,12 +48942,14 @@
  170.247.112.77
  170.247.158.23
  170.247.20.41
+170.247.202.129
  170.247.202.134
  170.247.202.46
  170.247.203.34
  170.247.43.142
  170.249.178.19
  170.249.191.114
+170.249.37.243
  170.250.113.211
  170.253.14.119
  170.253.17.217
@@ -52509,14 +48961,13 @@
  170.253.31.208
  170.253.33.200
  170.253.39.158
-170.253.4.153
+170.253.43.234
  170.253.62.139
  170.254.148.94
  170.254.162.165
+170.254.17.33
  170.254.204.86
-170.254.213.227
  170.254.224.7
-170.254.226.100
  170.254.248.61
  170.254.26.67
  170.254.83.94
@@ -52526,19 +48977,22 @@
  170.75.149.14
  170.75.150.50
  170.75.162.97
-170.75.163.136
  170.78.120.141
  170.78.120.213
  170.78.120.247
+170.78.160.42
  170.78.21.138
  170.78.228.196
  170.78.232.96
+170.78.37.33
  170.78.38.96
  170.78.39.132
  170.78.39.15
  170.78.39.58bin.sh
  170.78.6.130
-170.79.168.221
+170.78.60.4
+170.79.153.247
+170.79.167.84
  170.79.180.150
  170.79.180.154
  170.79.180.156
@@ -52547,7 +49001,6 @@
  170.79.181.166
  170.79.181.74
  170.79.181.82
-170.79.221.210
  170.79.233.162
  170.79.233.3
  170.79.33.138
@@ -52556,27 +49009,29 @@
  170.79.68.93
  170.79.68.96
  170.79.70.177
+170.79.87.119
  170.79.87.178
  170.79.88.115
  170.79.9.54
  170.79.91.98
-170.79.95.248
  170.80.12.129
  170.80.184.157
-170.80.204.25
+170.80.204.61
+170.80.204.7
  170.80.204.89
+170.80.207.2
  170.80.207.28
  170.80.207.31
-170.80.207.52
  170.80.21.148
  170.80.21.154
+170.80.226.187
  170.80.31.102
  170.80.36.150
  170.80.36.2
-170.80.41.222
  170.80.49.114
  170.80.51.206
  170.80.68.242
+170.80.71.19
  170.80.91.1
  170.80.91.10
  170.80.91.2
@@ -52585,17 +49040,13 @@
  170.80.91.6
  170.80.91.65
  170.80.91.8
-170.81.0.93
  170.81.0.94
  170.81.140.12
  170.81.140.79
  170.81.141.249
  170.81.141.254
-170.81.141.34
  170.81.149.210
  170.81.149.83
-170.81.19.74
-170.81.19.75
  170.81.231.187
  170.81.252.202
  170.81.34.54
@@ -52616,9 +49067,9 @@
  170.82.54.39
  170.82.7.250
  170.83.115.4
-170.83.125.146
  170.83.156.14
  170.83.17.251
+170.83.177.134
  170.83.177.148
  170.83.177.211
  170.83.177.233
@@ -52629,18 +49080,22 @@
  170.83.178.176
  170.83.178.185
  170.83.178.193
-170.83.178.230
  170.83.178.61
  170.83.178.83
  170.83.178.85
+170.83.178.86
  170.83.179.116
+170.83.179.139
  170.83.179.168
  170.83.179.179
  170.83.179.217
  170.83.179.92
+170.83.188.105
+170.83.188.97
+170.83.189.143
  170.83.199.9
  170.83.41.73
-170.83.76.187
+170.83.97.39
  170.84.182.145
  170.84.182.146
  170.84.183.2
@@ -52648,6 +49103,7 @@
  170.84.27.193
  170.84.48.105
  170.84.48.118
+170.84.48.174
  170.84.48.206
  170.84.48.230
  170.84.48.48
@@ -52663,15 +49119,12 @@
  171.100.56.54
  171.100.58.2
  171.100.58.6
-171.100.69.230
-171.100.77.44
  171.100.8.82
  171.100.9.126
-171.101.52.3
  171.101.68.161
-171.101.68.79
  171.103.174.222
  171.103.190.158
+171.103.195.50
  171.103.9.22
  171.104.126.183
  171.104.221.112
@@ -52705,26 +49158,25 @@
  171.113.40.47
  171.114.123.61
  171.114.15.53
-171.115.161.146
  171.115.161.89
  171.116.146.126
  171.116.183.38
-171.116.255.218
  171.116.38.60
  171.117.219.77
+171.117.227.170
  171.118.188.34
  171.118.24.229
  171.118.244.234
+171.118.96.67
  171.119.209.26
  171.119.210.96
-171.119.211.231
  171.119.214.254
  171.119.219.217
  171.119.223.219
  171.119.239.241
  171.12.115.239
-171.12.98.96
  171.120.112.52
+171.120.113.128
  171.120.28.56
  171.121.101.185
  171.121.122.102
@@ -52732,7 +49184,6 @@
  171.121.140.100
  171.121.18.75
  171.121.255.12
-171.121.29.41
  171.121.57.83
  171.121.7.44
  171.121.95.62
@@ -52753,28 +49204,29 @@
  171.125.12.144
  171.125.136.63
  171.125.139.15
+171.125.171.1
  171.125.181.172
  171.125.195.122
  171.125.21.189
  171.125.218.48
  171.125.223.180
+171.125.233.240
  171.125.239.61
  171.125.250.157
  171.125.26.105
  171.125.36.39
-171.125.4.198
  171.125.45.193
  171.125.50.166
  171.125.54.218
  171.125.80.84
-171.125.88.223
  171.125.88.253
  171.126.212.227
  171.126.32.220
+171.126.46.254
  171.127.151.86
  171.13.138.173
+171.13.150.19
  171.15.132.54
-171.15.156.182
  171.15.16.116
  171.15.17.161
  171.15.17.90
@@ -52788,31 +49240,24 @@
  171.212.200.233
  171.212.208.202
  171.212.209.252
-171.212.91.160
-171.212.91.193
+171.214.130.227
  171.214.132.156
  171.214.204.23
  171.214.204.30
  171.214.204.59
  171.217.104.202
-171.217.34.96
  171.217.71.131
  171.217.89.101
  171.217.92.33
  171.22.121.37
-171.22.121.4
  171.22.122.234
  171.22.123.118
-171.22.123.124
  171.22.123.207
  171.22.123.6
-171.22.145.223
  171.22.253.115
  171.22.253.144
  171.22.253.186
  171.22.253.201
-171.22.253.38
-171.22.253.78
  171.22.254.245
  171.22.255.135
  171.22.255.170
@@ -52821,9 +49266,6 @@
  171.220.181.90
  171.220.191.175
  171.220.191.53
-171.220.242.90
-171.220.243.179
-171.220.243.192
  171.220.243.213
  171.221.146.202
  171.221.2.114
@@ -52833,55 +49275,49 @@
  171.221.236.226
  171.221.242.23
  171.221.25.40
-171.221.254.175
-171.221.26.182
  171.221.26.6
-171.221.26.98
  171.221.39.9
  171.221.42.113
  171.223.111.237
  171.223.210.8
  171.224.118.89
-171.224.178.66
+171.224.178.179
+171.224.179.144
  171.224.189.56
  171.224.191.225
-171.224.22.218
  171.224.83.12
-171.225.251.94
-171.226.128.197
+171.225.250.159
  171.226.135.8
  171.226.153.68
+171.226.155.111
  171.226.19.191
  171.226.197.110
  171.226.38.187
  171.227.105.68
  171.227.172.174
-171.227.210.150
  171.227.211.37
  171.227.214.11
  171.227.252.213
-171.227.72.218
  171.227.79.199
  171.228.173.63
  171.228.178.101
  171.228.222.123
  171.228.68.79
-171.228.94.20
  171.229.152.45
  171.229.203.34
+171.229.235.108
  171.229.49.86
  171.229.7.138
-171.229.96.177
  171.231.119.195
  171.231.123.2
  171.231.128.43
  171.231.151.183
  171.231.168.217
-171.231.225.191
  171.231.24.34
  171.232.119.171
  171.232.170.81
  171.232.251.62
+171.232.26.172
  171.232.47.51
  171.233.133.178
  171.233.227.123
@@ -52895,9 +49331,9 @@
  171.235.183.154
  171.235.185.81
  171.235.193.78
+171.235.61.139
  171.235.64.66
  171.235.72.64
-171.235.80.150
  171.236.125.124
  171.236.125.139
  171.236.125.88
@@ -52908,7 +49344,6 @@
  171.237.59.47
  171.238.53.21
  171.239.130.54
-171.239.133.26
  171.239.134.181
  171.239.158.249
  171.239.169.246
@@ -52918,7 +49353,6 @@
  171.239.19.116
  171.239.199.19
  171.239.22.160
-171.239.226.254
  171.239.230.220
  171.239.243.106
  171.239.245.203
@@ -52926,9 +49360,10 @@
  171.240.137.253
  171.240.138.210
  171.240.185.14
+171.240.192.30
+171.240.195.10
  171.240.199.109
  171.240.201.118
-171.240.202.22
  171.240.210.217
  171.240.213.254
  171.240.217.98
@@ -52939,11 +49374,10 @@
  171.241.132.205
  171.241.14.170
  171.241.149.89
-171.241.7.142
-171.241.73.82
+171.241.48.219
  171.242.16.226
  171.242.170.180
-171.242.68.31
+171.242.96.208
  171.243.116.79
  171.243.234.27
  171.243.36.123
@@ -52953,7 +49387,6 @@
  171.244.10.69
  171.244.133.246
  171.244.137.38
-171.244.139.171
  171.244.139.178
  171.244.139.236
  171.244.139.67
@@ -52975,16 +49408,14 @@
  171.245.228.40
  171.245.236.33
  171.245.251.191
-171.246.104.207
  171.246.17.116
  171.246.37.104
  171.246.41.64
  171.246.42.99
-171.246.56.62
-171.246.68.154
  171.247.145.61
  171.247.148.137
  171.247.171.226
+171.247.172.56
  171.247.177.120
  171.247.178.146
  171.247.243.251
@@ -53014,7 +49445,6 @@
  171.25.193.25
  171.25.193.77
  171.25.193.78
-171.25.209.203
  171.250.106.156
  171.250.108.132
  171.250.110.199
@@ -53026,11 +49456,14 @@
  171.250.211.111
  171.250.244.30
  171.250.3.216
+171.250.39.151
  171.250.50.83
  171.251.159.3
  171.251.24.13
+171.251.30.77
  171.252.113.217
  171.252.116.64
+171.252.155.195
  171.252.155.32
  171.252.188.35
  171.252.21.225
@@ -53041,7 +49474,6 @@
  171.253.99.57
  171.254.10.34
  171.254.204.79
-171.254.205.213
  171.254.224.32
  171.254.64.56
  171.255.199.129
@@ -53050,32 +49482,34 @@
  171.255.251.32
  171.34.112.119
  171.34.113.168
-171.34.173.17
-171.34.177.68
+171.34.114.145
  171.34.178.93
+171.34.179.118
  171.34.179.79
-171.34.197.241
  171.34.42.155
  171.35.140.42
-171.35.147.91
  171.35.160.216
-171.35.161.106
  171.35.166.206
-171.35.167.216
  171.35.167.42
  171.35.167.73
+171.35.169.189
  171.35.169.230
  171.35.170.35
-171.35.171.20
+171.35.171.18
  171.35.173.184
  171.35.65.80
  171.37.86.53
-171.38.144.2
+171.38.150.1
  171.38.192.192
  171.38.193.179
+171.38.195.157
+171.38.195.178
  171.39.0.8
+171.40.239.35
  171.42.161.164bin.sh
+171.42.161.67
  171.43.175.85
+171.44.140.248
  171.44.141.44
  171.44.142.27
  171.5.161.30
@@ -53084,12 +49518,13 @@
  171.5.25.152
  171.5.26.96
  171.5.28.152
-171.50.179.166
+171.5.30.109
  171.6.1.45
  171.6.101.50
+171.6.129.197
+171.6.142.247
  171.6.150.144
  171.6.152.133
-171.6.159.160
  171.6.160.121
  171.6.229.229
  171.60.193.126
@@ -53097,15 +49532,14 @@
  171.60.251.170
  171.61.181.23
  171.7.13.237
-171.7.13.248
-171.7.237.146
+171.7.17.182
  171.7.27.93
  171.7.75.2
  171.7.76.40
  171.7.77.242
-171.76.128.11
  171.8.105.216
  171.8.106.237
+171.8.135.55
  171.8.6.111
  171.8.68.2
  171.8.69.13
@@ -53117,7 +49551,6 @@
  171.88.188.120
  171.88.35.53
  171.89.57.159
-171.9.117.216
  171.90.251.167
  171.90.251.169
  171.90.251.98
@@ -53126,19 +49559,20 @@
  171.92.16.208
  171.92.198.226
  171.95.71.82
+171.96.156.173
  171.96.192.87
  171.96.247.18
  171.96.94.80
+171.97.100.5
  171.97.106.14
-171.97.107.182
  171.97.107.42
  171.97.122.195
  171.97.122.34
  171.97.129.201
  171.97.217.95
-171.97.239.71
  171.97.242.91
  171.97.40.38
+171.97.42.209
  171.97.67.30
  171.97.9.211
  171.98.73.6
@@ -53191,6 +49625,7 @@
  172.104.167.85
  172.104.169.20
  172.104.169.32
+172.104.17.151
  172.104.175.163
  172.104.176.152
  172.104.178.169
@@ -53302,7 +49737,6 @@
  172.105.11.170
  172.105.11.228
  172.105.11.88
-172.105.112.56
  172.105.116.176
  172.105.120.76
  172.105.126.56
@@ -53395,7 +49829,6 @@
  172.105.33.148
  172.105.35.249
  172.105.36.151
-172.105.36.40
  172.105.37.168
  172.105.37.98
  172.105.38.103
@@ -53464,8 +49897,6 @@
  172.107.92.18
  172.107.94.66
  172.107.95.30
-172.109.146.210
-172.111.144.34
  172.111.144.83
  172.111.144.84
  172.111.144.87
@@ -53592,7 +50023,6 @@
  172.219.78.44
  172.219.82.125
  172.221.65.32
-172.222.200.131
  172.222.209.169
  172.241.168.10
  172.243.228.72
@@ -53601,10 +50031,8 @@
  172.245.104.116
  172.245.104.118
  172.245.105.103
-172.245.106.17
  172.245.110.114
  172.245.110.143
-172.245.110.219
  172.245.112.72
  172.245.135.133
  172.245.153.123
@@ -53615,29 +50043,25 @@
  172.245.159.184
  172.245.16.118
  172.245.163.48
-172.245.180.180
  172.245.181.157
  172.245.181.236
  172.245.181.248
  172.245.184.199
  172.245.185.165
-172.245.185.212
  172.245.186.139
  172.245.19.179
  172.245.191.221
  172.245.205.10
  172.245.205.137
  172.245.21.197
-172.245.210.129
+172.245.210.127
  172.245.211.58
  172.245.214.248
  172.245.218.53
  172.245.220.82
  172.245.224.155
  172.245.228.29
-172.245.230.134
-172.245.241.142
-172.245.241.76
+172.245.230.157
  172.245.244.25
  172.245.244.28
  172.245.25.121
@@ -53647,7 +50071,6 @@
  172.245.25.64
  172.245.25.70
  172.245.25.8
-172.245.253.52
  172.245.253.60
  172.245.26.140
  172.245.28.151
@@ -53658,23 +50081,21 @@
  172.245.44.95
  172.245.5.11
  172.245.5.122
+172.245.5.140
  172.245.52.120
  172.245.52.122
  172.245.52.225
  172.245.52.231
  172.245.56.78
-172.245.60.223
  172.245.60.27
  172.245.64.210
  172.245.64.214
  172.245.64.237
  172.245.64.246
-172.245.66.53
  172.245.7.103
  172.245.7.157
  172.245.71.145
  172.245.72.228
-172.245.75.102
  172.245.79.127
  172.245.79.138
  172.245.79.179
@@ -53684,21 +50105,19 @@
  172.245.86.127
  172.245.87.62
  172.245.88.191
+172.245.88.192
  172.245.92.147
  172.245.95.168
  172.245.97.184
  172.247.143.146
  172.247.246.144
  172.247.5.13
-172.248.13.224
  172.248.174.64
  172.248.22.98
-172.248.4.39
  172.249.171.9
-172.250.71.112
+172.249.82.99
  172.250.94.19
  172.251.35.35
-172.251.93.102
  172.252.180.90
  172.252.209.122
  172.252.242.58
@@ -53707,43 +50126,44 @@
  172.254.236.78
  172.255.125.138
  172.255.81.229
-172.255.81.241
  172.255.82.140
  172.255.82.173
  172.255.83.104
  172.255.83.169
+172.255.83.43
+172.58.231.61
  172.65.198.86
-172.68.10.140
-172.68.10.182
-172.68.11.19
-172.68.133.40
+172.68.10.46
+172.68.11.33
+172.68.132.243
  172.68.144.144
  172.68.146.133
  172.68.146.145
  172.68.146.163
  172.68.211.5
-172.68.238.144
+172.68.238.109
  172.68.238.145
  172.68.239.13
  172.68.239.163
  172.68.239.166
-172.68.239.169
  172.68.239.213
-172.68.239.227
  172.68.239.230
  172.68.239.7
-172.68.246.140
+172.68.239.95
  172.68.254.121
  172.68.255.121
  172.68.255.139
  172.68.255.187
+172.68.37.42
+172.68.37.44
  172.68.46.192
  172.69.10.114
+172.69.10.118
  172.69.10.162
  172.69.10.180
  172.69.10.182
-172.69.10.189
  172.69.10.197
+172.69.10.80
  172.69.134.146
  172.69.134.212
  172.69.134.32
@@ -53752,17 +50172,15 @@
  172.69.135.229
  172.69.135.243
  172.69.135.99
-172.69.138.10
  172.69.138.6
-172.69.190.16
+172.69.190.52
  172.69.190.58
+172.69.190.64
  172.69.190.66
  172.69.190.72
  172.69.194.15
  172.69.22.231
-172.69.69.202
-172.72.255.123
-172.72.92.104
+172.69.71.196
  172.74.184.175
  172.76.4.246
  172.81.140.146
@@ -53777,26 +50195,22 @@
  172.81.208.125
  172.81.208.207
  172.81.208.50
-172.81.209.10
-172.81.210.175
  172.81.211.119
+172.81.211.207
  172.81.215.201
  172.81.227.243
  172.81.234.10
  172.81.235.238
  172.81.235.48
-172.81.237.11
  172.81.239.21
  172.81.239.224
  172.81.240.237
  172.81.241.252
  172.81.241.92
-172.81.242.100
  172.81.242.147
  172.81.242.40
  172.81.243.195
  172.81.243.232
-172.81.253.233
  172.81.254.131
  172.82.128.202
  172.82.149.130
@@ -53805,18 +50219,17 @@
  172.83.11.170
  172.83.12.34
  172.83.153.89
-172.83.4.171
+172.83.154.100
  172.83.43.134
  172.83.45.163
  172.83.64.47
  172.83.73.56
  172.84.166.227
-172.86.114.203
+172.86.114.144
  172.86.120.215
  172.86.121.11
  172.86.126.233
  172.86.127.13
-172.86.181.58
  172.86.186.21
  172.86.188.251
  172.86.64.15
@@ -53830,13 +50243,13 @@
  172.88.228.41
  172.88.235.149
  172.88.54.147
-172.89.54.161
  172.9.104.170
  172.90.13.91
  172.90.198.97
+172.90.208.247
+172.90.236.20
+172.90.97.132
  172.91.208.86
-172.91.39.2
-172.92.144.116
  172.92.157.131
  172.93.101.73
  172.93.120.184
@@ -53848,7 +50261,6 @@
  172.93.4.78
  172.93.40.173
  172.93.43.11
-172.93.43.250
  172.93.49.142
  172.93.5.130
  172.94.107.133
@@ -53863,10 +50275,10 @@
  172.94.23.53
  172.94.23.9
  172.94.24.127
+172.94.24.27
  172.94.24.80
  172.95.161.66
  172.95.161.71
-172.96.16.86
  172.96.161.244
  172.96.166.188
  172.96.176.129
@@ -53885,10 +50297,9 @@
  172.96.231.122
  172.96.238.154
  172.96.241.139
-172.96.242.112
  172.96.251.203
  172.96.254.108
-172.96.95.195
+172.96.93.76
  172.97.218.132
  172.98.193.43
  172.98.193.62
@@ -53907,12 +50318,9 @@
  172910209315.ip-dynamic.com
  172princessbet.com
  173.0.48.123
-173.0.48.126
  173.0.49.138
  173.0.52.241
  173.0.52.249
-173.0.55.226
-173.0.57.197
  173.0.57.210
  173.0.84.66
  173.0.88.66
@@ -53921,7 +50329,6 @@
  173.11.150.73
  173.11.20.42
  173.12.0.170
-173.12.136.105
  173.12.15.68
  173.12.157.141
  173.12.181.181
@@ -53937,7 +50344,6 @@
  173.161.156.201
  173.161.173.158
  173.161.208.193
-173.161.70.37
  173.161.87.170
  173.163.166.140
  173.163.39.49
@@ -53975,7 +50381,6 @@
  173.193.136.52
  173.193.219.168
  173.193.22.6
-173.196.146.66
  173.198.52.58
  173.199.114.115
  173.199.114.171
@@ -54005,6 +50410,7 @@
  173.202.80.16
  173.203.126.125
  173.203.215.83
+173.206.111.64
  173.206.131.123
  173.206.88.248
  173.208.128.10
@@ -54026,7 +50432,6 @@
  173.208.168.194
  173.208.169.26
  173.208.169.42
-173.208.173.114
  173.208.176.146
  173.208.177.58
  173.208.177.59
@@ -54048,6 +50453,7 @@
  173.208.249.194
  173.208.46.67
  173.208.83.218
+173.209.167.66
  173.209.168.43
  173.209.39.196
  173.209.44.34
@@ -54081,7 +50487,6 @@
  173.212.222.97
  173.212.223.94
  173.212.225.214
-173.212.226.164
  173.212.226.236
  173.212.228.180
  173.212.231.228
@@ -54107,7 +50512,6 @@
  173.214.174.108
  173.214.181.39
  173.214.185.62
-173.214.248.127
  173.216.245.75
  173.217.246.229
  173.217.255.36
@@ -54115,7 +50519,6 @@
  173.218.85.193
  173.219.43.147
  173.219.86.196
-173.219.87.30
  173.22.198.85
  173.220.112.156
  173.220.199.42
@@ -54139,6 +50542,7 @@
  173.230.142.20
  173.230.147.115
  173.230.149.21
+173.230.150.56
  173.230.151.76
  173.230.153.37
  173.230.157.253
@@ -54151,14 +50555,13 @@
  173.231.63.88
  173.232.146.141
  173.232.146.53
-173.232.19.228
+173.232.226.210
+173.232.226.220
  173.232.226.94
  173.233.6.245
  173.233.72.96
-173.234.100.109
  173.234.100.207
  173.234.143.176
-173.234.151.203
  173.234.153.122
  173.234.154.143
  173.234.154.216
@@ -54940,11 +51343,19 @@
  173.234.227.99
  173.236.144.82
  173.236.146.9
-173.236.149.33
  173.236.152.135
  173.236.176.109
-173.236.176.127
+173.236.176.119
  173.236.176.14
+173.236.176.156
+173.236.176.85
+173.236.179.13
+173.236.179.211
+173.236.179.224
+173.236.180.13
+173.236.180.32
+173.236.181.154
+173.236.182.188
  173.236.194.65
  173.236.224.16
  173.236.242.192
@@ -54974,16 +51385,16 @@
  173.244.209.5
  173.244.36.48
  173.244.48.66
-173.245.202.108
-173.245.202.152
-173.245.202.154
  173.245.202.176
-173.245.202.187
+173.245.202.184
+173.245.202.194
  173.245.202.207
-173.245.203.28
-173.245.203.45
-173.245.203.94
-173.245.203.99
+173.245.202.74
+173.245.203.100
+173.245.203.112
+173.245.203.34
+173.245.203.46
+173.245.203.82
  173.245.71.147
  173.245.87.26
  173.246.103.8
@@ -55006,21 +51417,18 @@
  173.249.0.235
  173.249.1.160
  173.249.12.221
-173.249.16.117
  173.249.2.209
  173.249.2.32
-173.249.20.57
  173.249.22.26
  173.249.24.64
  173.249.25.217
  173.249.29.113
-173.249.29.54
  173.249.3.25
+173.249.30.165
  173.249.30.201
  173.249.33.26
  173.249.34.166
  173.249.34.251
-173.249.34.57
  173.249.35.163
  173.249.36.68
  173.249.40.36
@@ -55044,7 +51452,6 @@
  173.249.53.194
  173.249.54.32
  173.249.55.108
-173.249.56.241
  173.249.58.30
  173.249.59.148
  173.249.60.159
@@ -55053,7 +51460,6 @@
  173.249.8.112
  173.249.9.243
  173.249.9.82
-173.25.105.59
  173.252.18.240
  173.252.25.66
  173.254.192.180
@@ -55079,7 +51485,6 @@
  173.255.193.235
  173.255.194.65
  173.255.197.68
-173.255.199.69
  173.255.204.124
  173.255.209.39
  173.255.210.152
@@ -55104,7 +51509,6 @@
  173.28.15.98
  173.29.92.163
  173.30.96.81
-173.31.204.211
  173.32.68.145
  173.33.65.93
  173.35.147.204
@@ -55115,20 +51519,21 @@
  173.44.152.131
  173.44.152.19
  173.44.152.215
-173.44.153.94
+173.44.153.244
+173.44.155.43
  173.44.155.50
+173.44.155.88
  173.44.164.147
  173.44.164.167
-173.44.164.172
  173.44.164.173
  173.44.164.176
  173.44.164.181
-173.44.164.221
  173.44.164.225
  173.44.164.25
  173.44.165.133
  173.44.165.151
  173.44.165.155
+173.44.165.158
  173.44.165.234
  173.44.165.46
  173.44.166.108
@@ -55138,7 +51543,8 @@
  173.44.166.82
  173.44.171.98
  173.44.188.131
-173.44.188.134
+173.44.188.132
+173.44.188.133
  173.44.188.135
  173.44.188.136
  173.44.188.137
@@ -55153,6 +51559,7 @@
  173.44.188.147
  173.44.188.148
  173.44.188.149
+173.44.188.150
  173.44.188.151
  173.44.188.152
  173.44.188.153
@@ -55178,16 +51585,15 @@
  173.46.151.30
  173.46.67.172
  173.47.10.140
-173.47.143.80
  173.48.155.130
  173.49.133.128
  173.49.86.3
  173.51.177.2
-173.52.122.181
  173.52.38.127
-173.53.23.48
  173.56.116.111
  173.56.121.34
+173.56.219.169
+173.56.238.65
  173.56.92.166
  173.59.224.21
  173.61.88.14
@@ -55195,12 +51601,12 @@
  173.62.236.28
  173.62.253.103
  173.63.104.87
+173.63.222.65
  173.63.55.123
  173.63.6.217
+173.63.97.174
  173.64.72.247
  173.67.202.245
-173.67.48.130
-173.68.16.3
  173.68.173.104
  173.68.185.170
  173.68.20.72
@@ -55220,6 +51626,7 @@
  173.77.7.84
  173.78.219.97
  173.79.107.81
+173.79.186.61
  173.79.252.210
  173.79.59.86
  173.8.134.217
@@ -55229,6 +51636,7 @@
  173.81.219.52
  173.82.105.129
  173.82.119.161
+173.82.120.36
  173.82.123.229
  173.82.123.232
  173.82.123.243
@@ -55257,7 +51665,6 @@
  173.82.22.82
  173.82.22.86
  173.82.22.89
-173.82.227.100
  173.82.243.98
  173.82.255.36
  173.82.6.226
@@ -55272,7 +51679,6 @@
  173.82.97.232
  173.82.97.235
  173.82.97.243
-173.82.97.247
  173.88.88.55
  173.89.28.137
  173.9.134.145
@@ -55287,7 +51693,6 @@
  174-365.net
  174.0.187.106
  174.0.252.47
-174.0.79.91
  174.0.84.93
  174.1.55.251
  174.1.69.54
@@ -55295,12 +51700,10 @@
  174.100.209.2
  174.100.27.229
  174.102.48.180
-174.103.123.187
  174.105.149.112
  174.106.122.139
  174.106.163.226
  174.106.30.155
-174.107.117.81
  174.110.88.87
  174.111.19.140
  174.112.205.57
@@ -55330,12 +51733,12 @@
  174.125.3.152
  174.125.33.241
  174.125.4.14
+174.126.224.165
  174.127.155.118
  174.127.68.49
  174.127.99.132
  174.128.224.88
  174.128.226.101
-174.128.233.34
  174.128.235.243
  174.128.245.209
  174.129.10.127
@@ -55349,14 +51752,13 @@
  174.129.42.83
  174.129.58.165
  174.129.61.92
-174.130.50.208
  174.133.148.98
  174.133.201.194
  174.133.236.202
  174.133.29.34
  174.133.7.18
  174.133.81.90
-174.135.156.170
+174.134.34.52
  174.136.12.162
  174.136.24.107
  174.136.25.182
@@ -55374,8 +51776,7 @@
  174.138.10.156
  174.138.116.11
  174.138.14.107
-174.138.16.52
-174.138.18.157
+174.138.18.218
  174.138.181.221
  174.138.190.233
  174.138.2.114
@@ -55392,7 +51793,6 @@
  174.138.33.122
  174.138.33.202
  174.138.33.78
-174.138.34.155
  174.138.34.236
  174.138.35.201
  174.138.35.229
@@ -55410,7 +51810,6 @@
  174.138.46.137
  174.138.47.227
  174.138.47.35
-174.138.48.152
  174.138.48.84
  174.138.52.50
  174.138.55.13
@@ -55420,7 +51819,6 @@
  174.138.58.171
  174.138.58.23
  174.138.58.231
-174.138.59.36
  174.138.61.227
  174.138.61.46
  174.138.64.163
@@ -55477,7 +51875,6 @@
  174.153.42.217
  174.17.65.204
  174.18.86.101
-174.19.125.5
  174.19.13.83
  174.192.78.183
  174.2.180.201
@@ -55485,13 +51882,13 @@
  174.21.82.196
  174.21.86.74
  174.22.112.148
-174.227.138.124
  174.27.70.18
+174.27.81.67
  174.3.14.10
  174.3.154.99
+174.3.204.109
  174.30.126.92
  174.30.96.209
-174.31.127.116
  174.34.135.242
  174.34.223.19
  174.36.149.83
@@ -55516,13 +51913,13 @@
  174.59.3.38
  174.59.9.9
  174.6.100.50
-174.61.48.90
-174.62.110.179
  174.63.161.36
  174.63.236.83
+174.63.28.58
  174.64.199.79
  174.64.199.82
  174.65.58.159
+174.67.239.42
  174.7.122.2
  174.7.236.255
  174.7.29.42
@@ -55557,25 +51954,27 @@
  174.77.209.96
  174.78.198.170
  174.79.125.130
+174.82.216.89
+174.82.225.114
  174.84.183.72
-174.85.37.147
  174.85.6.114
-174.86.112.184
  174.87.100.122
  174.88.159.10
  174.88.165.121
  174.89.181.56
  174.89.183.229
-174.89.183.25
  174.89.185.50
  174.89.58.31
  174.91.157.207
  174.91.5.72
+174.93.55.225
  174.93.57.46
  174.94.101.110
+174.94.123.165
  174.94.155.224
  174.95.178.64
  174.98.21.9
+174.98.28.164
  175-365.net
  175.0.105.230
  175.0.134.251
@@ -55589,13 +51988,11 @@
  175.10.144.174
  175.10.145.138
  175.10.15.139
-175.10.185.40
  175.10.206.179
-175.10.214.180
  175.10.25.210
+175.10.51.6
  175.10.75.44
  175.100.103.132
-175.100.103.170
  175.100.151.50
  175.100.16.20
  175.100.18.45
@@ -55630,9 +52027,7 @@
  175.107.185.3
  175.107.19.219
  175.107.196.29
-175.107.198.23
  175.107.201.182
-175.107.203.28
  175.107.206.134
  175.11.192.170
  175.11.192.189
@@ -55642,11 +52037,12 @@
  175.11.195.90
  175.11.64.169
  175.11.64.170
+175.11.69.89
  175.11.8.12
  175.11.94.110
+175.110.0.49
  175.110.107.2
  175.110.13.187
-175.110.5.162
  175.110.80.86
  175.111.119.42
  175.111.181.246
@@ -55656,18 +52052,15 @@
  175.111.54.77
  175.111.91.143
  175.112.247.61
-175.112.89.171
  175.113.229.2
  175.114.15.229
  175.114.85.154
-175.114.95.194
  175.115.224.95
  175.116.199.21
  175.116.222.106
  175.116.222.47
  175.117.144.37
  175.117.145.166
-175.117.27.202
  175.117.40.19
  175.118.126.20
  175.118.126.99
@@ -55687,6 +52080,7 @@
  175.125.94.166
  175.125.95.160
  175.126.103.196
+175.126.168.137
  175.126.176.21
  175.126.37.133
  175.126.62.28
@@ -55709,14 +52103,14 @@
  175.137.99.197
  175.138.108.78
  175.138.190.3
+175.138.195.235
+175.138.21.25
  175.138.233.116
  175.138.48.167
  175.138.70.145
+175.138.94.9
  175.138.99.100
-175.139.1.34
  175.139.161.92
-175.139.162.191
-175.139.162.47
  175.139.164.218
  175.139.166.200
  175.139.179.65
@@ -55725,17 +52119,14 @@
  175.139.226.120
  175.139.252.193
  175.139.253.230
-175.139.3.41
  175.139.92.177
  175.14.5.144
  175.14.7.241
  175.140.129.130
  175.140.138.193
  175.140.139.150
-175.140.143.151
  175.140.181.115
  175.140.189.159
-175.140.200.253
  175.140.217.55
  175.140.230.109
  175.140.249.116
@@ -55745,13 +52136,12 @@
  175.141.163.36
  175.141.168.226
  175.141.171.247
-175.141.173.210
+175.141.235.17
  175.141.53.229
  175.141.61.45
  175.141.63.74
  175.141.69.201
  175.142.186.5
-175.142.24.171
  175.143.115.179
  175.143.208.63
  175.143.228.210
@@ -55770,11 +52160,9 @@
  175.145.195.250
  175.145.209.109
  175.145.214.70
-175.145.232.73
-175.146.117.122
  175.146.19.126
  175.146.197.88
-175.146.227.114
+175.146.225.251
  175.146.231.115
  175.146.242.250
  175.146.242.252
@@ -55786,9 +52174,9 @@
  175.146.64.136
  175.147.0.241
  175.147.103.103
+175.147.119.3
  175.147.2.186
  175.147.21.193
-175.147.4.112
  175.147.55.243
  175.148.106.134
  175.148.11.223
@@ -55801,6 +52189,8 @@
  175.148.86.1
  175.149.115.133
  175.149.169.106
+175.149.181.125
+175.149.199.77
  175.149.245.4
  175.149.246.50
  175.149.248.96
@@ -55808,7 +52198,6 @@
  175.150.128.190
  175.150.128.216
  175.150.129.234
-175.150.251.223
  175.150.46.246
  175.150.60.128
  175.150.61.185
@@ -55818,8 +52207,6 @@
  175.151.108.73
  175.151.190.20
  175.151.191.180
-175.151.203.117
-175.151.78.251
  175.151.82.184
  175.151.86.177
  175.151.86.18
@@ -55837,22 +52224,18 @@
  175.153.251.88
  175.153.254.54
  175.155.61.122
-175.157.212.243
-175.157.37.186
-175.157.45.210
-175.157.50.218
+175.157.44.108
  175.158.156.76
  175.158.170.213
-175.158.180.129
  175.158.40.140
  175.158.40.97
  175.16.216.241
  175.16.22.241
+175.16.236.21
  175.16.5.93
  175.16.6.188
  175.16.69.19
  175.160.194.61
-175.160.200.204
  175.161.14.80
  175.161.171.142
  175.161.2.34
@@ -55860,16 +52243,13 @@
  175.161.245.21
  175.161.253.194
  175.161.29.105
-175.162.1.125
-175.162.11.41
  175.162.150.58
  175.162.197.87
  175.162.199.178
  175.162.200.209
  175.162.247.27
  175.163.45.186
-175.163.92.167
-175.164.151.11
+175.163.46.143
  175.164.215.75
  175.164.58.124
  175.165.14.233
@@ -55877,7 +52257,6 @@
  175.165.173.168
  175.165.225.101
  175.165.227.174
-175.165.230.36
  175.165.237.184
  175.165.75.108
  175.165.93.28
@@ -55898,15 +52277,17 @@
  175.168.20.226
  175.168.201.50
  175.168.231.207
+175.168.240.11
  175.168.254.234
  175.169.163.237
  175.169.167.29
  175.169.179.192
+175.169.182.192
  175.169.182.91
  175.169.185.214
  175.169.187.80
  175.169.189.8
-175.169.211.70
+175.169.75.72
  175.17.214.52
  175.17.7.50
  175.170.12.166
@@ -55914,27 +52295,26 @@
  175.170.14.6
  175.170.149.18
  175.170.15.239
+175.170.3.150
  175.170.40.253
-175.170.68.207
  175.170.74.7
  175.170.8.206
  175.171.118.113
  175.171.119.169
  175.171.120.144
  175.171.120.76
-175.171.147.75
  175.171.245.119
+175.171.247.83
  175.171.254.193
  175.171.28.103
-175.171.69.37
  175.172.174.191
-175.172.178.59
  175.172.187.95
  175.172.238.180
  175.172.239.59
  175.172.45.36
  175.172.57.108
  175.172.59.209
+175.172.84.100
  175.173.178.22
  175.173.227.103
  175.173.73.109
@@ -55955,7 +52335,10 @@
  175.176.32.13
  175.176.32.4
  175.176.33.242
-175.176.50.131
+175.176.48.14
+175.176.50.232
+175.176.84.171
+175.176.87.61
  175.18.152.199
  175.18.50.192
  175.18.94.12
@@ -55983,7 +52366,6 @@
  175.183.62.172
  175.183.64.148
  175.183.73.53
-175.183.80.5
  175.184.232.194
  175.184.232.196
  175.184.232.74
@@ -55998,10 +52380,8 @@
  175.192.12.27
  175.192.128.217
  175.192.179.80
-175.192.191.226
  175.192.20.2
  175.192.200.25
-175.192.5.43
  175.192.5.62
  175.192.64.99
  175.192.88.167
@@ -56012,7 +52392,9 @@
  175.193.21.32
  175.193.244.13
  175.193.47.144
+175.194.111.102
  175.194.111.96
+175.194.113.99
  175.194.118.36
  175.194.120.62
  175.194.153.5
@@ -56022,8 +52404,10 @@
  175.194.214.33
  175.194.50.11
  175.194.54.93
+175.194.86.99
  175.195.142.189
  175.195.178.86
+175.195.186.181
  175.195.207.100
  175.195.215.180
  175.195.33.102
@@ -56034,17 +52418,20 @@
  175.196.191.240
  175.196.191.70
  175.196.61.1
+175.196.69.174
  175.197.159.122
+175.197.217.35
  175.197.221.220
  175.197.233.197
-175.197.74.237
  175.198.184.224
  175.198.200.160
  175.198.211.109
  175.198.211.160
  175.198.211.226
  175.198.214.201
+175.198.227.215
  175.198.248.73
+175.198.48.252
  175.198.56.151
  175.198.65.114
  175.198.65.138
@@ -56062,20 +52449,19 @@
  175.199.242.142
  175.199.28.29
  175.20.161.43
-175.20.54.1
  175.20.55.191
  175.20.57.112
  175.20.57.41
  175.20.58.75
+175.20.59.40
  175.20.59.43
  175.20.60.75
  175.20.79.42
+175.200.144.186
  175.200.155.244
  175.200.3.32
  175.200.53.56
-175.200.56.121
  175.200.96.150
-175.201.126.198
  175.201.126.210
  175.201.126.39
  175.201.126.41
@@ -56096,12 +52482,14 @@
  175.202.151.89
  175.202.235.18
  175.202.238.231
+175.202.245.178
  175.202.33.134
  175.202.53.124
  175.203.174.203
  175.203.175.249
  175.203.195.10
  175.203.206.212
+175.203.220.171
  175.203.254.231
  175.203.57.172
  175.204.204.173
@@ -56119,12 +52507,16 @@
  175.205.221.32
  175.205.98.123
  175.206.109.101
+175.206.111.174
  175.206.130.123
  175.206.147.232
+175.206.169.221
  175.206.173.232
+175.206.178.15
  175.206.182.103
  175.206.183.177
  175.206.229.96
+175.206.234.98
  175.206.37.133
  175.206.37.192
  175.206.56.67
@@ -56149,6 +52541,7 @@
  175.208.6.229
  175.209.141.227
  175.209.179.142
+175.209.231.97
  175.209.47.237
  175.21.239.28
  175.21.79.118
@@ -56159,9 +52552,11 @@
  175.210.238.141
  175.211.139.197
  175.211.155.92
+175.211.192.94
  175.211.197.214
  175.211.202.131
  175.211.207.22
+175.211.207.23
  175.211.218.238
  175.211.248.7
  175.211.251.173
@@ -56181,10 +52576,11 @@
  175.212.225.71
  175.212.248.141
  175.212.248.59
+175.212.67.63
  175.212.89.108
  175.213.104.231
  175.213.120.39
-175.213.185.129
+175.213.168.136
  175.213.24.199
  175.213.94.18
  175.214.157.164
@@ -56197,13 +52593,15 @@
  175.214.240.212
  175.214.37.176
  175.214.57.165
-175.214.73.208
+175.214.59.103
+175.214.73.204
  175.215.114.134
  175.215.138.105
  175.215.202.131
  175.215.230.109
  175.215.5.27
  175.215.80.170
+175.215.80.190
  175.215.88.94
  175.215.89.172
  175.215.96.152
@@ -56211,7 +52609,6 @@
  175.22.14.243
  175.22.166.210
  175.22.216.108
-175.22.216.123
  175.22.223.8
  175.23.154.109
  175.23.201.104
@@ -56221,12 +52618,12 @@
  175.24.102.249
  175.24.103.60
  175.24.103.72
+175.24.105.133
  175.24.105.233
  175.24.106.253
  175.24.107.175
  175.24.107.201
  175.24.107.214
-175.24.107.68
  175.24.116.10
  175.24.116.33
  175.24.117.144
@@ -56248,48 +52645,39 @@
  175.24.131.200
  175.24.132.108
  175.24.132.209
-175.24.132.222
  175.24.133.232
-175.24.135.131
  175.24.135.90
  175.24.138.103
  175.24.138.30
  175.24.139.32
  175.24.139.70
-175.24.14.72
  175.24.147.134
  175.24.15.243
  175.24.152.120
  175.24.152.35
+175.24.153.160
  175.24.16.135
  175.24.16.61
  175.24.17.53
  175.24.18.134
-175.24.18.86
  175.24.186.132
  175.24.189.12
  175.24.190.130
  175.24.190.27
-175.24.23.31
  175.24.230.44
-175.24.24.250
-175.24.28.164
-175.24.33.99
  175.24.34.90
  175.24.36.114
  175.24.42.244
-175.24.44.70
  175.24.45.103
  175.24.45.137
  175.24.45.144
-175.24.46.107
  175.24.46.21
+175.24.49.208
  175.24.49.210
  175.24.49.95
-175.24.51.45
+175.24.54.16
  175.24.54.223
  175.24.57.24
-175.24.61.126
  175.24.62.199
  175.24.63.117
  175.24.66.23
@@ -56299,29 +52687,20 @@
  175.24.71.52
  175.24.72.167
  175.24.74.188
-175.24.77.111
-175.24.77.27
-175.24.78.205
  175.24.8.247
  175.24.81.123
-175.24.81.178
  175.24.81.207
  175.24.81.65
  175.24.84.160
-175.24.84.164
  175.24.84.198
  175.24.85.71
  175.24.88.227
  175.24.90.42
-175.24.91.63
  175.24.93.7
-175.24.94.167
  175.24.95.209
  175.24.95.240
  175.24.96.90
  175.24.97.164
-175.24.97.62
-175.24.98.39
  175.25.16.28
  175.28.14.2
  175.29.174.18
@@ -56344,6 +52723,7 @@
  175.37.92.189
  175.38.148.6
  175.41.218.218
+175.41.44.115
  175.41.44.26
  175.41.44.36
  175.41.44.43
@@ -56359,15 +52739,17 @@
  175.44.158.139
  175.44.182.14
  175.44.33.175
+175.44.33.247
  175.44.33.42
+175.44.34.75
  175.44.35.176
  175.44.35.193
-175.45.10.101
  175.45.180.254
  175.45.187.182
  175.45.187.30
-175.5.172.50
  175.5.195.31
+175.5.21.246
+175.5.34.135
  175.5.38.41
  175.6.0.190
  175.6.1.177
@@ -56376,7 +52758,6 @@
  175.6.108.213
  175.6.130.39
  175.6.135.122
-175.6.146.174
  175.6.146.207
  175.6.148.219
  175.6.21.77
@@ -56389,11 +52770,9 @@
  175.6.32.134
  175.6.35.166
  175.6.35.197
-175.6.35.202
  175.6.35.207
  175.6.35.228
  175.6.35.46
-175.6.35.52
  175.6.35.82
  175.6.35.93
  175.6.40.19
@@ -56403,8 +52782,8 @@
  175.6.7.20
  175.6.70.180
  175.6.73.4
+175.6.76.71
  175.6.77.131
-175.6.99.102
  175.8.140.92
  175.8.142.21
  175.8.41.237
@@ -56415,8 +52794,6 @@
  175.9.222.2
  175.9.31.85
  175.97.136.186
-175.97.137.10
-175.98.112.29
  175.98.46.88
  1758681625.rsc.cdn77.org
  176.10.104.240
@@ -56453,6 +52830,7 @@
  176.101.221.119
  176.101.80.215
  176.101.89.226
+176.102.130.103
  176.102.193.16
  176.102.196.162
  176.102.224.53
@@ -56469,11 +52847,12 @@
  176.103.54.73
  176.103.55.73
  176.103.74.89
+176.103.91.40
  176.103.99.155
  176.104.11.77
-176.104.16.58
  176.104.176.218
  176.104.184.187
+176.104.192.77
  176.104.25.140
  176.104.39.126
  176.104.52.46
@@ -56487,11 +52866,8 @@
  176.106.191.2
  176.106.26.85
  176.106.41.214
-176.106.66.198
  176.106.84.1
  176.106.9.181
-176.107.131.9
-176.107.133.228
  176.107.176.111
  176.107.176.164
  176.107.176.178
@@ -56524,17 +52900,15 @@
  176.107.187.236
  176.107.191.199
  176.107.241.195
-176.107.242.43
  176.108.104.84
  176.108.106.15
  176.108.106.25
-176.108.250.151
  176.108.65.192
  176.109.0.30
  176.109.0.5
-176.109.160.232
  176.109.222.63
  176.109.233.132
+176.109.240.156
  176.109.251.247
  176.109.47.185
  176.110.121.90
@@ -56591,7 +52965,6 @@
  176.113.161.57
  176.113.161.59
  176.113.161.60
-176.113.161.62
  176.113.161.64
  176.113.161.65
  176.113.161.66
@@ -56612,12 +52985,12 @@
  176.113.161.95
  176.113.205.44
  176.113.209.13
-176.113.228.24
  176.113.251.7
  176.113.252.130
  176.113.252.134
  176.113.252.145
  176.113.252.173
+176.113.252.184
  176.113.252.186
  176.113.252.205
  176.113.32.96
@@ -56626,10 +52999,8 @@
  176.113.71.71
  176.113.72.133
  176.113.80.252
-176.113.83.46
  176.114.0.120
  176.114.0.74
-176.114.153.111
  176.114.153.6
  176.114.153.78
  176.114.199.56
@@ -56669,9 +53040,10 @@
  176.119.1.180
  176.119.109.177
  176.119.141.238
+176.119.141.63
  176.119.141.84
  176.119.156.8
-176.119.159.20
+176.119.158.41
  176.119.224.74
  176.119.29.70
  176.119.29.8
@@ -56687,10 +53059,7 @@
  176.121.224.97
  176.121.235.236
  176.121.81.51
-176.122.117.7
-176.122.123.102
  176.122.129.114
-176.122.132.168
  176.122.141.223
  176.122.146.45
  176.122.156.32
@@ -56713,6 +53082,8 @@
  176.123.128.248
  176.123.164.240
  176.123.2.196
+176.123.2.36
+176.123.20.92
  176.123.21.148
  176.123.22.241
  176.123.29.241
@@ -56751,9 +53122,10 @@
  176.123.9.171
  176.123.9.32
  176.124.116.142
+176.124.142.217
+176.124.188.13
  176.124.188.3
  176.125.38.129
-176.125.45.97
  176.125.54.246
  176.126.167.10
  176.126.175.182
@@ -56768,35 +53140,32 @@
  176.127.3.92
  176.127.60.12
  176.134.163.155
-176.134.64.65
  176.14.135.119
  176.14.137.126
  176.14.139.153
  176.14.153.168
  176.14.153.182
  176.14.156.48
-176.142.216.192
+176.14.238.192
  176.143.111.17
+176.144.65.173
  176.15.163.216
+176.15.198.59
  176.157.61.145
  176.158.56.29
  176.158.71.34
  176.159.144.162
-176.163.6.57
-176.165.48.246
  176.174.199.40
  176.175.1.113
  176.181.56.34
-176.186.77.215
  176.191.182.3
  176.192.182.15
+176.192.252.133
  176.192.66.254
  176.192.8.206
  176.193.71.50
  176.193.74.103
-176.194.140.85
  176.194.35.226
-176.194.47.86
  176.196.240.34
  176.196.84.138
  176.197.100.134
@@ -56815,14 +53184,13 @@
  176.20.174.12
  176.20.181.128
  176.20.198.78
-176.20.247.161
  176.202.169.139
  176.202.40.61
  176.202.93.78
  176.202.95.217
  176.206.133.185
  176.206.136.225
-176.207.13.132
+176.210.140.139
  176.210.99.14
  176.212.100.0
  176.212.100.10
@@ -56844,34 +53212,26 @@
  176.212.104.109
  176.212.104.11
  176.212.104.111
-176.212.104.116
-176.212.104.118
  176.212.104.119
  176.212.104.126
  176.212.104.129
  176.212.104.137
-176.212.104.138
  176.212.104.140
  176.212.104.144
  176.212.104.146
  176.212.104.15
-176.212.104.150
  176.212.104.151
-176.212.104.156
  176.212.104.158
-176.212.104.159
  176.212.104.16
  176.212.104.160
  176.212.104.162
  176.212.104.163
-176.212.104.166
  176.212.104.17
  176.212.104.172
  176.212.104.173
  176.212.104.175
  176.212.104.176
  176.212.104.183
-176.212.104.186
  176.212.104.187
  176.212.104.188
  176.212.104.192
@@ -56880,9 +53240,7 @@
  176.212.104.197
  176.212.104.198
  176.212.104.20
-176.212.104.202
  176.212.104.203
-176.212.104.209
  176.212.104.213
  176.212.104.216
  176.212.104.218
@@ -56905,7 +53263,6 @@
  176.212.104.27
  176.212.104.28
  176.212.104.3
-176.212.104.30
  176.212.104.32
  176.212.104.36
  176.212.104.37
@@ -56913,7 +53270,6 @@
  176.212.104.47
  176.212.104.5
  176.212.104.50
-176.212.104.51
  176.212.104.53
  176.212.104.54
  176.212.104.55
@@ -56924,7 +53280,6 @@
  176.212.104.65
  176.212.104.70
  176.212.104.72
-176.212.104.74
  176.212.104.77
  176.212.104.79
  176.212.104.8
@@ -56934,17 +53289,13 @@
  176.212.104.86
  176.212.104.87
  176.212.104.91
-176.212.104.94
  176.212.108.0
-176.212.108.107
  176.212.108.110
  176.212.108.113
-176.212.108.114
  176.212.108.118
  176.212.108.12
  176.212.108.121
  176.212.108.122
-176.212.108.123
  176.212.108.125
  176.212.108.126
  176.212.108.128
@@ -56977,12 +53328,10 @@
  176.212.108.20
  176.212.108.200
  176.212.108.202
-176.212.108.203
  176.212.108.206
  176.212.108.211
  176.212.108.213
  176.212.108.222
-176.212.108.230
  176.212.108.231
  176.212.108.234
  176.212.108.235
@@ -56990,8 +53339,6 @@
  176.212.108.240
  176.212.108.243
  176.212.108.249
-176.212.108.250
-176.212.108.254
  176.212.108.29
  176.212.108.30
  176.212.108.4
@@ -57011,8 +53358,7 @@
  176.212.108.76
  176.212.108.80
  176.212.108.95
-176.212.112.77
-176.212.183.133
+176.212.179.176
  176.212.185.153
  176.212.190.93
  176.212.191.153
@@ -57024,7 +53370,6 @@
  176.212.96.2
  176.212.96.20
  176.212.96.24
-176.212.96.3
  176.212.96.33
  176.212.96.36
  176.212.96.4
@@ -57033,7 +53378,6 @@
  176.212.96.5
  176.212.96.52
  176.212.96.53
-176.212.96.54
  176.212.96.60
  176.212.96.62
  176.212.96.7
@@ -57176,11 +53520,13 @@
  176.221.104.2
  176.221.116.10
  176.221.121.154
+176.221.136.117
  176.221.188.104
  176.221.188.14
  176.221.188.168
  176.221.188.175
  176.221.188.195
+176.221.188.251
  176.221.188.29
  176.221.188.63
  176.221.206.115
@@ -57217,7 +53563,6 @@
  176.223.60.10
  176.226.167.141
  176.226.184.88
-176.226.203.142
  176.226.224.47
  176.226.229.208
  176.227.188.16
@@ -57268,14 +53613,12 @@
  176.241.128.219
  176.241.141.167
  176.241.186.194
-176.241.8.217
  176.241.88.170
  176.241.89.170
  176.241.90.164
  176.241.92.38
  176.241.94.146
  176.241.94.228
-176.243.14.224
  176.249.102.104
  176.25.170.134
  176.25.18.22
@@ -57288,13 +53631,11 @@
  176.254.90.73
  176.26.189.40
  176.28.116.58
-176.28.126.135
  176.30.212.184
  176.30.212.190
  176.30.212.193
  176.31.102.37
  176.31.105.112
-176.31.105.136
  176.31.107.25
  176.31.110.229
  176.31.117.184
@@ -57310,13 +53651,11 @@
  176.31.156.47
  176.31.162.82
  176.31.163.192
-176.31.163.248
  176.31.165.144
  176.31.17.187
  176.31.18.148
  176.31.182.125
  176.31.182.79
-176.31.191.173
  176.31.193.24
  176.31.200.125
  176.31.200.130
@@ -57331,10 +53670,7 @@
  176.31.24.91
  176.31.240.198
  176.31.242.225
-176.31.248.166
  176.31.249.167
-176.31.250.160
-176.31.251.177
  176.31.252.148
  176.31.253.121
  176.31.253.13
@@ -57353,8 +53689,7 @@
  176.31.90.220
  176.32.150.66
  176.32.177.30
-176.32.195.69
-176.32.33.158
+176.32.32.50
  176.32.33.174
  176.34.121.38
  176.34.148.66
@@ -57366,8 +53701,9 @@
  176.35.212.240
  176.35.217.245
  176.35.242.118
+176.36.109.96
  176.36.17.63
-176.36.192.193
+176.36.20.11
  176.36.20.67
  176.36.37.21
  176.36.74.209
@@ -57375,6 +53711,7 @@
  176.36.92.188
  176.37.105.29
  176.37.113.61
+176.37.172.87
  176.37.211.10
  176.37.214.177
  176.37.248.76
@@ -57388,17 +53725,15 @@
  176.40.121.204
  176.40.124.52
  176.40.167.253
-176.40.253.74
  176.40.48.61
  176.41.145.57
  176.41.147.177
  176.42.114.128
  176.44.76.124
  176.46.123.40
-176.48.117.28
  176.48.20.69
+176.49.7.16
  176.51.100.190
-176.51.107.194
  176.51.31.145
  176.52.200.130
  176.52.219.6
@@ -57409,8 +53744,9 @@
  176.53.90.26
  176.56.107.132
  176.56.107.145
+176.56.107.146
+176.56.107.171
  176.56.107.185
-176.56.107.195
  176.56.107.198
  176.56.107.203
  176.56.107.210
@@ -57418,21 +53754,20 @@
  176.56.107.233
  176.56.107.240
  176.56.107.248
-176.56.107.250
+176.56.107.252
+176.56.107.71
  176.56.182.71
  176.56.225.110
  176.56.225.111
  176.56.236.158
  176.56.236.76
  176.56.237.165
-176.56.237.176
  176.56.61.4
  176.56.91.145
  176.57.128.87
  176.57.71.45
  176.57.71.47
  176.57.74.18
-176.57.76.80
  176.58.100.98
  176.58.101.249
  176.58.107.100
@@ -57462,16 +53797,14 @@
  176.61.140.225
  176.61.233.67
  176.61.60.76
-176.62.178.247
  176.62.182.26
+176.62.182.29
  176.62.182.30
  176.62.185.72
+176.62.187.75
  176.62.188.138
  176.62.85.42
-176.63.145.245
  176.63.23.105
-176.63.250.251
-176.63.30.148
  176.63.56.31
  176.63.82.33
  176.67.16.108
@@ -57492,27 +53825,25 @@
  176.67.86.37
  176.67.86.49
  176.67.86.50
-176.67.86.62
  176.74.113.52
  176.74.13.170
  176.74.136.237
  176.74.218.175
+176.74.222.189
  176.74.91.41
  176.74.95.3
-176.78.117.60
  176.78.29.155
  176.78.53.49
  176.79.187.133
-176.79.81.72
+176.79.20.194
+176.79.93.220
  176.8.90.171
-176.84.28.50
  176.85.213.251
  176.85.220.153
  176.85.239.196
  176.86.165.85
  176.88.201.210
  176.88.224.211
-176.88.97.59
  176.9.10.227
  176.9.101.91
  176.9.104.149
@@ -57544,7 +53875,6 @@
  176.9.42.253
  176.9.47.132
  176.9.47.5
-176.9.49.204
  176.9.51.122
  176.9.52.190
  176.9.57.185
@@ -57576,20 +53906,21 @@
  176.93.33.191
  176.93.35.248
  176.93.44.77
+176.93.64.108
  176.93.81.179
  176.93.81.197
  176.93.82.140
  176.93.93.52
-176.94.20.213
-176.94.56.162
-176.95.138.32
  176.95.184.111
+176.96.174.231
  176.96.238.149
  176.96.241.1
  176.96.241.253
  176.96.70.151
  176.97.226.28
  176.97.247.9
+176.97.251.202
+176.97.254.108
  176.98.156.64
  176.98.156.76
  176.98.16.205
@@ -57605,10 +53936,11 @@
  176.99.10.21
  176.99.147.167
  176.99.147.238
+176.99.160.19
  176.99.174.213
-176.99.182.215
+176.99.181.78
  176.99.2.207
-176.99.227.46
+176.99.200.254
  176.99.5.150
  176310687075500-dot-wetransfer-auth-file-343.appspot.com
  17678457-dot-sydneyma.appspot.com
@@ -57621,7 +53953,6 @@
  177.1.202.137
  177.1.213.19
  177.1.214.207
-177.1.214.84
  177.1.26.130
  177.10.116.114
  177.10.116.72
@@ -57639,21 +53970,15 @@
  177.10.211.198
  177.10.212.166
  177.10.231.97
-177.10.240.103
-177.10.240.104
-177.10.240.114
  177.10.240.120
-177.10.240.245
-177.10.241.111
+177.10.240.249
+177.10.241.109
  177.10.84.121
  177.100.130.96
  177.100.9.200
  177.101.0.252
-177.101.124.34
  177.101.125.251
  177.101.172.14
-177.101.181.78
-177.101.182.100
  177.101.186.138
  177.102.19.240
  177.103.152.191
@@ -57664,9 +53989,9 @@
  177.103.161.56
  177.103.164.56
  177.103.182.12
-177.103.187.233
  177.103.187.42
  177.103.197.216
+177.103.202.52
  177.103.223.147
  177.103.240.93
  177.104.115.16
@@ -57696,16 +54021,13 @@
  177.107.125.142
  177.107.134.94
  177.107.235.38
-177.107.35.26
  177.107.50.18
  177.107.53.76
-177.107.68.26
  177.107.79.214
  177.107.87.11
-177.11.156.212
+177.11.136.76
  177.11.156.246
  177.11.167.49
-177.11.167.93
  177.11.184.18
  177.11.185.73
  177.11.185.75
@@ -57717,6 +54039,8 @@
  177.11.36.143
  177.11.42.114
  177.11.65.126
+177.11.71.40
+177.11.71.78
  177.11.75.18
  177.11.85.77
  177.11.85.9
@@ -57725,6 +54049,7 @@
  177.12.227.131
  177.12.239.130
  177.12.30.140
+177.12.57.204
  177.12.80.246
  177.124.10.53
  177.124.101.103
@@ -57741,11 +54066,10 @@
  177.125.163.114
  177.125.163.170
  177.125.163.65
-177.125.164.225
-177.125.165.186
  177.125.166.200
  177.125.192.234
  177.125.20.35
+177.125.204.136
  177.125.204.32
  177.125.205.235
  177.125.205.44
@@ -57760,7 +54084,6 @@
  177.125.90.226
  177.126.0.115
  177.126.123.82
-177.126.130.112
  177.126.154.102
  177.126.154.93
  177.126.209.133
@@ -57769,8 +54092,6 @@
  177.126.220.136
  177.126.220.237
  177.126.220.58
-177.126.224.107
-177.126.224.24
  177.126.238.200
  177.126.238.213
  177.126.78.10
@@ -57779,7 +54100,6 @@
  177.126.85.189
  177.126.89.59
  177.126.93.170
-177.128.104.207
  177.128.121.254
  177.128.124.100
  177.128.134.252
@@ -57789,22 +54109,19 @@
  177.128.205.98
  177.128.209.58
  177.128.212.30
-177.128.216.5
  177.128.232.30
-177.128.34.79
+177.128.26.204
  177.128.35.51
  177.128.44.22
  177.128.63.184
  177.129.139.134
  177.129.17.170
  177.129.17.52
-177.129.191.142
  177.129.202.92
  177.129.202.97
-177.129.206.110
  177.129.206.124
-177.129.206.169
  177.129.206.76
+177.129.206.96
  177.129.207.23
  177.129.24.194
  177.129.250.217
@@ -57814,16 +54131,13 @@
  177.129.8.18
  177.129.80.110
  177.129.90.94
-177.13.125.12
  177.13.126.172
-177.13.127.138
  177.130.110.87
  177.130.140.227
  177.130.141.154
  177.130.141.181
  177.130.156.37
  177.130.189.116
-177.130.25.76
  177.130.51.198
  177.130.60.243
  177.130.95.154
@@ -57832,7 +54146,6 @@
  177.131.136.130
  177.131.22.186
  177.131.51.52
-177.131.6.15
  177.132.67.182
  177.132.71.197
  177.132.84.51
@@ -57842,11 +54155,8 @@
  177.134.166.10
  177.134.239.16
  177.135.101.101
-177.135.101.5
-177.135.103.54
  177.135.177.18
  177.135.236.126
-177.135.250.32
  177.135.93.227
  177.136.121.145
  177.136.129.2
@@ -57854,12 +54164,10 @@
  177.136.159.1
  177.136.185.200
  177.136.209.174
-177.136.209.98
  177.136.210.114
  177.136.227.157
  177.136.252.7
  177.136.32.70
-177.136.39.254
  177.136.39.8
  177.136.40.150
  177.136.68.181
@@ -57871,6 +54179,7 @@
  177.137.151.249
  177.137.160.233
  177.137.160.235
+177.137.163.61
  177.137.163.63
  177.137.163.73
  177.137.163.77
@@ -57889,17 +54198,13 @@
  177.137.168.155
  177.137.168.158
  177.137.170.161
-177.137.205.49
-177.137.207.51
  177.137.212.41
  177.137.222.70
  177.137.227.14
  177.137.231.131
  177.137.233.62
-177.137.40.86
  177.137.80.145
  177.137.96.14
-177.137.96.15
  177.137.96.2
  177.138.254.162
  177.139.129.17
@@ -57912,7 +54217,6 @@
  177.139.176.242
  177.139.194.62
  177.139.205.107
-177.139.205.69
  177.139.218.249
  177.139.224.55
  177.140.196.172
@@ -57923,17 +54227,15 @@
  177.142.200.65
  177.142.65.223
  177.142.82.142
+177.142.83.9
  177.143.14.234
  177.143.194.63
  177.144.130.105
  177.144.131.226
-177.144.133.82
  177.144.135.2
  177.144.141.144
-177.147.35.97
  177.147.50.73
  177.149.216.89
-177.149.223.198
  177.152.124.19
  177.152.124.20
  177.152.124.21
@@ -57949,24 +54251,19 @@
  177.154.226.11
  177.154.226.169
  177.154.226.239
-177.154.227.105
  177.154.230.123
  177.154.230.58
-177.154.235.219
+177.154.234.110
+177.154.235.205
  177.154.236.187
  177.154.236.226
-177.154.236.29
  177.154.237.115
-177.154.238.119
  177.154.238.171
  177.154.238.235
-177.154.238.84
  177.154.239.217
  177.154.239.31
  177.154.239.89
  177.154.37.222
-177.154.38.18
-177.154.39.233
  177.154.43.153
  177.154.49.130
  177.154.49.132
@@ -57976,7 +54273,6 @@
  177.154.52.34
  177.154.55.114
  177.154.72.58
-177.154.8.179
  177.155.134.68
  177.155.180.2
  177.155.185.214
@@ -57990,22 +54286,20 @@
  177.156.230.130
  177.157.103.203
  177.157.114.139
+177.157.158.96
  177.158.13.126
-177.158.217.165
  177.158.221.214
  177.158.5.11
  177.159.120.182
-177.159.146.68
  177.159.198.38
-177.159.25.118
  177.16.169.150
-177.160.200.156
  177.161.230.105
  177.162.9.237
  177.17.117.138
  177.17.121.0
  177.17.130.147
  177.17.174.203
+177.17.212.230
  177.17.22.12
  177.170.20.252
  177.170.251.79
@@ -58013,34 +54307,25 @@
  177.170.30.217
  177.170.50.40
  177.170.88.146
-177.175.198.98
-177.175.236.137
-177.175.253.78
  177.18.198.168
  177.18.47.21
  177.18.49.236
  177.18.49.74
-177.18.68.23
  177.180.234.237
  177.181.165.129
  177.181.178.37
  177.182.26.43
  177.182.40.23
-177.183.47.20
  177.184.101.158
  177.184.116.45
  177.184.137.165
  177.184.139.81
  177.184.140.222
-177.184.147.143
-177.184.178.54
  177.184.191.22
-177.184.191.30
  177.184.192.50
  177.184.207.125
  177.184.218.129
  177.184.240.15
-177.184.241.117
  177.184.246.244
  177.184.44.17
  177.184.44.231
@@ -58066,14 +54351,12 @@
  177.185.93.103
  177.188.121.26
  177.188.160.67
-177.189.209.143
  177.189.228.188
  177.189.241.61
-177.189.244.193
  177.189.43.167
  177.19.129.196
+177.19.164.149
  177.19.165.26
-177.19.176.234
  177.19.187.79
  177.19.238.230
  177.19.245.221
@@ -58090,21 +54373,16 @@
  177.190.74.41
  177.190.78.47
  177.190.83.126
-177.191.160.159
-177.191.160.186
  177.191.164.120
  177.191.167.152
  177.191.168.115
  177.191.168.17
  177.191.168.211
-177.191.168.243
  177.191.169.30
-177.191.176.109
  177.191.176.176
+177.191.179.30
  177.191.253.4
  177.192.144.249
-177.193.220.41
-177.193.88.63
  177.194.65.21
  177.195.154.42
  177.195.18.99
@@ -58113,7 +54391,6 @@
  177.20.213.173
  177.200.16.10
  177.200.189.205
-177.200.207.11
  177.200.243.50
  177.200.247.235
  177.200.35.217
@@ -58121,6 +54398,7 @@
  177.200.35.230
  177.200.35.237
  177.200.35.24
+177.200.35.242
  177.200.35.244
  177.200.35.247
  177.200.35.26
@@ -58130,13 +54408,13 @@
  177.200.64.116
  177.200.65.255
  177.200.72.214
+177.200.76.97
  177.200.89.62
  177.200.90.94
  177.200.94.150
  177.201.211.167
  177.202.108.18
  177.202.118.44
-177.203.169.17
  177.203.53.85
  177.204.128.91
  177.204.159.49
@@ -58156,26 +54434,20 @@
  177.207.192.137
  177.207.204.230
  177.207.216.148
-177.207.251.18
  177.207.58.211
  177.208.190.74
-177.21.11.98
  177.21.120.102
  177.21.121.10
  177.21.19.87
-177.21.193.200
  177.21.195.101
  177.21.195.121
+177.21.195.97
  177.21.199.6
-177.21.213.152
-177.21.213.57
-177.21.213.65
-177.21.213.74
+177.21.213.61
  177.21.30.36
-177.21.33.193
  177.21.36.73
  177.21.37.106
-177.21.56.149
+177.21.57.128
  177.21.96.222
  177.22.119.155
  177.22.124.170
@@ -58200,8 +54472,6 @@
  177.220.173.136
  177.220.174.41
  177.220.175.70
-177.220.178.190
-177.220.178.192
  177.220.178.231
  177.220.188.143
  177.220.188.213
@@ -58212,6 +54482,7 @@
  177.220.206.138
  177.220.226.122
  177.221.108.100
+177.221.108.139
  177.221.176.66
  177.221.176.77
  177.221.34.141
@@ -58221,6 +54492,7 @@
  177.222.46.83
  177.223.16.58
  177.223.226.223
+177.223.226.29
  177.223.48.126
  177.223.50.130
  177.223.58.68
@@ -58228,15 +54500,13 @@
  177.223.63.26
  177.223.65.201
  177.223.81.210
-177.224.35.86
  177.224.90.29
  177.226.114.134
-177.226.182.49
  177.226.25.78
  177.227.24.156
  177.227.44.127
  177.227.44.71
-177.228.86.1
+177.228.76.137
  177.23.138.92
  177.23.149.18
  177.23.150.218
@@ -58245,7 +54515,7 @@
  177.23.184.166
  177.23.184.99
  177.23.191.244
-177.23.58.40
+177.23.227.136
  177.23.7.151
  177.230.20.38
  177.231.242.116
@@ -58253,34 +54523,31 @@
  177.231.255.110
  177.231.63.31
  177.231.84.126
+177.232.88.176
  177.234.154.77
  177.234.166.226
  177.235.19.251
-177.236.44.199
-177.236.81.131
  177.238.248.101
  177.238.249.14
  177.239.160.121
  177.239.51.129
+177.24.120.145
  177.240.102.153
-177.240.107.34
  177.240.174.84
  177.240.187.74
  177.240.204.200
  177.240.206.74
-177.241.103.68
  177.241.245.226
  177.241.248.22
  177.242.234.192
-177.242.46.46
  177.242.49.94
  177.244.220.235
  177.244.36.134
+177.245.193.129
  177.247.70.91
+177.25.151.8
+177.25.154.44
  177.27.212.168
-177.27.246.175
-177.3.253.61
-177.30.47.9
  177.30.73.64
  177.32.1.89
  177.32.112.120
@@ -58302,7 +54569,6 @@
  177.36.159.34
  177.36.246.159
  177.36.248.221
-177.36.33.175
  177.36.37.116
  177.36.37.241
  177.36.89.10
@@ -58310,7 +54576,6 @@
  177.37.162.57
  177.37.164.125
  177.37.165.88
-177.37.173.93
  177.37.175.3
  177.37.176.210
  177.37.240.52
@@ -58326,48 +54591,40 @@
  177.38.215.73
  177.38.22.209
  177.38.232.40
-177.38.235.106
  177.38.243.90
  177.38.253.121
  177.38.35.66
  177.38.39.130
  177.38.69.111
  177.38.76.5
-177.39.140.157
  177.39.155.220
  177.39.187.70
  177.39.191.94
  177.39.219.186
  177.39.222.185
-177.39.66.170
  177.39.84.100
  177.39.84.104
  177.4.121.4
-177.4.74.110
  177.40.108.254
  177.41.53.23
  177.41.62.200
  177.42.118.254
  177.42.46.150
  177.42.71.208
-177.43.132.169
  177.43.213.240
  177.43.249.42
+177.43.251.153
  177.43.63.62
  177.43.83.122
  177.43.92.98
-177.43.94.106
-177.43.94.109
  177.44.16.108
-177.44.16.203
-177.44.16.248
+177.44.16.215
  177.44.161.5
  177.44.17.0
-177.44.17.102
  177.44.17.16
+177.44.17.240
  177.44.17.244
  177.44.17.48
-177.44.17.8
  177.44.18.114
  177.44.18.124
  177.44.18.96
@@ -58378,7 +54635,6 @@
  177.44.82.232
  177.44.88.168
  177.45.201.178
-177.45.98.32
  177.46.111.243
  177.46.141.143
  177.46.147.89
@@ -58392,23 +54648,21 @@
  177.47.27.234
  177.47.39.9
  177.52.173.62
-177.52.24.4
-177.52.249.220
  177.52.25.8
  177.52.255.235
  177.52.26.194
-177.52.26.220
  177.52.26.234
  177.52.48.225
  177.52.54.72
+177.52.74.22
  177.52.74.79
-177.53.1.113
  177.53.105.88
  177.53.109.94
-177.53.110.112
+177.53.111.137
  177.53.118.95
  177.53.152.36
-177.53.56.71
+177.53.164.121
+177.53.165.54
  177.53.68.59
  177.53.7.211
  177.53.7.234
@@ -58422,7 +54676,6 @@
  177.54.111.181
  177.54.111.215
  177.54.133.170
-177.54.142.230
  177.54.150.171
  177.54.152.211
  177.54.152.38
@@ -58433,7 +54686,6 @@
  177.54.224.203
  177.54.224.222
  177.54.224.245
-177.54.251.204
  177.54.38.86
  177.54.41.185
  177.54.97.139
@@ -58441,8 +54693,6 @@
  177.55.143.141
  177.55.157.11
  177.55.237.52
-177.55.51.103
-177.56.130.55
  177.56.26.255
  177.57.168.220
  177.57.8.141
@@ -58457,13 +54707,13 @@
  177.66.195.114
  177.66.195.116
  177.66.195.118
-177.66.208.247
  177.66.221.5
-177.66.244.115
  177.66.247.233
  177.66.247.81
  177.66.255.55
+177.66.3.200
  177.66.30.141
+177.66.5.110
  177.66.66.197
  177.66.73.74
  177.66.73.84
@@ -58473,13 +54723,15 @@
  177.67.14.62
  177.67.158.94
  177.67.162.42
-177.67.165.208
+177.67.165.225
+177.67.165.65
  177.67.168.4
  177.67.176.173
  177.67.180.160
  177.67.203.135
  177.67.217.30
  177.67.219.1
+177.67.241.127
  177.67.245.197
  177.67.5.142
  177.67.8.200
@@ -58488,26 +54740,19 @@
  177.67.8.80
  177.67.84.204
  177.67.9.140
-177.67.9.216
-177.67.9.49
-177.68.102.56
  177.68.143.100
-177.68.156.101
-177.68.156.24
  177.68.255.48
  177.68.74.97
-177.69.118.197
  177.69.124.245
-177.69.130.195
  177.69.158.130
  177.69.158.132
  177.69.178.158
  177.69.19.49
  177.69.203.7
  177.69.23.177
-177.69.237.49
  177.69.238.9
  177.69.45.188
+177.69.46.129
  177.7.17.230
  177.7.84.189
  177.70.106.51
@@ -58521,13 +54766,11 @@
  177.72.113.193
  177.72.113.246
  177.72.13.80
-177.72.169.236
  177.72.185.94
  177.72.21.98
  177.72.6.18
  177.72.6.195
  177.72.65.2
-177.72.69.245
  177.72.72.217
  177.72.82.47
  177.72.82.8
@@ -58546,19 +54789,19 @@
  177.73.248.38
  177.73.248.6
  177.73.25.126
+177.73.25.180
  177.73.25.249
  177.73.250.160
  177.73.250.193
  177.73.250.253
-177.73.28.199
  177.73.3.206
  177.73.30.10
  177.73.4.96
-177.73.44.169
  177.73.47.110
  177.73.68.138
  177.73.8.230
  177.73.8.42
+177.73.83.195
  177.74.115.37
  177.74.117.158
  177.74.119.222
@@ -58569,16 +54812,8 @@
  177.74.182.17
  177.74.182.59
  177.74.2.10
-177.74.205.254
-177.74.232.124
  177.74.252.95
-177.74.254.122
-177.74.254.151
-177.74.254.156
-177.74.254.172
  177.74.63.197
-177.75.1.218
-177.75.1.94
  177.75.143.241
  177.75.15.162
  177.75.159.200
@@ -58594,25 +54829,25 @@
  177.76.162.243
  177.76.176.88
  177.76.190.227
+177.76.191.247
  177.76.197.14
  177.76.223.233
+177.76.224.179
  177.76.224.194
-177.78.156.50
+177.79.60.254
+177.79.65.108
  177.8.124.3
-177.8.154.13
-177.8.154.150
-177.8.154.193
-177.8.154.42
-177.8.155.86
+177.8.126.127
+177.8.154.18
  177.8.172.137
  177.8.174.110
  177.8.216.114
-177.8.244.38
+177.8.247.23
  177.8.55.155
  177.8.55.44
-177.8.56.109
  177.80.132.178
  177.80.132.232
+177.80.132.30
  177.80.133.16
  177.80.16.234
  177.80.208.127
@@ -58624,12 +54859,12 @@
  177.81.25.145
  177.81.34.69
  177.81.37.23
-177.81.41.160
  177.81.65.127
  177.82.131.199
  177.84.108.75
  177.84.109.10
  177.84.143.142
+177.84.144.151
  177.84.145.200
  177.84.146.16
  177.84.146.29
@@ -58642,12 +54877,13 @@
  177.84.174.202
  177.84.197.229
  177.84.209.192
+177.84.209.28
  177.84.209.48
  177.84.209.92
  177.84.210.47
+177.84.243.38
  177.84.35.6
  177.84.43.202
-177.84.77.115
  177.85.102.232
  177.85.112.230
  177.85.113.195
@@ -58656,10 +54892,10 @@
  177.85.116.78
  177.85.117.165
  177.85.121.36
-177.85.167.10
  177.85.189.225
  177.85.200.241
  177.85.200.45
+177.85.201.229
  177.85.203.110
  177.85.224.76
  177.85.226.136
@@ -58674,38 +54910,32 @@
  177.86.115.2
  177.86.115.65
  177.86.115.97
+177.86.124.68
  177.86.158.102
  177.86.160.4
  177.86.181.206
  177.86.50.64
  177.86.64.173
-177.86.64.201
  177.86.64.245
  177.86.64.253
  177.86.77.10
  177.86.80.19
  177.87.10.186
-177.87.10.50
  177.87.108.93
-177.87.154.2
-177.87.158.98
-177.87.168.101
+177.87.152.58
  177.87.213.129
  177.87.223.194
  177.87.230.1
  177.87.252.18
  177.87.36.193
  177.87.37.28
-177.87.68.128
  177.87.68.137
-177.87.68.142
-177.87.68.225
+177.87.68.252
  177.87.68.61
  177.87.68.97
-177.9.156.96
+177.87.9.187
  177.9.187.44
  177.9.227.31
-177.91.113.44
  177.91.113.68
  177.91.165.192
  177.91.181.234
@@ -58713,9 +54943,8 @@
  177.91.184.169
  177.91.184.78
  177.91.186.60
-177.91.188.41
  177.91.214.89
-177.91.216.247
+177.91.219.192
  177.91.33.131
  177.91.33.17
  177.91.33.55
@@ -58728,10 +54957,8 @@
  177.91.78.253
  177.91.79.21
  177.91.80.8
-177.91.84.245
  177.91.9.17
  177.92.12.74
-177.92.16.186
  177.92.160.254
  177.92.160.70
  177.92.160.72
@@ -58739,23 +54966,33 @@
  177.92.21.2
  177.92.247.133
  177.92.247.145
-177.92.247.37
  177.92.249.112
  177.92.38.187
  177.92.38.62
-177.92.4.106
  177.92.4.58
  177.92.47.90
-177.92.66.227
  177.92.85.186
  177.92.9.10
  177.92.9.12
  177.92.9.14
-177.93.151.8
  177.93.165.25
  177.93.188.22
  177.93.251.45
  177.93.253.8
+177.93.65.123
+177.93.65.128
+177.93.65.129
+177.93.65.168
+177.93.65.22
+177.93.65.220
+177.93.65.240
+177.93.68.229
+177.93.68.66
+177.93.69.177
+177.93.69.186
+177.93.70.134
+177.93.70.234
+177.93.70.9
  177.93.79.18
  177.93.79.34
  177.93.79.57
@@ -58771,16 +55008,13 @@
  177.95.210.184
  177.95.228.118
  177.96.145.181
+177.96.231.101
  177.96.244.21
  177.96.56.36
-177.97.10.147
  177.97.105.212
-177.97.12.104
  177.97.120.245
  177.97.253.175
  177.97.29.190
-177.97.79.66
-177.97.8.170
  177.98.110.153
  177.98.118.197
  177.98.152.202
@@ -58790,8 +55024,6 @@
  177.99.1.73
  177.99.116.221
  177.99.175.58
-177.99.206.82
-177.99.210.179
  1770122162.jclecardinal.com
  177306689.servehalflife.com
  1775114384.jclecardinal.com
@@ -58802,9 +55034,11 @@
  178.113.40.169
  178.116.213.31
  178.116.96.223
+178.118.161.146
  178.12.221.130
  178.120.15.145
  178.120.22.2
+178.120.234.217
  178.120.48.199
  178.121.104.247
  178.121.128.17
@@ -58814,19 +55048,22 @@
  178.121.238.63
  178.121.69.188
  178.121.69.232
+178.122.131.219
  178.122.148.122
  178.122.205.228
  178.122.207.82
  178.122.48.251
  178.123.211.226
-178.123.25.148
+178.123.221.237
+178.123.57.200
  178.123.84.20
+178.124.124.44
  178.124.131.178
  178.124.134.75
-178.124.148.227
  178.124.153.97
  178.124.166.231
  178.124.182.104
+178.124.187.114
  178.124.187.237
  178.124.188.42
  178.124.202.115
@@ -58839,17 +55076,12 @@
  178.125.221.124
  178.125.77.145
  178.125.85.116
-178.126.51.119
-178.126.95.176
-178.127.17.108
-178.127.175.92
  178.127.241.64
  178.128.1.219
  178.128.10.117
  178.128.100.167
  178.128.102.190
  178.128.103.8
-178.128.105.160
  178.128.105.245
  178.128.105.25
  178.128.105.253
@@ -58863,17 +55095,16 @@
  178.128.108.166
  178.128.11.149
  178.128.11.189
-178.128.110.188
  178.128.110.241
  178.128.111.172
  178.128.111.69
  178.128.112.14
  178.128.112.53
-178.128.113.47
  178.128.114.118
  178.128.114.145
  178.128.114.40
  178.128.114.63
+178.128.115.234
  178.128.116.73
  178.128.117.160
  178.128.117.18
@@ -58893,13 +55124,9 @@
  178.128.120.33
  178.128.121.104
  178.128.121.137
-178.128.121.188
-178.128.122.111
-178.128.122.126
  178.128.122.222
  178.128.123.111
  178.128.124.89
-178.128.125.10
  178.128.125.16
  178.128.125.4
  178.128.126.173
@@ -58907,16 +55134,13 @@
  178.128.127.62
  178.128.131.130
  178.128.14.102
-178.128.14.3
-178.128.144.14
  178.128.144.227
  178.128.146.154
  178.128.146.87
  178.128.147.114
  178.128.147.244
  178.128.148.98
-178.128.15.57
-178.128.150.158
+178.128.15.105
  178.128.150.21
  178.128.152.19
  178.128.152.194
@@ -58934,23 +55158,20 @@
  178.128.158.86
  178.128.159.158
  178.128.161.170
-178.128.162.10
  178.128.162.115
  178.128.164.145
-178.128.168.87
  178.128.169.88
  178.128.17.153
  178.128.172.203
  178.128.172.59
  178.128.173.100
  178.128.173.238
-178.128.175.10
  178.128.175.197
  178.128.18.102
  178.128.18.14
+178.128.18.247
  178.128.18.29
  178.128.181.61
-178.128.183.90
  178.128.189.108
  178.128.19.198
  178.128.193.234
@@ -58960,7 +55181,7 @@
  178.128.201.175
  178.128.206.34
  178.128.206.59
-178.128.208.38
+178.128.207.26
  178.128.209.139
  178.128.209.152
  178.128.209.46
@@ -58970,7 +55191,6 @@
  178.128.21.38
  178.128.210.175
  178.128.210.230
-178.128.211.198
  178.128.211.49
  178.128.212.164
  178.128.212.19
@@ -58980,23 +55200,18 @@
  178.128.215.172
  178.128.215.76
  178.128.217.135
-178.128.217.168
  178.128.217.42
  178.128.217.58
  178.128.217.83
  178.128.218.188
-178.128.218.56
-178.128.219.170
  178.128.22.249
  178.128.221.162
  178.128.221.177
-178.128.221.85
-178.128.222.15
  178.128.223.235
  178.128.224.143
  178.128.225.74
+178.128.226.161
  178.128.226.2
-178.128.227.211
  178.128.227.22
  178.128.228.15
  178.128.228.228
@@ -59007,7 +55222,6 @@
  178.128.230.50
  178.128.231.38
  178.128.232.28
-178.128.232.77
  178.128.233.69
  178.128.234.32
  178.128.235.230
@@ -59034,6 +55248,7 @@
  178.128.244.226
  178.128.244.231
  178.128.244.252
+178.128.245.251
  178.128.247.181
  178.128.247.43
  178.128.247.47
@@ -59056,12 +55271,12 @@
  178.128.255.45
  178.128.255.82
  178.128.26.111
+178.128.26.134
  178.128.26.222
  178.128.26.38
  178.128.28.166
  178.128.28.51
  178.128.29.15
-178.128.29.208
  178.128.30.115
  178.128.31.47
  178.128.31.84
@@ -59078,7 +55293,6 @@
  178.128.39.246
  178.128.39.39
  178.128.40.56
-178.128.41.102
  178.128.41.106
  178.128.41.141
  178.128.41.212
@@ -59089,23 +55303,19 @@
  178.128.48.87
  178.128.49.224
  178.128.49.29
+178.128.51.162
  178.128.52.193
  178.128.52.226
  178.128.53.79
  178.128.54.106
  178.128.54.110
-178.128.54.25
  178.128.54.44
  178.128.55.198
  178.128.55.214
  178.128.56.89
-178.128.57.222
-178.128.58.110
  178.128.58.12
  178.128.58.95
-178.128.59.109
  178.128.60.11
-178.128.61.101
  178.128.61.133
  178.128.61.148
  178.128.61.211
@@ -59118,32 +55328,26 @@
  178.128.68.121
  178.128.7.8
  178.128.70.115
-178.128.70.61
  178.128.72.117
  178.128.72.80
  178.128.72.84
  178.128.75.169
  178.128.75.212
  178.128.76.123
-178.128.78.109
  178.128.8.160
  178.128.8.241
  178.128.80.85
-178.128.81.60
-178.128.83.30
-178.128.84.200
  178.128.84.47
  178.128.86.47
  178.128.87.73
-178.128.88.244
  178.128.89.170
-178.128.89.86
  178.128.89.95
+178.128.90.6
  178.128.91.117
  178.128.91.60
+178.128.91.99
  178.128.92.109
  178.128.93.251
-178.128.95.71
  178.128.96.56
  178.128.96.96
  178.128.97.198
@@ -59162,7 +55366,6 @@
  178.130.71.63
  178.130.82.123
  178.130.84.5
-178.132.2.212
  178.132.2.246
  178.132.200.244
  178.132.209.83
@@ -59173,6 +55376,7 @@
  178.134.153.205
  178.134.155.82
  178.134.185.112
+178.134.185.13
  178.134.185.155
  178.134.185.173
  178.134.185.183
@@ -59197,15 +55401,12 @@
  178.134.71.146
  178.135.11.169
  178.135.11.79
-178.135.12.74
  178.135.12.9
  178.135.13.179
  178.135.13.186
  178.135.51.30
  178.135.8.238
  178.135.9.129
-178.136.2.208
-178.136.235.119
  178.136.56.246
  178.137.115.185
  178.137.16.0
@@ -59488,9 +55689,7 @@
  178.137.93.24
  178.137.93.28
  178.137.95.244
-178.138.99.228
  178.141.0.246
-178.141.11.201
  178.141.123.154
  178.141.13.237
  178.141.132.216
@@ -59498,7 +55697,7 @@
  178.141.135.114
  178.141.135.211
  178.141.136.21
-178.141.138.150
+178.141.136.214
  178.141.139.183
  178.141.140.199
  178.141.140.2
@@ -59509,7 +55708,6 @@
  178.141.150.202
  178.141.161.58
  178.141.17.185
-178.141.175.161
  178.141.177.90
  178.141.178.180
  178.141.18.37
@@ -59545,7 +55743,6 @@
  178.141.30.147
  178.141.31.45
  178.141.31.80
-178.141.32.24
  178.141.34.216
  178.141.39.47
  178.141.4.114
@@ -59553,7 +55750,6 @@
  178.141.45.93
  178.141.47.227
  178.141.47.232
-178.141.49.101
  178.141.5.202
  178.141.51.126
  178.141.6.163
@@ -59568,6 +55764,7 @@
  178.141.83.41
  178.141.84.109
  178.141.85.213
+178.141.85.36
  178.141.88.58
  178.141.91.145
  178.141.91.20
@@ -59575,10 +55772,10 @@
  178.142.62.214
  178.143.12.103
  178.143.52.84
+178.147.154.216
  178.148.118.106
  178.148.172.209
  178.148.226.180
-178.149.114.79
  178.149.157.252
  178.149.185.77
  178.149.192.80
@@ -59591,7 +55788,6 @@
  178.150.194.243
  178.150.20.188
  178.150.237.198
-178.150.237.227
  178.150.47.62
  178.150.96.46
  178.150.97.102
@@ -59612,7 +55808,6 @@
  178.153.23.50
  178.153.28.112
  178.153.41.44
-178.153.71.198
  178.153.87.238
  178.153.94.200
  178.154.227.101
@@ -59622,6 +55817,7 @@
  178.155.5.143
  178.155.5.146
  178.155.5.174
+178.155.5.219
  178.155.72.107
  178.156.31.233
  178.156.44.128
@@ -59631,12 +55827,12 @@
  178.158.36.166
  178.158.53.167
  178.158.64.20
+178.158.70.147
  178.159.107.115
  178.159.107.116
  178.159.107.244
  178.159.107.254
  178.159.107.40
-178.159.107.44
  178.159.107.70
  178.159.107.98
  178.159.112.214
@@ -59648,6 +55844,7 @@
  178.159.245.55
  178.159.36.172
  178.159.36.185
+178.159.37.104
  178.159.37.125
  178.159.37.139
  178.159.37.142
@@ -59662,13 +55859,10 @@
  178.159.37.92
  178.159.43.35
  178.16.174.0
-178.16.175.146
  178.16.222.146
  178.16.223.204
  178.16.80.16
  178.16.97.147
-178.160.248.151
-178.160.248.170
  178.161.192.171
  178.161.214.254
  178.162.146.215
@@ -59694,13 +55888,13 @@
  178.162.221.115
  178.162.222.227
  178.162.27.252
+178.164.145.216
  178.164.226.197
  178.165.103.188
  178.165.21.58
  178.165.44.122
  178.165.48.209
  178.165.72.177
-178.165.99.208
  178.166.52.254
  178.167.14.18
  178.168.120.136
@@ -59719,8 +55913,8 @@
  178.169.115.209
  178.169.170.112
  178.169.191.216
+178.169.217.246
  178.169.248.92
-178.169.252.7
  178.169.254.113
  178.169.80.150
  178.17.127.210
@@ -59764,8 +55958,8 @@
  178.170.220.162
  178.170.46.114
  178.173.171.10
+178.173.212.77
  178.174.136.101
-178.174.136.102
  178.174.136.105
  178.174.136.107
  178.174.136.109
@@ -59809,14 +56003,15 @@
  178.174.148.20
  178.174.148.234
  178.174.148.58
-178.174.172.139
  178.174.176.12
  178.174.237.91
+178.174.246.157
  178.175.119.165
  178.175.130.253
  178.175.130.254
  178.175.131.194
  178.175.132.65
+178.175.132.66
  178.175.132.67
  178.175.132.68
  178.175.132.69
@@ -59840,7 +56035,6 @@
  178.176.249.113
  178.176.249.143
  178.176.249.219
-178.176.41.40
  178.176.61.193
  178.177.0.36
  178.18.138.41
@@ -59854,11 +56048,11 @@
  178.183.1.9
  178.183.99.149
  178.184.122.103
+178.184.165.231
  178.184.77.73
  178.184.80.253
-178.184.91.11
+178.185.34.157
  178.188.67.190
-178.189.226.143
  178.19.106.234
  178.19.107.27
  178.19.247.25
@@ -59868,11 +56062,13 @@
  178.193.62.127
  178.193.89.142
  178.194.188.6
+178.194.87.238
  178.195.218.144
  178.196.1.133
  178.196.1.210
  178.196.19.216
  178.196.25.114
+178.196.57.3
  178.198.104.56
  178.198.152.152
  178.198.35.158
@@ -59895,8 +56091,8 @@
  178.20.74.212
  178.200.152.49
  178.200.234.84
-178.201.118.209
  178.201.200.46
+178.201.247.152
  178.202.130.86
  178.202.32.83
  178.202.92.150
@@ -59906,17 +56102,19 @@
  178.205.101.67
  178.205.109.107
  178.205.136.73
+178.205.141.180
  178.205.150.49
  178.205.253.205
  178.205.253.206
  178.205.254.106
+178.206.2.252
  178.206.224.16
  178.206.228.141
  178.206.229.89
  178.207.196.229
  178.207.9.210
  178.208.163.147
-178.208.242.251
+178.208.255.8
  178.208.75.227
  178.209.121.5
  178.209.126.217
@@ -59928,22 +56126,21 @@
  178.209.55.89
  178.209.66.112
  178.209.67.73
-178.209.94.211
  178.21.20.102
  178.21.206.74
  178.210.0.198
  178.210.139.218
  178.210.163.36
  178.210.22.7
-178.210.246.86
  178.210.27.187
  178.210.35.217
+178.210.4.66
  178.210.54.253
  178.210.66.37
  178.211.179.3
  178.211.45.18
  178.211.45.66
-178.211.96.40
+178.211.57.114
  178.212.134.160
  178.212.176.82
  178.212.54.137
@@ -59953,6 +56150,7 @@
  178.213.0.207
  178.213.112.33
  178.213.116.58
+178.213.123.158
  178.213.130.101
  178.213.130.159
  178.213.184.108
@@ -59960,29 +56158,27 @@
  178.213.185.205
  178.213.185.234
  178.213.185.41
+178.213.185.79
  178.213.186.192
  178.213.186.53
  178.213.187.175
  178.213.187.6
  178.213.188.134
  178.213.189.112
-178.213.189.172
+178.213.189.115
  178.213.189.249
-178.213.189.94
  178.213.190.121
  178.213.190.234
  178.213.191.183
-178.213.53.35
  178.213.53.36
-178.213.53.37
-178.213.53.39
+178.213.53.41
  178.213.53.44
  178.213.53.46
  178.213.53.49
-178.213.53.51
+178.213.53.50
  178.214.212.2
-178.214.220.13
  178.214.243.19
+178.214.244.146
  178.214.245.131
  178.214.245.133
  178.214.245.166
@@ -59995,8 +56191,8 @@
  178.214.250.188
  178.214.250.23
  178.214.251.136
+178.214.251.142
  178.214.254.149
-178.214.254.203
  178.214.46.108
  178.214.77.12
  178.215.163.218
@@ -60011,14 +56207,12 @@
  178.216.2.229
  178.216.200.48
  178.216.202.97
-178.216.233.110
  178.216.24.44
  178.216.24.49
  178.216.24.53
  178.216.251.21
  178.216.26.175
  178.216.49.147
-178.216.50.2
  178.216.64.235
  178.216.77.165
  178.217.106.245
@@ -60028,6 +56222,13 @@
  178.217.152.234
  178.217.168.85
  178.217.169.10
+178.217.169.208
+178.217.169.209
+178.217.169.212
+178.217.169.222
+178.217.169.223
+178.217.169.225
+178.217.169.240
  178.217.172.234
  178.217.173.54
  178.217.184.212
@@ -60035,8 +56236,8 @@
  178.217.216.184
  178.217.33.61
  178.217.40.208
+178.217.69.129
  178.217.76.31
-178.217.76.64
  178.217.8.194
  178.217.98.174
  178.218.104.42
@@ -60055,41 +56256,36 @@
  178.219.174.58
  178.219.175.128
  178.219.187.6
+178.219.30.197
  178.219.31.252
-178.219.37.70
  178.219.49.61
  178.219.62.208
  178.219.9.40
  178.22.120.102
  178.22.123.150
-178.22.123.208
-178.22.123.241
  178.22.168.44
  178.22.221.201
  178.22.65.147
+178.220.109.113
  178.221.110.179
  178.221.139.245
  178.221.39.148
  178.221.41.10
  178.222.148.139
  178.222.172.3
-178.222.228.190
-178.222.246.48
  178.222.249.214
  178.222.8.202
  178.223.178.103
  178.223.68.233
-178.223.74.203
  178.23.236.40
  178.23.244.208
-178.233.16.117
+178.234.241.86
  178.234.35.42
  178.234.37.197
  178.234.40.163
  178.236.137.63
  178.236.45.30
  178.236.61.27
-178.237.0.229
  178.237.56.4
  178.238.131.112
  178.238.133.232
@@ -60119,13 +56315,13 @@
  178.248.108.51
  178.248.115.47
  178.248.200.16
+178.248.254.100
  178.248.255.79
  178.248.3.25
  178.248.57.92
  178.248.87.44
  178.249.122.203
  178.249.148.227
-178.249.193.64
  178.249.219.91
  178.249.95.43
  178.250.156.229
@@ -60148,21 +56344,23 @@
  178.254.139.41
  178.254.142.177
  178.254.143.17
-178.254.147.219
  178.254.148.37
  178.254.149.33
  178.254.149.37
  178.254.169.10
+178.254.171.115
  178.254.171.117
-178.254.171.128
-178.254.171.199
-178.254.171.206
-178.254.171.214
+178.254.171.123
+178.254.171.151
+178.254.171.191
+178.254.171.223
  178.254.171.25
+178.254.171.60
  178.254.171.61
+178.254.171.71
  178.254.174.196
+178.254.179.133
  178.254.179.145
-178.254.179.176
  178.254.179.201
  178.254.31.72
  178.254.34.108
@@ -60174,6 +56372,7 @@
  178.255.154.57
  178.255.215.69
  178.255.229.102
+178.255.41.138
  178.255.42.126
  178.255.45.214
  178.26.144.123
@@ -60193,46 +56392,38 @@
  178.32.121.17
  178.32.123.182
  178.32.125.98
-178.32.163.201
  178.32.163.202
-178.32.163.203
  178.32.167.73
  178.32.181.66
  178.32.189.89
  178.32.192.85
  178.32.197.83
+178.32.197.89
+178.32.197.90
  178.32.198.183
  178.32.198.221
  178.32.205.2
  178.32.213.61
  178.32.215.88
-178.32.215.89
-178.32.215.90
  178.32.216.133
  178.32.218.149
  178.32.218.192
-178.32.219.209
+178.32.218.72
  178.32.219.210
  178.32.220.61
-178.32.221.142
-178.32.221.225
  178.32.223.117
+178.32.228.88
  178.32.244.169
  178.32.251.97
-178.32.51.139
  178.32.53.124
  178.32.53.131
  178.32.53.94
  178.32.58.209
-178.32.6.108
  178.32.62.253
  178.32.79.49
  178.32.88.23
  178.32.97.34
-178.32.98.98
-178.33.12.237
  178.33.131.26
-178.33.132.108
  178.33.132.214
  178.33.132.215
  178.33.134.34
@@ -60249,17 +56440,14 @@
  178.33.167.120
  178.33.18.165
  178.33.209.195
-178.33.212.220
  178.33.216.187
  178.33.216.209
  178.33.228.210
-178.33.229.120
  178.33.232.69
  178.33.233.230
  178.33.255.189
  178.33.3.16
  178.33.38.55
-178.33.45.156
  178.33.48.26
  178.33.64.76
  178.33.67.12
@@ -60267,8 +56455,6 @@
  178.33.68.21
  178.33.93.88
  178.34.146.222
-178.34.156.249
-178.34.190.34
  178.37.238.95
  178.38.132.54
  178.38.27.254
@@ -60278,6 +56464,8 @@
  178.42.182.179
  178.42.48.18
  178.44.204.175
+178.44.228.100
+178.45.185.206
  178.46.107.129
  178.46.128.121
  178.46.159.12
@@ -60286,17 +56474,18 @@
  178.46.208.107
  178.46.208.11
  178.46.208.158
+178.46.208.160
  178.46.208.162
  178.46.208.183
  178.46.208.197
+178.46.208.211
  178.46.208.240
  178.46.208.241
  178.46.208.249
+178.46.208.49
  178.46.208.86
-178.46.208.87
  178.46.209.106
  178.46.209.130
-178.46.209.145
  178.46.209.166
  178.46.209.168
  178.46.209.180
@@ -60307,6 +56496,7 @@
  178.46.209.243
  178.46.210.0
  178.46.210.109
+178.46.210.110
  178.46.210.12
  178.46.210.120
  178.46.210.151
@@ -60321,14 +56511,16 @@
  178.46.210.47
  178.46.210.58
  178.46.210.66
-178.46.210.72
  178.46.210.8
  178.46.211.10
+178.46.211.115
+178.46.211.141
+178.46.211.151
  178.46.211.157
  178.46.211.161
  178.46.211.167
  178.46.211.170
-178.46.211.172
+178.46.211.191
  178.46.211.23
  178.46.211.245
  178.46.211.29
@@ -60341,6 +56533,7 @@
  178.46.212.152
  178.46.212.159
  178.46.212.171
+178.46.212.187
  178.46.212.191
  178.46.212.197
  178.46.212.198
@@ -60354,10 +56547,8 @@
  178.46.212.7
  178.46.212.74
  178.46.212.78
-178.46.212.84
  178.46.213.10
  178.46.213.114
-178.46.213.145
  178.46.213.15
  178.46.213.160
  178.46.213.190
@@ -60365,7 +56556,6 @@
  178.46.213.22
  178.46.213.226
  178.46.213.228
-178.46.213.230
  178.46.213.24
  178.46.213.248
  178.46.213.254
@@ -60375,7 +56565,6 @@
  178.46.213.95
  178.46.214.106
  178.46.214.107
-178.46.214.11
  178.46.214.142
  178.46.214.17
  178.46.214.182
@@ -60385,6 +56574,7 @@
  178.46.214.221
  178.46.214.246
  178.46.214.252
+178.46.214.47
  178.46.214.53
  178.46.214.65
  178.46.214.71
@@ -60413,6 +56603,7 @@
  178.47.132.182
  178.47.139.151
  178.47.139.50
+178.47.140.149
  178.47.141.128
  178.47.141.196
  178.47.141.218
@@ -60437,6 +56628,7 @@
  178.48.68.61
  178.49.13.230
  178.54.121.123
+178.54.121.174
  178.54.155.51
  178.54.219.178
  178.54.78.190
@@ -60449,16 +56641,13 @@
  178.57.115.124
  178.57.125.78
  178.57.235.112
-178.59.96.141
  178.60.28.98
  178.61.141.198
  178.61.147.17
-178.62.0.138
  178.62.0.215
+178.62.1.145
  178.62.10.18
  178.62.10.232
-178.62.100.17
-178.62.101.107
  178.62.101.135
  178.62.103.10
  178.62.103.30
@@ -60468,8 +56657,6 @@
  178.62.105.138
  178.62.107.10
  178.62.108.111
-178.62.11.53
-178.62.110.145
  178.62.110.209
  178.62.112.19
  178.62.114.26
@@ -60493,7 +56680,6 @@
  178.62.18.173
  178.62.18.9
  178.62.183.92
-178.62.186.49
  178.62.187.136
  178.62.19.106
  178.62.192.150
@@ -60505,10 +56691,8 @@
  178.62.196.28
  178.62.197.90
  178.62.198.108
-178.62.198.142
  178.62.199.240
  178.62.2.80
-178.62.202.204
  178.62.203.116
  178.62.203.118
  178.62.204.42
@@ -60517,7 +56701,6 @@
  178.62.209.102
  178.62.209.85
  178.62.21.115
-178.62.21.80
  178.62.210.151
  178.62.211.224
  178.62.212.233
@@ -60530,7 +56713,6 @@
  178.62.215.235
  178.62.215.43
  178.62.217.61
-178.62.22.142
  178.62.220.89
  178.62.222.152
  178.62.224.162
@@ -60540,11 +56722,9 @@
  178.62.226.177
  178.62.227.177
  178.62.228.162
-178.62.23.108
+178.62.23.28
  178.62.230.5
-178.62.233.112
  178.62.233.90
-178.62.234.124
  178.62.238.37
  178.62.24.120
  178.62.240.196
@@ -60561,11 +56741,9 @@
  178.62.247.109
  178.62.247.22
  178.62.247.57
-178.62.248.130
  178.62.25.71
  178.62.250.186
  178.62.251.183
-178.62.252.131
  178.62.252.206
  178.62.253.169
  178.62.254.221
@@ -60576,11 +56754,9 @@
  178.62.27.144
  178.62.29.24
  178.62.29.94
+178.62.30.190
  178.62.31.152
  178.62.32.11
-178.62.33.138
-178.62.33.222
-178.62.36.116
  178.62.36.84
  178.62.37.78
  178.62.39.189
@@ -60598,6 +56774,7 @@
  178.62.49.137
  178.62.5.48
  178.62.50.191
+178.62.50.212
  178.62.52.150
  178.62.52.168
  178.62.52.213
@@ -60621,7 +56798,6 @@
  178.62.75.60
  178.62.76.138
  178.62.77.137
-178.62.79.227
  178.62.79.64
  178.62.8.113
  178.62.8.174
@@ -60636,13 +56812,12 @@
  178.62.86.172
  178.62.86.6
  178.62.87.246
-178.62.89.14
  178.62.89.199
  178.62.9.122
  178.62.9.39
+178.62.90.154
  178.62.92.247
  178.62.98.233
-178.63.111.207
  178.63.127.148
  178.63.127.150
  178.63.13.15
@@ -60673,16 +56848,16 @@
  178.63.97.197
  178.63.97.34
  178.63.98.228
-178.64.240.97
+178.64.193.5
  178.64.96.97
  178.65.144.180
  178.65.214.71
-178.65.51.2
-178.66.182.76
+178.66.26.235
  178.66.3.151
  178.67.195.64
  178.67.205.104
  178.67.48.220
+178.68.196.178
  178.69.12.30
  178.69.16.130
  178.69.191.120
@@ -60690,7 +56865,6 @@
  178.70.76.234
  178.71.124.90
  178.71.184.240
-178.71.187.114
  178.72.162.242
  178.72.74.40
  178.73.210.138
@@ -60702,7 +56876,6 @@
  178.75.27.131
  178.76.234.182
  178.76.238.246
-178.76.252.146
  178.76.254.130
  178.76.69.132
  178.77.154.111
@@ -60715,6 +56888,7 @@
  178.79.138.62
  178.79.149.208
  178.79.152.170
+178.79.161.111
  178.79.161.166
  178.79.162.159
  178.79.163.131
@@ -60737,8 +56911,8 @@
  178.85.133.89
  178.85.82.198
  178.86.160.56
-178.86.233.48
  178.87.239.116
+178.87.30.194
  178.88.142.108
  178.88.211.113
  178.88.212.171
@@ -60755,12 +56929,10 @@
  178.90.159.114
  178.90.32.114
  178.90.50.54
-178.90.88.152
  178.91.179.201
  178.91.189.206
  178.91.196.201
-178.91.95.178
-178.93.12.196
+178.93.12.24
  178.93.12.9
  178.93.13.16
  178.93.137.129
@@ -60770,12 +56942,10 @@
  178.93.19.230
  178.93.21.213
  178.93.26.87
-178.93.28.84
  178.93.29.68
  178.93.38.232
  178.93.40.144
  178.93.42.132
-178.93.43.88
  178.93.45.178
  178.93.45.6
  178.93.46.110
@@ -60785,17 +56955,17 @@
  178.93.5.123
  178.93.5.194
  178.93.51.42
-178.93.52.59
+178.93.51.68
+178.93.55.174
  178.93.59.166
  178.93.59.175
  178.93.6.134
-178.93.60.160
  178.93.98.77
  178.94.112.235
  178.94.146.50
  178.94.149.31
  178.94.173.6
-178.94.45.187
+178.94.59.170
  178.94.87.197
  178.95.102.248
  178.95.164.97
@@ -60806,14 +56976,15 @@
  179.104.173.90
  179.104.230.12
  179.104.230.187
+179.104.230.28
  179.104.230.36
  179.104.232.97
-179.104.233.85
  179.104.236.118
  179.104.236.8
  179.104.42.215
  179.104.48.241
  179.105.125.141
+179.105.130.207
  179.105.25.40
  179.106.12.87
  179.106.150.4
@@ -60826,14 +56997,13 @@
  179.106.223.27
  179.106.23.62
  179.106.26.72
-179.106.32.109
  179.106.57.162
  179.106.83.157
  179.106.96.74
-179.107.11.239
  179.107.11.98
  179.107.135.42
  179.107.189.1
+179.107.189.184
  179.107.189.72
  179.107.192.123
  179.107.192.246
@@ -60841,6 +57011,7 @@
  179.107.194.186
  179.107.34.178
  179.107.57.80
+179.107.57.96
  179.107.58.244
  179.107.58.79
  179.107.59.89
@@ -60852,21 +57023,21 @@
  179.107.67.80
  179.107.84.10
  179.107.90.36
-179.108.104.15
  179.108.123.210
  179.108.158.122
  179.108.158.142
  179.108.158.224
  179.108.158.226
+179.108.179.242
  179.108.18.115
  179.108.184.131
  179.108.187.128
  179.108.19.202
  179.108.19.214
  179.108.206.140
-179.108.222.250
  179.108.249.116
  179.108.249.118
+179.108.249.133
  179.108.249.177
  179.108.250.77
  179.108.45.253
@@ -60887,22 +57058,18 @@
  179.110.129.172
  179.110.147.1
  179.110.19.173
-179.110.50.197
+179.110.61.143
  179.110.81.43
  179.110.98.246
  179.111.154.187
+179.111.160.35
  179.111.212.162
  179.111.9.254
  179.111.97.199
-179.112.151.122
-179.112.182.18
-179.112.38.84
-179.112.9.12
-179.112.97.172
  179.113.190.122
  179.113.194.145
+179.113.97.108
  179.117.162.118
-179.117.185.138
  179.124.136.37
  179.124.177.70
  179.124.177.73
@@ -60920,16 +57087,13 @@
  179.124.31.175
  179.124.31.240
  179.124.31.242
-179.124.34.8
-179.124.34.9
-179.124.36.195
  179.124.36.196
-179.125.118.78
  179.125.172.177
  179.125.172.210
  179.125.25.218
  179.125.39.230
  179.125.43.89
+179.125.50.166
  179.125.6.36
  179.127.140.113
  179.127.140.142
@@ -60943,11 +57107,8 @@
  179.127.35.17
  179.127.93.122
  179.131.11.234
-179.145.36.75
  179.149.182.19
-179.150.137.166
  179.151.227.253
-179.151.227.59
  179.155.108.27
  179.155.127.61
  179.155.221.208
@@ -60958,7 +57119,6 @@
  179.156.99.114
  179.157.206.101
  179.157.207.193
-179.159.164.242
  179.159.247.21
  179.159.251.87
  179.159.42.233
@@ -60971,10 +57131,9 @@
  179.162.41.112
  179.162.89.102
  179.162.9.172
+179.167.30.196
  179.168.248.105
  179.170.229.37
-179.171.1.186
-179.173.200.207
  179.174.32.166
  179.176.100.232
  179.176.11.229
@@ -60992,6 +57151,7 @@
  179.179.27.71
  179.179.54.182
  179.179.75.2
+179.180.171.53
  179.180.232.176
  179.180.73.80
  179.181.106.79
@@ -60999,54 +57159,49 @@
  179.181.179.13
  179.181.201.184
  179.181.206.196
-179.181.226.31
  179.182.134.140
  179.182.180.228
-179.182.220.242
  179.182.63.104
  179.183.230.91
  179.184.0.112
  179.184.161.221
  179.184.230.194
-179.185.104.250
  179.185.189.177
  179.185.212.214
  179.185.50.182
  179.185.65.220
  179.185.66.242
-179.185.78.91
  179.185.80.196
  179.185.89.241
  179.186.241.7
  179.186.46.11
  179.187.239.180
-179.187.30.70
  179.187.92.73
  179.189.1.17
  179.189.101.148
  179.189.125.222
+179.189.181.9
  179.189.199.120
  179.189.199.149
  179.189.199.32
+179.189.2.210
+179.189.207.178
  179.189.253.122
  179.189.27.28
  179.189.48.50
  179.189.48.70
  179.189.85.206
  179.190.199.206
-179.190.96.250
-179.191.123.46
  179.191.15.59
-179.191.224.126
  179.191.235.238
-179.191.237.172
  179.191.238.239
  179.191.245.58
-179.191.52.112
-179.191.52.158
+179.191.52.100
+179.191.52.133
+179.191.52.90
+179.191.52.92
  179.191.53.121
-179.191.68.86
-179.191.88.58
+179.191.99.218
  179.208.141.58
  179.208.167.192
  179.208.176.208
@@ -61055,38 +57210,29 @@
  179.209.196.233
  179.209.232.229
  179.209.88.167
-179.209.88.230
  179.210.121.225
  179.211.32.189
-179.212.136.198
  179.212.138.1
  179.213.95.241
  179.215.62.112
-179.216.177.121
  179.217.154.41
  179.217.40.116
-179.217.63.241
-179.219.54.67
  179.219.96.136
  179.219.98.106
  179.221.205.69
  179.221.219.246
  179.222.115.170
-179.222.33.54
  179.222.67.144
  179.222.96.70
  179.225.140.127
  179.225.245.170
  179.228.128.144
  179.228.13.37
-179.228.27.12
-179.228.32.17
  179.228.74.3
  179.228.95.121
-179.228.97.179
+179.232.15.58
  179.232.71.145
  179.234.1.38
-179.234.199.14
  179.234.232.150
  179.234.251.225
  179.234.26.18
@@ -61094,34 +57240,29 @@
  179.234.40.169
  179.235.137.203
  179.235.150.219
-179.240.245.91
  179.243.81.157
  179.243.82.199
-179.252.92.123
+179.247.13.136
  179.253.179.216
  179.255.88.127
  179.27.60.34
  179.27.67.250
-179.27.71.18
  179.27.73.234
  179.27.83.222
  179.33.181.35
  179.34.35.41
  179.36.214.227
-179.39.41.99
-179.39.56.82
  179.4.136.174
  179.40.75.1
  179.42.105.0
  179.42.105.233
-179.42.183.224
+179.42.107.251
  179.42.205.50
  179.43.101.47
  179.43.128.245
  179.43.133.42
  179.43.134.154
  179.43.134.190
-179.43.141.213
  179.43.141.76
  179.43.143.162
  179.43.146.201
@@ -61154,23 +57295,18 @@
  179.43.170.150
  179.43.170.152
  179.43.174.203
-179.43.60.1
  179.43.97.40
  179.48.251.188
  179.49.134.61
  179.49.144.239
  179.49.165.74
-179.49.46.2
  179.49.57.150
  179.5.118.12
  179.5.194.9
  179.50.241.53
-179.51.192.198
  179.51.196.10
  179.51.96.32
-179.52.132.217
  179.52.18.155
-179.53.195.4
  179.53.73.70
  179.54.191.14
  179.55.238.53
@@ -61182,23 +57318,20 @@
  179.56.248.64
  179.56.59.194
  179.57.254.34
-179.57.254.39
  179.57.254.69
  179.57.45.150
  179.57.45.168
  179.57.56.146
-179.6.46.2
+179.6.201.158
+179.6.33.124
  179.60.127.234
  179.60.127.45
  179.60.127.80
  179.60.243.38
  179.61.145.53
  179.61.160.196
-179.61.161.126
-179.61.162.124
  179.61.164.45
  179.61.166.74
-179.61.167.29
  179.61.179.184
  179.61.179.213
  179.61.180.32
@@ -61210,13 +57343,13 @@
  179.61.180.52
  179.61.180.53
  179.61.180.63
-179.61.184.199
  179.61.184.208
  179.61.184.218
  179.61.184.248
-179.61.185.239
-179.61.185.253
+179.61.185.205
+179.61.185.212
  179.61.251.117
+179.61.251.171
  179.61.251.210
  179.61.87.86
  179.61.92.62
@@ -61225,25 +57358,23 @@
  179.66.160.226
  179.66.42.115
  179.67.21.157
+179.7.192.210
  179.70.102.164
  179.70.117.133
  179.70.71.103
-179.8.16.25
  179.83.104.48
-179.83.200.239
  179.83.201.128
  179.83.201.236
  179.83.244.72
  179.83.250.153
  179.83.4.186
  179.85.199.172
+179.85.225.129
+179.89.196.244
  179.9.160.50
-179.9.183.121
  179.93.120.11
  179.93.146.186
  179.93.149.17
-179.93.151.64
-179.93.196.166
  179.93.55.28
  179.93.59.141
  179.93.60.52
@@ -61257,6 +57388,7 @@
  179.96.3.248
  179.96.62.105
  179.96.62.29
+179.97.10.186
  179.97.113.43
  179.97.23.126
  179.97.23.63
@@ -61267,10 +57399,12 @@
  179.97.8.238
  179.98.0.169
  179.98.0.38
-179.98.109.232
+179.98.5.185
  179.99.129.131
+179.99.195.60
  179.99.200.39
  179.99.203.139
+179.99.214.142
  179381017012724-dot-aql-rkl-evh.appspot.com
  17ab3d2e4638facf.icu
  17bofa71.systeminformationoursecure.com
@@ -61294,9 +57428,7 @@
  18.130.181.59
  18.130.181.66
  18.130.182.166
-18.130.209.7
  18.130.21.204
-18.130.233.219
  18.130.242.64
  18.130.244.18
  18.130.246.105
@@ -61309,14 +57441,13 @@
  18.132.37.244
  18.134.242.0
  18.134.246.87
+18.134.5.186
  18.136.103.250
  18.136.118.221
-18.136.120.152
  18.136.124.224
  18.136.124.244
  18.136.142.174
  18.136.144.35
-18.136.153.130
  18.136.198.2
  18.136.200.216
  18.136.205.193
@@ -61324,29 +57455,20 @@
  18.136.72.135
  18.136.74.240
  18.138.11.173
-18.138.212.162
  18.138.254.147
  18.138.254.166
-18.138.255.186
  18.138.255.8
-18.138.255.82
-18.139.117.179
  18.139.179.138
  18.139.212.16
-18.139.3.212
  18.140.1.91
  18.140.148.89
-18.140.158.23
  18.140.196.41
  18.140.214.227
-18.140.70.247
  18.141.143.176
  18.141.175.198
  18.141.179.167
  18.141.200.138
  18.141.210.87
-18.141.223.205
-18.141.229.207
  18.141.32.68
  18.141.58.221
  18.144.1.173
@@ -61355,25 +57477,28 @@
  18.144.49.66
  18.144.54.86
  18.144.73.74
-18.144.80.217
-18.156.153.38
  18.156.64.16
  18.156.81.115
-18.157.161.42
  18.157.86.215
  18.158.93.160
  18.159.226.230
  18.159.53.170
  18.162.184.105
+18.162.207.211
  18.162.208.153
  18.162.232.109
+18.162.46.146
+18.162.49.2
  18.162.56.139
  18.163.111.172
  18.163.183.198
  18.163.185.91
-18.163.215.140
+18.163.194.25
  18.163.88.189
  18.166.194.199
+18.166.209.177
+18.166.212.138
+18.166.71.221
  18.166.77.237
  18.177.13.247
  18.177.144.21
@@ -61387,6 +57512,7 @@
  18.18.248.17
  18.180.156.169
  18.181.109.120
+18.181.167.174
  18.181.194.135
  18.181.3.129
  18.182.152.245
@@ -61395,7 +57521,6 @@
  18.182.46.235
  18.182.68.214
  18.183.139.213
-18.183.147.121
  18.183.153.104
  18.183.186.156
  18.183.19.86
@@ -61438,6 +57563,7 @@
  18.191.109.28
  18.191.132.10
  18.191.132.27
+18.191.145.121
  18.191.145.149
  18.191.159.221
  18.191.17.165
@@ -61475,13 +57601,11 @@
  18.194.87.132
  18.195.121.56
  18.195.126.47
-18.195.225.113
  18.195.228.145
  18.195.243.254
  18.195.33.5
  18.195.51.22
  18.196.206.35
-18.196.23.156
  18.196.240.197
  18.196.79.108
  18.197.104.87
@@ -61510,8 +57634,6 @@
  18.206.115.37
  18.206.14.51
  18.206.158.128
-18.206.177.131
-18.206.18.212
  18.206.201.164
  18.206.223.137
  18.206.238.251
@@ -61521,6 +57643,7 @@
  18.207.105.173
  18.207.110.64
  18.207.123.167
+18.207.179.247
  18.207.230.252
  18.207.34.254
  18.208.100.35
@@ -61544,6 +57667,7 @@
  18.212.25.96
  18.212.57.172
  18.212.70.205
+18.213.218.157
  18.214.113.12
  18.214.121.165
  18.214.39.103
@@ -61554,6 +57678,7 @@
  18.216.142.183
  18.216.16.45
  18.216.163.203
+18.216.215.120
  18.216.225.154
  18.216.249.170
  18.216.254.255
@@ -61580,7 +57705,6 @@
  18.217.26.239
  18.217.26.54
  18.217.66.164
-18.217.74.80
  18.217.75.7
  18.217.87.238
  18.218.114.49
@@ -61654,7 +57778,6 @@
  18.221.143.49
  18.221.162.186
  18.221.162.53
-18.221.195.166
  18.221.223.108
  18.221.226.11
  18.221.233.177
@@ -61680,25 +57803,20 @@
  18.222.226.53
  18.222.229.143
  18.222.232.78
-18.222.240.219
  18.222.255.206
  18.222.44.220
  18.222.44.236
  18.222.57.180
-18.222.68.200
  18.222.99.113
  18.223.1.180
  18.223.121.192
-18.223.129.64
  18.223.149.246
  18.223.159.195
-18.223.162.111
  18.223.169.31
  18.223.188.153
  18.223.214.130
  18.223.225.61
  18.223.29.35
-18.224.107.150
  18.224.139.209
  18.224.185.112
  18.224.228.223
@@ -61719,10 +57837,10 @@
  18.228.144.20
  18.228.158.38
  18.228.189.224
+18.228.191.202
  18.228.220.130
  18.228.31.45
  18.228.67.12
-18.229.214.126
  18.230.135.138
  18.231.114.211
  18.231.115.37
@@ -61743,7 +57861,6 @@
  18.233.240.175
  18.233.7.52
  18.233.99.209
-18.234.128.23
  18.234.174.252
  18.234.208.74
  18.234.221.133
@@ -61759,11 +57876,9 @@
  18.236.163.88
  18.236.193.189
  18.236.213.97
-18.236.219.39
  18.236.68.61
  18.236.73.214
  18.236.76.228
-18.236.80.67
  18.236.94.102
  18.237.127.12
  18.237.150.11
@@ -61778,12 +57893,11 @@
  18.27.197.252
  18.27.79.17
  180.100.206.35
-180.100.213.63
  180.100.243.210
  180.100.74.4
-180.101.145.234
  180.101.145.86
  180.101.147.147
+180.101.157.222
  180.101.160.70
  180.101.186.24
  180.101.202.30
@@ -61794,12 +57908,10 @@
  180.101.9.174
  180.102.130.13
  180.102.133.193
-180.102.133.27
  180.102.133.99
  180.102.198.249
  180.102.214.130
  180.103.158.169
-180.103.166.93
  180.103.210.68
  180.103.219.117
  180.103.29.204
@@ -61816,14 +57928,12 @@
  180.104.195.81
  180.104.214.249
  180.104.223.191
-180.104.228.62
  180.104.239.146
  180.104.239.184
  180.104.241.83
  180.104.247.126
  180.104.36.208
  180.104.39.202
-180.104.45.19
  180.104.59.28
  180.104.61.229
  180.104.74.135
@@ -61831,24 +57941,21 @@
  180.104.79.77
  180.104.85.70
  180.104.9.150
-180.105.117.236
  180.106.151.233
  180.106.151.38
  180.106.226.248
  180.106.81.126
+180.106.81.168
  180.107.109.21
  180.107.190.176
+180.107.204.25
  180.107.76.147
  180.108.104.124
-180.108.116.190
  180.108.64.71
  180.108.9.34
-180.109.12.17
  180.109.14.165
  180.109.164.233
  180.109.19.125
-180.109.32.80
-180.109.35.107
  180.109.36.200
  180.109.88.73
  180.109.90.246
@@ -61859,14 +57966,11 @@
  180.110.167.67
  180.110.65.219
  180.110.70.124
-180.111.10.114
  180.111.184.139
  180.111.90.68
  180.112.185.135
  180.112.186.194
-180.112.46.46
  180.113.216.101
-180.113.34.187
  180.113.78.52
  180.114.100.68
  180.114.101.116
@@ -61910,7 +58014,6 @@
  180.116.232.8
  180.116.232.95
  180.116.234.94
-180.116.235.6
  180.116.238.12
  180.116.238.136
  180.116.238.144
@@ -61935,24 +58038,27 @@
  180.118.206.60
  180.118.34.100
  180.118.50.46
+180.118.69.134
  180.120.12.85
  180.120.175.141
  180.120.179.144
  180.120.20.203
  180.120.208.81
-180.120.210.22
+180.120.211.57
  180.120.211.76
-180.120.213.111
  180.120.213.126
+180.120.214.201
  180.120.34.228
  180.120.79.159
  180.120.89.209
  180.120.89.229
  180.121.118.47
-180.121.130.186
+180.121.135.169
+180.121.135.3
  180.121.247.122
  180.122.53.43
  180.122.53.97
+180.122.75.192
  180.123.108.63
  180.123.111.168
  180.123.151.213
@@ -62000,8 +58106,10 @@
  180.124.146.205
  180.124.167.252
  180.124.174.33
+180.124.179.194
  180.124.184.132
  180.124.188.129
+180.124.195.45
  180.124.195.61
  180.124.214.4
  180.124.225.77
@@ -62024,9 +58132,7 @@
  180.124.90.224
  180.125.11.13
  180.125.11.54
-180.125.12.86
  180.125.156.242
-180.125.157.134
  180.125.169.29
  180.125.170.131
  180.125.227.194
@@ -62041,10 +58147,12 @@
  180.126.130.162
  180.126.174.198
  180.126.235.204
+180.126.32.54
  180.126.48.168
+180.127.1.153
+180.127.109.163
  180.127.77.217
  180.127.78.107
-180.127.78.184
  180.127.91.222
  180.127.92.53
  180.128.0.237
@@ -62056,6 +58164,7 @@
  180.129.34.84
  180.129.81.253
  180.129.99.84
+180.130.155.124
  180.131.10.24
  180.131.124.134
  180.131.52.107
@@ -62073,11 +58182,10 @@
  180.138.48.144
  180.138.48.33
  180.138.76.125
-180.139.112.125
  180.139.113.30
  180.139.114.27
  180.139.114.40
-180.139.124.130
+180.139.124.167
  180.139.124.177
  180.139.130.36
  180.14.102.33
@@ -62085,7 +58193,6 @@
  180.140.177.181
  180.140.71.149
  180.141.201.189
-180.141.24.122
  180.141.32.191
  180.141.33.105
  180.141.35.30
@@ -62097,12 +58204,12 @@
  180.141.76.47
  180.141.78.5
  180.141.93.64
-180.142.158.140
  180.142.158.180
  180.142.58.37
  180.143.156.4
  180.143.242.216
  180.146.76.190
+180.147.214.74
  180.148.215.101
  180.148.33.203
  180.148.4.194
@@ -62333,8 +58440,7 @@
  180.149.243.178
  180.149.245.78
  180.149.96.131
-180.150.104.137
-180.150.189.206
+180.15.96.71
  180.150.19.243
  180.150.21.129
  180.150.21.41
@@ -62351,32 +58457,21 @@
  180.150.46.187
  180.150.52.37
  180.150.58.14
-180.150.61.144
  180.150.78.6
  180.150.86.215
  180.151.102.90
-180.151.198.70
+180.151.130.96
  180.151.201.122
+180.151.246.58
  180.151.3.43
-180.151.56.103
-180.151.56.113
  180.151.56.114
-180.151.56.119
  180.151.56.124
  180.151.56.99
-180.151.61.46
-180.151.76.188
-180.151.81.138
  180.152.239.218
-180.152.9.217
  180.153.183.174
  180.153.57.132
-180.153.57.251
-180.153.63.9
  180.153.65.120
-180.153.65.18
  180.153.68.54
-180.153.71.134
  180.153.91.17
  180.156.116.56
  180.156.157.122
@@ -62405,32 +58500,26 @@
  180.163.220.97
  180.163.220.99
  180.164.123.19
-180.164.180.120
  180.164.20.115
  180.164.221.45
  180.164.255.12
  180.164.41.248
-180.164.56.3
  180.164.58.29
-180.164.63.94
+180.165.226.147
  180.165.229.156
  180.165.229.187
  180.166.114.14
-180.166.117.254
-180.166.184.66
-180.166.192.66
  180.166.206.162
  180.166.208.56
  180.166.220.177
  180.166.220.179
  180.166.228.228
-180.166.229.4
  180.167.101.162
  180.167.101.246
  180.167.126.126
+180.167.16.162
  180.167.168.2
  180.167.180.46
-180.167.195.167
  180.167.195.218
  180.167.201.243
  180.167.207.234
@@ -62449,7 +58538,6 @@
  180.168.5.114
  180.168.76.230
  180.168.87.50
-180.168.95.234
  180.169.12.205
  180.169.129.78
  180.169.166.87
@@ -62467,12 +58555,12 @@
  180.169.32.52
  180.169.52.242
  180.173.180.239
+180.174.165.118
  180.174.250.255
  180.175.199.165
  180.175.247.97
  180.175.72.149
  180.175.74.217
-180.175.81.19
  180.175.87.64
  180.176.128.88
  180.176.149.2
@@ -62487,6 +58575,7 @@
  180.176.168.121
  180.176.168.177
  180.176.168.3
+180.176.169.32
  180.176.177.225
  180.176.177.31
  180.176.177.77
@@ -62512,6 +58601,7 @@
  180.177.117.142
  180.177.128.163
  180.177.129.217
+180.177.131.38
  180.177.181.241
  180.177.187.171
  180.177.187.217
@@ -62536,6 +58626,7 @@
  180.178.134.162
  180.178.135.98
  180.178.37.186
+180.178.50.243
  180.178.63.10
  180.178.97.90
  180.179.98.22
@@ -62543,7 +58634,6 @@
  180.180.102.180
  180.180.102.211
  180.180.104.133
-180.180.110.43
  180.180.112.186
  180.180.114.48
  180.180.119.40
@@ -62574,13 +58664,13 @@
  180.180.190.237
  180.180.194.102
  180.180.216.177
+180.180.217.212
  180.180.218.12
  180.180.235.188
  180.180.241.93
  180.180.38.93
  180.180.56.9
  180.180.57.116
-180.180.58.15
  180.180.58.239
  180.180.61.72
  180.180.7.201
@@ -62653,25 +58743,24 @@
  180.182.245.95
  180.182.47.132
  180.183.0.192
-180.183.1.20
-180.183.117.35
+180.183.116.205
  180.183.123.39
  180.183.139.12
+180.183.152.197
  180.183.156.253
  180.183.180.18
  180.183.2.245
  180.183.226.17
  180.183.229.125
-180.183.244.34
  180.183.245.130
-180.183.247.201
  180.183.249.183
+180.183.251.242
  180.183.3.74
  180.183.4.128
  180.183.44.213
-180.183.5.239
  180.183.5.244
  180.183.5.252
+180.183.5.57
  180.183.5.7
  180.183.70.165
  180.183.8.196
@@ -62856,11 +58945,8 @@
  180.190.118.71
  180.190.243.7
  180.191.158.14
-180.191.158.157
  180.191.159.4
-180.196.120.141
  180.198.30.58
-180.208.58.145
  180.210.201.54
  180.210.201.57
  180.210.205.53
@@ -62920,7 +59006,6 @@
  180.211.92.42
  180.211.95.234
  180.211.97.204
-180.213.2.236
  180.213.4.122
  180.214.148.44
  180.214.153.56
@@ -62928,6 +59013,7 @@
  180.214.236.156
  180.214.236.211
  180.214.236.98
+180.214.237.130
  180.214.237.99
  180.214.238.5
  180.214.238.75
@@ -62937,13 +59023,12 @@
  180.214.239.19
  180.214.239.223
  180.214.239.54
-180.215.196.95
  180.215.203.121
  180.215.204.155
  180.215.207.155
  180.215.214.77
  180.215.214.88
-180.215.226.143
+180.215.221.210
  180.215.227.16
  180.215.227.32
  180.216.157.217
@@ -62953,6 +59038,7 @@
  180.218.162.78
  180.218.164.132
  180.218.224.190
+180.218.242.11
  180.218.5.171
  180.218.96.231
  180.218.96.40
@@ -62965,7 +59051,6 @@
  180.226.9.101
  180.228.38.207
  180.230.42.137
-180.231.11.182
  180.231.110.87
  180.231.149.99
  180.232.123.251
@@ -62977,7 +59062,6 @@
  180.233.215.80
  180.233.216.253
  180.233.221.63
-180.233.231.83
  180.233.242.169
  180.234.83.202
  180.235.131.131
@@ -62990,8 +59074,6 @@
  180.241.208.84
  180.241.219.55
  180.241.75.230
-180.241.76.133
-180.242.13.165
  180.242.152.33
  180.242.161.47
  180.242.180.19
@@ -63002,10 +59084,7 @@
  180.242.186.66
  180.243.12.13
  180.243.167.26
-180.244.14.214
-180.244.188.149
  180.244.23.246
-180.244.232.190
  180.244.234.211
  180.244.74.53
  180.245.192.129
@@ -63018,11 +59097,14 @@
  180.246.205.208
  180.246.209.14
  180.246.209.90
+180.246.245.242
  180.246.28.155
+180.246.67.198
  180.246.94.151
+180.247.1.108
+180.247.156.153
  180.247.202.134
-180.248.118.65
-180.248.130.237
+180.248.175.30
  180.248.2.246
  180.248.228.198
  180.248.242.204
@@ -63033,7 +59115,6 @@
  180.249.6.66
  180.249.8.236
  180.25.1.243
-180.250.108.133
  180.250.115.121
  180.250.12.10
  180.250.124.227
@@ -63064,20 +59145,20 @@
  180.251.106.191
  180.251.116.198
  180.251.146.136
-180.251.162.200
+180.251.150.106
  180.251.229.197
-180.252.237.227
  180.253.127.48
  180.253.138.182
  180.253.147.182
  180.253.161.94
-180.253.162.188
  180.253.162.215
-180.253.162.244
+180.253.163.167
  180.253.164.175
  180.253.164.94
  180.253.165.34
  180.253.166.135
+180.253.66.8
+180.253.98.105
  180.254.12.125
  180.254.34.139
  180.254.37.199
@@ -63086,6 +59167,7 @@
  180.30.219.22
  180.33.192.153
  180.38.10.172
+180.44.191.254
  180.45.115.159
  180.50.153.67
  180.51.32.36
@@ -63093,63 +59175,45 @@
  180.59.53.190
  180.6.238.175
  180.64.119.38
-180.64.214.48
-180.65.167.61
-180.66.207.67
+180.66.218.141
  180.68.251.67
  180.68.49.93
  180.68.88.11
  180.69.254.177
  180.69.27.217
-180.69.27.26
  180.70.141.10
  180.70.20.109
  180.70.54.135
  180.71.47.198
  180.71.58.134
-180.76.100.183
  180.76.101.165
-180.76.101.202
  180.76.101.229
  180.76.101.241
  180.76.101.244
-180.76.102.226
  180.76.103.247
-180.76.103.63
  180.76.104.101
-180.76.104.167
  180.76.105.165
  180.76.105.81
  180.76.106.175
  180.76.106.21
  180.76.106.65
  180.76.107.10
-180.76.108.118
-180.76.108.151
  180.76.108.66
  180.76.108.73
  180.76.109.16
  180.76.109.31
-180.76.110.70
  180.76.111.214
  180.76.111.242
-180.76.112.250
  180.76.114.145
  180.76.114.218
-180.76.114.61
  180.76.115.123
  180.76.115.226
  180.76.116.98
  180.76.118.181
-180.76.119.34
  180.76.120.135
-180.76.121.28
  180.76.121.95
-180.76.124.123
  180.76.124.150
  180.76.124.173
-180.76.124.20
-180.76.124.21
  180.76.125.161
  180.76.133.173
  180.76.134.238
@@ -63160,7 +59224,6 @@
  180.76.138.132
  180.76.139.101
  180.76.140.184
-180.76.141.184
  180.76.141.221
  180.76.141.248
  180.76.141.81
@@ -63169,9 +59232,7 @@
  180.76.142.69
  180.76.143.116
  180.76.144.99
-180.76.145.64
  180.76.146.229
-180.76.146.54
  180.76.146.60
  180.76.147.183
  180.76.147.221
@@ -63179,7 +59240,6 @@
  180.76.148.87
  180.76.149.7
  180.76.150.17
-180.76.150.238
  180.76.151.189
  180.76.151.90
  180.76.152.157
@@ -63197,9 +59257,6 @@
  180.76.160.148
  180.76.160.35
  180.76.161.41
-180.76.161.77
-180.76.162.19
-180.76.163.31
  180.76.163.33
  180.76.163.4
  180.76.163.86
@@ -63209,17 +59266,12 @@
  180.76.167.16
  180.76.167.221
  180.76.168.54
-180.76.169.192
  180.76.169.198
  180.76.171.110
  180.76.171.230
  180.76.171.57
  180.76.172.103
  180.76.172.202
-180.76.172.227
-180.76.173.75
-180.76.174.197
-180.76.174.246
  180.76.174.39
  180.76.174.59
  180.76.174.95
@@ -63228,29 +59280,21 @@
  180.76.175.211
  180.76.176.126
  180.76.176.223
-180.76.177.130
  180.76.177.194
-180.76.177.2
  180.76.177.217
-180.76.177.237
  180.76.178.46
  180.76.179.213
-180.76.179.43
  180.76.179.67
  180.76.180.140
  180.76.180.231
-180.76.181.115
  180.76.181.152
  180.76.181.47
  180.76.182.139
  180.76.182.238
-180.76.182.56
-180.76.183.191
  180.76.183.218
  180.76.183.245
  180.76.184.50
  180.76.185.121
-180.76.185.25
  180.76.186.109
  180.76.187.216
  180.76.188.4
@@ -63258,7 +59302,6 @@
  180.76.188.98
  180.76.189.196
  180.76.189.220
-180.76.190.221
  180.76.190.251
  180.76.228.68
  180.76.229.245
@@ -63267,9 +59310,7 @@
  180.76.230.211
  180.76.232.66
  180.76.234.185
-180.76.234.206
  180.76.236.65
-180.76.237.54
  180.76.238.128
  180.76.238.183
  180.76.238.69
@@ -63280,7 +59321,6 @@
  180.76.242.204
  180.76.242.233
  180.76.245.228
-180.76.246.194
  180.76.246.205
  180.76.246.38
  180.76.247.16
@@ -63290,8 +59330,6 @@
  180.76.248.85
  180.76.249.74
  180.76.250.18
-180.76.37.36
-180.76.39.103
  180.76.51.143
  180.76.51.53
  180.76.53.100
@@ -63304,8 +59342,6 @@
  180.76.54.25
  180.76.54.251
  180.76.54.33
-180.76.54.86
-180.76.55.119
  180.76.56.128
  180.76.56.29
  180.76.56.69
@@ -63316,16 +59352,15 @@
  180.76.60.6
  180.76.96.55
  180.76.97.180
-180.76.97.9
  180.76.98.151
  180.76.98.157
  180.76.98.236
-180.76.98.239
  180.76.98.66
  180.76.98.71
  180.76.98.99
  180.83.132.133
  180.83.232.246
+180.83.81.230
  180.87.195.22
  180.89.58.27
  180.92.132.242
@@ -63346,7 +59381,6 @@
  180.95.220.72
  180.96.11.20
  180.96.62.129
-180.96.62.247
  180.96.63.162
  180.97.182.111
  180.97.182.226
@@ -63370,7 +59404,6 @@
  180.97.204.239
  180.97.207.221
  180.97.220.252
-180.97.220.42
  180.97.30.188
  180.97.30.208
  180.97.31.201
@@ -63401,31 +59434,30 @@
  181.1.29.120
  181.10.129.85
  181.10.18.188
-181.10.199.162
  181.10.204.106
  181.10.210.99
  181.10.250.146
  181.10.45.170
  181.101.10.87
  181.101.104.133
-181.101.104.159
  181.101.104.203
  181.101.104.216
  181.101.107.130
  181.101.107.85
-181.101.109.120
  181.101.113.173
+181.101.113.197
  181.101.115.158
  181.101.116.30
  181.101.117.123
  181.101.119.16
  181.101.121.234
+181.101.122.231
+181.101.125.199
  181.101.126.124
-181.101.126.144
  181.101.126.207
  181.101.127.173
-181.101.2.185
  181.101.20.108
+181.101.22.27
  181.101.25.96
  181.101.28.91
  181.101.3.98
@@ -63436,15 +59468,15 @@
  181.101.56.61
  181.101.6.253
  181.101.63.204
-181.101.80.119
  181.101.81.217
  181.101.83.59
  181.101.84.169
+181.101.91.1
  181.101.91.48
+181.101.95.215
  181.101.96.183
  181.101.97.39
  181.101.99.10
-181.101.99.124
  181.102.0.196
  181.102.10.10
  181.102.10.251
@@ -63455,12 +59487,10 @@
  181.102.112.86
  181.102.116.21
  181.102.116.39
-181.102.118.55
+181.102.121.122
  181.102.122.14
  181.102.124.135
  181.102.126.134
-181.102.129.106
-181.102.129.7
  181.102.132.151
  181.102.135.10
  181.102.136.192
@@ -63468,20 +59498,14 @@
  181.102.14.241
  181.102.141.144
  181.102.143.50
-181.102.145.129
  181.102.147.142
-181.102.147.178
  181.102.148.87
  181.102.150.185
  181.102.152.173
  181.102.156.251
  181.102.158.53
-181.102.159.117
-181.102.16.58
-181.102.161.53
  181.102.164.193
  181.102.164.31
-181.102.164.43
  181.102.17.118
  181.102.203.11
  181.102.25.24
@@ -63491,34 +59515,39 @@
  181.102.30.224
  181.102.30.236
  181.102.30.90
-181.102.35.225
+181.102.36.36
  181.102.38.33
+181.102.39.102
  181.102.44.205
  181.102.45.144
-181.102.48.128
-181.102.49.211
+181.102.46.188
  181.102.51.163
+181.102.54.2
  181.102.57.46
  181.102.64.241
  181.102.66.31
  181.102.67.7
  181.102.70.201
-181.102.72.93
  181.102.73.107
  181.102.73.3
+181.102.74.200
  181.102.77.117
+181.102.79.75
  181.102.8.37
+181.102.80.247
  181.102.81.53
-181.102.82.119
-181.102.82.159
+181.102.82.157
  181.102.89.32
  181.102.9.100
  181.102.90.7
+181.102.92.141
  181.102.93.121
+181.102.93.203
+181.102.94.189
+181.102.95.176
  181.102.95.220
  181.102.96.79
  181.106.192.245
-181.106.192.37
  181.106.194.87
  181.106.196.22
  181.106.197.181
@@ -63528,7 +59557,7 @@
  181.106.201.244
  181.106.201.55
  181.106.205.84
-181.106.209.33
+181.106.206.58
  181.106.211.28
  181.106.212.225
  181.106.214.147
@@ -63544,24 +59573,20 @@
  181.106.222.20
  181.106.223.34
  181.106.224.161
-181.106.226.157
  181.106.230.219
  181.106.231.132
  181.106.231.183
  181.106.232.102
  181.106.233.183
+181.106.234.119
  181.106.234.212
  181.106.236.194
-181.106.237.138
-181.106.237.250
  181.106.242.218
  181.106.242.234
  181.106.243.31
  181.106.244.83
-181.106.246.34
  181.106.251.170
  181.106.252.213
-181.106.254.68
  181.110.95.54
  181.111.181.50
  181.111.60.13
@@ -63579,7 +59604,6 @@
  181.112.55.130
  181.112.57.2
  181.112.57.62
-181.112.85.144
  181.113.114.90
  181.113.121.158
  181.113.135.214
@@ -63598,9 +59622,7 @@
  181.113.67.54
  181.114.101.78
  181.114.132.202
-181.114.154.58
  181.114.208.150
-181.114.208.48
  181.114.212.131
  181.114.56.98
  181.114.99.237
@@ -63608,10 +59630,10 @@
  181.115.156.59
  181.115.168.69
  181.115.183.130
+181.115.204.74
  181.115.242.114
  181.115.38.146
  181.116.50.170
-181.117.117.238
  181.117.141.222
  181.117.197.34
  181.117.202.5
@@ -63623,25 +59645,19 @@
  181.118.126.110
  181.118.177.191
  181.118.45.216
-181.118.94.57
  181.119.169.87
  181.119.20.201
  181.119.27.62
  181.119.30.26
  181.120.130.31
  181.120.218.241
-181.120.225.246
-181.120.246.83
  181.120.29.49
-181.121.134.55
  181.121.72.54
  181.123.12.241
  181.123.12.89
-181.123.177.150
  181.123.216.165
  181.123.36.39
  181.123.6.86
-181.123.9.3
  181.124.32.162
  181.124.39.223
  181.126.201.255
@@ -63655,8 +59671,6 @@
  181.129.14.218
  181.129.144.59
  181.129.147.27
-181.129.161.28
-181.129.161.29
  181.129.162.132
  181.129.162.133
  181.129.165.139
@@ -63735,6 +59749,7 @@
  181.164.237.201
  181.164.95.113
  181.165.161.171
+181.165.179.225
  181.165.200.185
  181.165.68.127
  181.166.106.224
@@ -63742,8 +59757,6 @@
  181.166.134.205
  181.166.215.148
  181.166.229.163
-181.166.87.8
-181.167.1.152
  181.167.12.178
  181.167.156.204
  181.167.243.89
@@ -63754,26 +59767,22 @@
  181.169.225.172
  181.169.235.110
  181.169.37.247
-181.169.82.156
+181.170.141.214
  181.170.162.205
  181.170.167.227
-181.170.195.192
  181.170.47.113
  181.170.71.133
  181.171.172.147
  181.171.188.229
  181.171.238.143
-181.171.36.86
-181.171.37.100
  181.174.100.66
  181.174.102.239
-181.174.144.93
  181.174.166.112
  181.174.166.113
  181.174.166.9
+181.174.183.32
  181.174.194.62
  181.174.55.16
-181.174.84.69
  181.174.91.162
  181.175.10.233
  181.175.102.164
@@ -63781,7 +59790,6 @@
  181.175.105.43
  181.175.106.177
  181.175.106.21
-181.175.12.202
  181.175.120.63
  181.175.122.85
  181.175.134.60
@@ -63793,46 +59801,40 @@
  181.175.215.24
  181.175.24.143
  181.175.249.252
-181.175.28.213
  181.175.48.101
  181.175.50.181
  181.175.51.198
-181.175.52.21
  181.175.52.3
-181.175.52.92
  181.175.64.255
  181.175.66.244
  181.175.69.84
  181.175.86.217
  181.175.86.252
  181.175.96.110
-181.175.96.192
-181.175.97.44
  181.176.160.66
  181.176.161.19
  181.176.164.179
-181.176.165.209
  181.176.182.194
  181.176.182.227
  181.176.242.168
-181.177.111.106
-181.177.111.15
-181.177.111.16
+181.177.111.137
+181.177.111.156
  181.177.111.160
  181.177.111.185
  181.177.111.19
  181.177.111.197
-181.177.111.213
+181.177.111.198
+181.177.111.201
  181.177.111.248
  181.177.111.49
  181.177.111.52
-181.177.111.60
-181.177.111.69
  181.177.111.88
+181.177.111.9
  181.177.112.114
  181.177.112.138
  181.177.112.143
  181.177.112.158
+181.177.112.186
  181.177.112.32
  181.177.112.56
  181.177.112.65
@@ -63848,11 +59850,8 @@
  181.188.156.58
  181.188.166.74
  181.188.171.55
-181.188.19.17
  181.189.144.206
-181.189.221.209
  181.189.221.245
-181.189.222.20
  181.189.224.122
  181.189.234.66
  181.189.235.134
@@ -63860,22 +59859,15 @@
  181.191.213.90
  181.191.215.174
  181.191.241.14
-181.191.241.6
-181.191.4.114
  181.191.4.25
  181.191.55.242
  181.191.82.196bin.sh
  181.191.85.114
  181.192.19.238
-181.192.26.193
  181.193.45.179
  181.193.45.180
  181.193.48.228
-181.194.193.111
  181.194.224.192
-181.196.0.54
-181.196.1.148
-181.196.145.106
  181.196.177.30
  181.196.181.146
  181.196.205.250
@@ -63886,7 +59878,6 @@
  181.196.246.74
  181.196.247.142
  181.196.254.202
-181.196.27.18
  181.196.57.150
  181.196.57.230
  181.197.10.157
@@ -63896,12 +59887,9 @@
  181.198.182.19
  181.198.2.22
  181.198.203.45
-181.198.252.236
  181.198.42.229
  181.198.61.195
-181.198.65.147
  181.198.91.203
-181.198.97.241
  181.199.146.216
  181.199.162.40
  181.199.163.111
@@ -63924,15 +59912,13 @@
  181.208.213.96
  181.208.241.159
  181.208.33.43
-181.208.57.185
  181.209.134.138
  181.209.159.166
+181.209.188.60
  181.209.71.22
  181.209.75.66
  181.209.82.154
  181.209.86.130
-181.209.87.50
-181.209.9.249
  181.209.91.154
  181.209.97.226
  181.211.101.90
@@ -63944,7 +59930,6 @@
  181.211.244.126
  181.211.244.66
  181.211.246.18
-181.211.252.74
  181.211.36.98
  181.211.38.62
  181.211.6.34
@@ -63961,7 +59946,6 @@
  181.214.92.100
  181.215.114.160
  181.215.14.149
-181.215.157.137
  181.215.18.39
  181.215.18.46
  181.215.215.2
@@ -63977,10 +59961,8 @@
  181.224.161.168
  181.224.161.173
  181.224.228.186
-181.224.250.93
  181.225.107.43
  181.225.157.57
-181.225.198.215
  181.225.3.64
  181.225.44.26
  181.225.65.106
@@ -63991,21 +59973,16 @@
  181.226.156.197
  181.226.176.227
  181.226.41.20
-181.228.140.207
  181.228.231.133
  181.228.55.57
-181.228.80.244
  181.229.183.116
  181.229.203.83
-181.229.215.199
-181.229.217.221
  181.230.113.191
  181.231.212.232
  181.231.220.232
  181.231.40.8
  181.231.68.51
-181.234.146.116
-181.236.168.109
+181.234.3.237
  181.236.183.88
  181.236.221.138
  181.236.224.4
@@ -64019,26 +59996,26 @@
  181.25.237.97
  181.27.203.50
  181.28.101.14
-181.29.74.171
-181.3.101.183
  181.3.102.202
  181.3.103.130
+181.3.105.105
  181.3.105.113
-181.3.105.125
  181.3.105.164
  181.3.106.134
-181.3.108.139
+181.3.106.92
  181.3.108.34
  181.3.11.152
  181.3.111.151
  181.3.112.153
-181.3.112.228
  181.3.113.160
+181.3.116.79
  181.3.120.221
  181.3.120.230
  181.3.120.42
+181.3.120.56
  181.3.121.102
  181.3.121.236
+181.3.121.88
  181.3.122.107
  181.3.122.185
  181.3.122.93
@@ -64046,7 +60023,6 @@
  181.3.124.85
  181.3.124.95
  181.3.125.22
-181.3.126.214
  181.3.127.153
  181.3.128.181
  181.3.129.141
@@ -64056,29 +60032,32 @@
  181.3.129.74
  181.3.130.13
  181.3.130.198
-181.3.135.65
-181.3.139.197
+181.3.131.197
+181.3.133.79
+181.3.135.116
  181.3.139.54
  181.3.14.95
  181.3.143.9
  181.3.144.16
  181.3.145.131
  181.3.145.211
+181.3.148.254
  181.3.149.245
-181.3.149.75
-181.3.150.178
+181.3.150.58
  181.3.150.6
+181.3.150.9
  181.3.151.101
  181.3.152.143
  181.3.152.97
  181.3.153.110
+181.3.154.16
  181.3.156.231
-181.3.156.49
  181.3.157.210
+181.3.158.8
+181.3.159.178
  181.3.16.179
  181.3.162.201
  181.3.163.229
-181.3.165.132
  181.3.166.20
  181.3.166.52
  181.3.167.90
@@ -64086,52 +60065,42 @@
  181.3.169.221
  181.3.17.123
  181.3.17.197
+181.3.17.76
  181.3.170.147
  181.3.171.58
  181.3.171.6
  181.3.172.154
  181.3.172.172
  181.3.172.212
-181.3.172.78
  181.3.173.77
  181.3.174.225
  181.3.175.175
-181.3.175.226
+181.3.175.22
+181.3.175.73
  181.3.177.102
-181.3.177.146
  181.3.177.211
-181.3.179.129
-181.3.181.126
-181.3.181.190
+181.3.178.62
+181.3.179.219
  181.3.181.40
-181.3.182.110
-181.3.183.96
  181.3.184.233
  181.3.185.14
  181.3.186.158
-181.3.187.109
-181.3.188.193
  181.3.188.43
  181.3.189.62
  181.3.191.211
-181.3.191.27
-181.3.191.64
+181.3.191.236
+181.3.192.27
  181.3.193.193
  181.3.194.154
-181.3.194.8
  181.3.196.153
  181.3.199.12
  181.3.20.172
  181.3.202.237
  181.3.202.77
  181.3.204.192
-181.3.206.226
  181.3.206.29
-181.3.208.132
-181.3.209.236
  181.3.210.218
  181.3.215.173
-181.3.215.44
  181.3.216.61
  181.3.217.123
  181.3.218.111
@@ -64145,35 +60114,32 @@
  181.3.224.250
  181.3.225.173
  181.3.225.226
-181.3.226.109
  181.3.227.4
  181.3.229.176
-181.3.231.50
  181.3.232.167
  181.3.232.175
  181.3.233.215
-181.3.237.228
-181.3.237.4
  181.3.238.106
+181.3.238.245
  181.3.238.26
  181.3.239.101
  181.3.240.110
+181.3.241.124
  181.3.241.68
+181.3.242.149
  181.3.242.21
-181.3.243.53
  181.3.245.126
-181.3.245.214
  181.3.245.250
  181.3.247.228
  181.3.248.5
  181.3.248.81
  181.3.249.102
+181.3.249.195
+181.3.249.34
  181.3.250.75
+181.3.251.2
  181.3.252.28
-181.3.3.106
-181.3.4.248
  181.3.5.74
-181.3.5.93
  181.3.6.138
  181.3.67.232
  181.3.69.204
@@ -64183,8 +60149,6 @@
  181.3.7.26
  181.3.72.127
  181.3.73.24
-181.3.74.52
-181.3.74.59
  181.3.75.91
  181.3.76.125
  181.3.76.24
@@ -64193,39 +60157,36 @@
  181.3.77.225
  181.3.78.149
  181.3.82.99
+181.3.83.16
  181.3.84.27
  181.3.84.89
  181.3.86.245
-181.3.87.50
+181.3.86.55
+181.3.88.100
+181.3.89.250
  181.3.89.80
  181.3.9.165
+181.3.90.201
+181.3.90.94
+181.3.94.141
  181.3.94.18
  181.3.94.217
  181.3.95.236
-181.3.96.22
  181.3.96.82
-181.3.97.123
  181.3.97.251
-181.3.98.28
-181.3.98.63
  181.3.99.199
  181.3.99.39
-181.3.99.44
  181.30.101.242
  181.30.126.66
  181.30.169.222
-181.30.28.120
  181.30.28.174
  181.30.28.198
  181.30.28.201
  181.30.28.22
  181.30.28.51
-181.30.28.58
-181.30.28.59
  181.30.28.73
  181.30.28.83
  181.30.30.166
-181.30.31.39
  181.30.61.163
  181.30.69.50
  181.30.8.146
@@ -64234,7 +60195,6 @@
  181.31.51.181
  181.36.42.205
  181.39.135.122
-181.39.233.187
  181.39.32.99
  181.4.0.226
  181.4.1.72
@@ -64242,32 +60202,26 @@
  181.4.10.231
  181.4.11.173
  181.4.11.179
+181.4.11.99
  181.4.12.249
  181.4.12.60
-181.4.15.157
  181.4.15.67
  181.4.16.107
-181.4.16.109
-181.4.17.31
  181.4.18.106
  181.4.21.34
-181.4.23.124
-181.4.23.32
  181.4.24.123
-181.4.25.160
  181.4.25.227
  181.4.26.10
+181.4.26.149
  181.4.26.78
  181.4.27.223
  181.4.27.42
+181.4.28.116
  181.4.28.62
-181.4.29.8
-181.4.3.233
-181.4.3.33
  181.4.3.67
  181.4.30.223
  181.4.31.43
-181.4.31.9
+181.4.31.45
  181.4.33.127
  181.4.35.50
  181.4.36.189
@@ -64277,22 +60231,22 @@
  181.4.40.196
  181.4.40.65
  181.4.42.200
-181.4.44.186
  181.4.45.180
  181.4.46.23
-181.4.46.52
  181.4.46.96
  181.4.47.103
  181.4.47.240
-181.4.49.219
  181.4.52.12
  181.4.52.99
-181.4.55.170
+181.4.55.236
+181.4.57.164
  181.4.57.230
  181.4.58.227
  181.4.59.184
  181.4.6.19
+181.4.60.72
  181.4.63.90
+181.4.64.119
  181.4.65.205
  181.4.65.235
  181.4.66.161
@@ -64303,18 +60257,16 @@
  181.4.69.253
  181.4.7.119
  181.4.7.42
-181.4.7.45
  181.4.7.98
  181.4.72.109
  181.4.72.22
-181.4.73.124
  181.4.73.253
  181.4.77.1
-181.4.77.110
  181.4.77.246
  181.4.78.97
  181.4.83.189
  181.4.83.211
+181.4.85.194
  181.4.85.94
  181.4.9.131
  181.40.116.150
@@ -64324,27 +60276,19 @@
  181.40.73.86
  181.40.84.38
  181.40.84.50
-181.41.235.207
  181.41.80.40
  181.43.111.52
  181.44.6.160
  181.45.136.144
-181.46.138.70
-181.46.78.110
+181.45.191.64
  181.47.113.213
-181.47.196.85
-181.47.90.217
  181.48.105.6
-181.48.111.246
-181.48.114.82
-181.48.120.219
  181.48.120.220
-181.48.134.65
  181.48.134.66
  181.48.134.70
-181.48.138.242
  181.48.139.118
  181.48.14.154
+181.48.145.28
  181.48.15.227
  181.48.155.149
  181.48.18.130
@@ -64369,11 +60313,9 @@
  181.49.154.26
  181.49.157.10
  181.49.175.91
-181.49.214.43
  181.49.236.4
  181.49.236.46
  181.49.246.20
-181.49.254.230
  181.49.254.238
  181.49.38.43
  181.49.42.30
@@ -64387,19 +60329,14 @@
  181.50.99.8
  181.51.40.110
  181.52.121.54
-181.52.172.107
  181.52.223.52
  181.52.237.106
-181.52.249.177
  181.52.249.181
  181.52.249.213
  181.52.85.249
  181.53.251.181
  181.53.251.199
-181.55.123.14
-181.55.188.218
  181.55.95.52
-181.56.9.15
  181.57.151.214
  181.57.167.193
  181.57.168.174
@@ -64418,39 +60355,44 @@
  181.6.10.104
  181.6.10.205
  181.6.10.247
-181.6.102.231
  181.6.105.208
+181.6.106.23
+181.6.107.209
+181.6.107.252
  181.6.108.242
  181.6.109.167
  181.6.11.40
  181.6.110.112
+181.6.111.180
  181.6.111.217
  181.6.112.15
  181.6.112.216
  181.6.114.20
-181.6.116.78
  181.6.117.77
  181.6.121.77
+181.6.125.45
  181.6.126.129
  181.6.130.61
  181.6.133.168
+181.6.134.29
  181.6.135.156
  181.6.136.169
+181.6.139.199
  181.6.140.142
  181.6.142.134
  181.6.142.138
  181.6.143.204
+181.6.145.154
  181.6.148.28
  181.6.149.4
-181.6.15.10
-181.6.15.140
-181.6.152.118
+181.6.152.160
  181.6.152.6
+181.6.152.77
  181.6.153.129
+181.6.156.114
  181.6.157.54
  181.6.158.124
  181.6.158.14
-181.6.160.42
  181.6.163.175
  181.6.166.163
  181.6.167.210
@@ -64470,18 +60412,20 @@
  181.6.193.170
  181.6.193.174
  181.6.195.179
+181.6.196.181
  181.6.20.129
  181.6.20.159
  181.6.200.154
+181.6.200.98
  181.6.201.214
-181.6.202.121
  181.6.202.93
  181.6.203.49
  181.6.207.212
-181.6.207.23
  181.6.208.116
  181.6.209.147
+181.6.211.193
  181.6.215.101
+181.6.217.233
  181.6.217.234
  181.6.218.177
  181.6.219.222
@@ -64489,28 +60433,28 @@
  181.6.219.81
  181.6.22.106
  181.6.22.145
+181.6.221.126
  181.6.221.21
  181.6.224.3
-181.6.23.121
-181.6.230.141
+181.6.233.7
  181.6.237.214
  181.6.242.33
  181.6.243.166
  181.6.244.199
+181.6.250.63
  181.6.254.159
+181.6.254.179
+181.6.254.195
  181.6.254.9
  181.6.255.115
  181.6.26.209
-181.6.3.235
+181.6.30.100
  181.6.31.137
  181.6.31.17
-181.6.32.136
-181.6.32.170
  181.6.33.82
  181.6.4.231
  181.6.40.181
  181.6.41.149
-181.6.42.203
  181.6.46.101
  181.6.49.134
  181.6.50.105
@@ -64518,10 +60462,9 @@
  181.6.63.150
  181.6.7.183
  181.6.70.155
-181.6.75.5
-181.6.76.150
-181.6.8.82
  181.6.80.98
+181.6.82.178
+181.6.85.205
  181.6.85.99
  181.6.86.57
  181.6.87.225
@@ -64535,11 +60478,8 @@
  181.6.99.244
  181.60.79.253
  181.61.182.143
-181.62.161.245
  181.62.245.247
-181.62.248.12
  181.63.248.149
-181.64.146.106
  181.64.160.234
  181.64.192.59
  181.65.138.218
@@ -64547,15 +60487,14 @@
  181.65.142.125
  181.65.155.20
  181.65.157.134
-181.65.252.10
+181.66.102.211
  181.66.130.211
  181.72.201.229
  181.73.4.137
-181.78.0.45
-181.82.231.217
  181.82.233.72
  181.82.238.28
  181.83.229.120
+181.83.231.119
  181.83.238.221
  181.84.20.129
  181.88.176.122
@@ -64576,135 +60515,127 @@
  182.101.134.168
  182.101.207.11
  182.101.207.128
-182.103.24.178
-182.105.156.19
  182.106.87.52
  182.107.123.205
  182.107.177.83
-182.108.7.122
  182.110.126.79
  182.110.127.89
  182.110.15.51
  182.111.103.92
  182.111.148.38
+182.111.151.29
  182.111.153.177
  182.111.24.105
  182.111.24.203
  182.112.13.21
  182.112.146.176
-182.112.15.100
-182.112.15.11
  182.112.156.163
  182.112.16.174
  182.112.177.193
-182.112.18.176
-182.112.19.52
-182.112.20.178
+182.112.18.192
+182.112.22.25
  182.112.23.103
  182.112.23.206
+182.112.24.118
+182.112.24.136
  182.112.24.85
  182.112.243.128
-182.112.25.238
+182.112.25.139
  182.112.26.166
-182.112.3.212
+182.112.26.240
  182.112.30.127
  182.112.30.178
-182.112.31.50
  182.112.45.183
+182.112.48.133
  182.112.48.35
  182.112.49.89
-182.112.52.48
-182.112.52.65
  182.112.52.89
  182.112.54.181
-182.112.56.179
  182.112.57.111
  182.112.58.163
-182.112.61.226
+182.112.62.234
  182.112.62.252
  182.112.68.179
  182.112.78.243
  182.112.9.196
+182.113.0.82
  182.113.112.66
  182.113.114.33
  182.113.116.201
+182.113.14.21
  182.113.168.245
-182.113.17.140
  182.113.171.130
+182.113.199.113
+182.113.201.160
+182.113.202.166
  182.113.203.75
-182.113.204.45
-182.113.205.21
-182.113.208.94
-182.113.211.137
+182.113.207.197
  182.113.211.248
-182.113.214.11
-182.113.215.159
+182.113.213.152
  182.113.215.240
  182.113.218.184
  182.113.219.179
-182.113.22.194
+182.113.220.20
+182.113.223.156
  182.113.228.239
-182.113.229.101
  182.113.231.84
  182.113.234.199
-182.113.241.86
-182.113.244.58
-182.113.26.177
  182.113.28.127
+182.113.43.235
  182.113.43.246
+182.113.48.89
  182.113.58.37
  182.113.58.91
  182.113.98.18
-182.114.1.207
-182.114.102.0
-182.114.104.66
-182.114.120.30
-182.114.123.72
-182.114.124.194
-182.114.126.140
+182.114.100.195
+182.114.100.234
+182.114.122.27
+182.114.127.121
  182.114.127.134
  182.114.145.16
  182.114.146.132
  182.114.173.50
  182.114.18.6
+182.114.189.69
  182.114.2.249
+182.114.2.254
  182.114.20.91
-182.114.203.240
+182.114.204.162
  182.114.205.198
  182.114.208.219
-182.114.21.131
  182.114.22.151
  182.114.22.185
+182.114.22.233
  182.114.22.90
  182.114.23.164
-182.114.23.237
-182.114.247.218
-182.114.25.228
+182.114.25.8
  182.114.254.27
  182.114.254.79
+182.114.29.150
  182.114.3.212
  182.114.3.9
-182.114.57.50
+182.114.49.176
  182.114.64.33
  182.114.64.72
-182.114.69.206
  182.114.70.84
-182.114.82.103
+182.114.82.172
  182.114.87.123
-182.114.87.179
  182.114.87.2
  182.114.87.253
  182.114.88.208
  182.114.88.39
  182.114.90.158
+182.114.90.163
  182.114.91.122
+182.114.91.51
  182.114.91.87
  182.114.92.204
-182.114.98.138
-182.114.99.84
+182.114.93.40
+182.114.95.243
+182.115.151.14
+182.115.152.177
  182.115.161.11
-182.115.174.42
-182.115.185.35
+182.115.182.208
  182.115.194.78
  182.115.199.174
  182.115.199.21
@@ -64716,173 +60647,182 @@
  182.116.101.104
  182.116.101.36
  182.116.102.170
-182.116.102.20
-182.116.102.232
  182.116.102.75
  182.116.103.176
+182.116.103.178
  182.116.105.27
+182.116.106.13
  182.116.106.142
-182.116.106.175
  182.116.106.74
  182.116.108.16
-182.116.108.52
-182.116.109.174
  182.116.109.252
-182.116.110.109
  182.116.110.177
  182.116.111.230
  182.116.111.253
  182.116.111.3
+182.116.111.44
  182.116.111.82
+182.116.114.195
+182.116.114.41
  182.116.115.128
  182.116.115.15
  182.116.115.46
  182.116.115.78
-182.116.116.170
-182.116.118.182
-182.116.119.210
-182.116.161.88
+182.116.117.50
+182.116.32.40
  182.116.38.160
+182.116.39.252
  182.116.45.179
-182.116.45.194
-182.116.50.255
  182.116.61.43
  182.116.66.39
-182.116.68.236
  182.116.70.143
+182.116.70.222
+182.116.70.241
  182.116.70.60
-182.116.71.177
+182.116.71.181
  182.116.71.231
-182.116.74.196
+182.116.73.236
  182.116.74.217
-182.116.74.4
  182.116.75.126
-182.116.75.220
-182.116.78.11
+182.116.76.120
+182.116.76.51
  182.116.78.241
+182.116.78.246
+182.116.79.214
+182.116.79.242
  182.116.83.184
  182.116.95.140
  182.116.96.194
-182.116.97.188
+182.116.97.64
+182.116.97.67
  182.116.98.31
-182.116.99.42
+182.116.99.197
  182.116.99.66
  182.117.10.20
+182.117.100.136
  182.117.100.151
  182.117.101.168
  182.117.102.6
  182.117.103.176
  182.117.104.253
  182.117.105.200
-182.117.106.21
-182.117.106.80
-182.117.108.113
  182.117.108.181
  182.117.108.188
-182.117.110.215
  182.117.111.133
+182.117.111.145
  182.117.111.54
-182.117.111.98
+182.117.118.211
+182.117.122.150
  182.117.129.52
  182.117.130.204
  182.117.132.81
  182.117.133.106
-182.117.171.23
-182.117.179.75
-182.117.184.27
+182.117.152.156
+182.117.176.207
  182.117.207.206
  182.117.227.55
  182.117.230.78
-182.117.24.20
-182.117.24.99
  182.117.245.44
-182.117.26.120
-182.117.26.79
+182.117.26.102
  182.117.27.185
  182.117.27.218
  182.117.28.104
  182.117.29.102
  182.117.29.231
  182.117.29.66
+182.117.29.70
  182.117.29.80
  182.117.30.110
-182.117.30.168
+182.117.33.24
+182.117.40.192
  182.117.40.199
+182.117.40.213
  182.117.40.23
  182.117.41.103
  182.117.41.163
  182.117.41.199
-182.117.42.159
+182.117.41.223
  182.117.42.198
  182.117.42.52
-182.117.43.139
  182.117.43.233
-182.117.49.217
-182.117.51.185
+182.117.51.240
+182.117.65.104
+182.117.66.210
  182.117.66.233
-182.117.66.254
+182.117.66.74
  182.117.67.215
-182.117.67.4
  182.117.67.71
  182.117.69.169
+182.117.69.83
+182.117.70.171
+182.117.70.253
  182.117.71.196
-182.117.71.240
+182.117.71.216
  182.117.72.10
  182.117.72.124
  182.117.72.158
  182.117.72.171
  182.117.73.120
+182.117.73.143
+182.117.75.181
  182.117.75.235
+182.117.76.79
  182.117.77.103
  182.117.78.212
  182.117.78.39
  182.117.79.102
  182.117.79.115
+182.117.81.21
  182.117.81.68
-182.117.81.8
  182.117.82.131
+182.117.82.187
  182.117.83.88
  182.117.84.190
  182.117.85.50
-182.117.85.57
-182.117.86.254
+182.117.86.29
+182.117.86.58
  182.117.87.198
-182.117.89.236
+182.117.87.27
+182.117.87.48
+182.117.91.146
  182.117.91.214
  182.117.91.235
-182.117.92.112
+182.117.93.215
  182.117.93.42
+182.117.93.5
  182.117.94.187
  182.117.94.238
-182.117.94.99
  182.117.96.14
  182.117.96.178
-182.117.96.29
+182.117.96.199
+182.117.97.185
  182.117.98.201
  182.117.99.72
-182.118.134.255
+182.118.134.197
  182.118.135.39
-182.118.141.21
+182.118.173.170
  182.118.173.50
  182.118.174.46
  182.118.46.94
  182.119.0.204
+182.119.10.197
  182.119.10.210
  182.119.10.25
  182.119.10.28
  182.119.10.42
  182.119.102.136
+182.119.102.63
  182.119.102.93
+182.119.107.33
  182.119.12.199
  182.119.12.22
-182.119.120.88
+182.119.123.194
  182.119.123.2
  182.119.13.160
  182.119.13.240
  182.119.138.143
  182.119.14.124
  182.119.15.189
-182.119.15.233
  182.119.15.24
  182.119.160.219
  182.119.160.254
@@ -64892,23 +60832,20 @@
  182.119.163.61
  182.119.164.146
  182.119.164.247
-182.119.164.251
  182.119.165.100
-182.119.165.57
  182.119.166.30
+182.119.166.4
  182.119.167.121
  182.119.167.172
  182.119.167.175
  182.119.167.42
  182.119.17.205
+182.119.177.29
  182.119.179.199
  182.119.180.11
-182.119.182.250
  182.119.184.73
-182.119.185.106
-182.119.186.36
+182.119.187.77
  182.119.189.90
-182.119.191.105
  182.119.191.157
  182.119.20.35
  182.119.202.20
@@ -64916,325 +60853,313 @@
  182.119.205.123
  182.119.205.226
  182.119.206.88
-182.119.207.143
  182.119.207.145
  182.119.208.132
  182.119.210.156
-182.119.215.32
-182.119.215.62
  182.119.215.94
  182.119.218.133
  182.119.218.184
  182.119.219.132
-182.119.220.58
-182.119.221.83
-182.119.224.245
+182.119.224.49
+182.119.225.146
  182.119.227.65
-182.119.246.237
-182.119.248.242
-182.119.249.2
+182.119.248.121
+182.119.249.136
+182.119.249.157
  182.119.250.177
  182.119.251.11
  182.119.251.147
  182.119.251.182
  182.119.252.210
  182.119.253.121
-182.119.253.135
  182.119.254.16
+182.119.254.41
  182.119.255.126
  182.119.255.220
  182.119.255.28
  182.119.3.60
  182.119.32.89
-182.119.33.148
  182.119.35.126
+182.119.35.212
  182.119.47.254
  182.119.48.103
-182.119.48.63
  182.119.53.95
-182.119.54.125
-182.119.54.208
  182.119.58.36
  182.119.59.235
+182.119.59.32
  182.119.61.10
-182.119.61.123
-182.119.63.89
+182.119.7.167
  182.119.7.183
+182.119.78.1
  182.119.8.250
-182.119.81.42
+182.119.8.6
+182.119.84.249
+182.119.9.246
  182.119.9.51
  182.119.99.59
+182.120.120.39
  182.120.15.40
+182.120.151.187
  182.120.155.197
  182.120.157.211
  182.120.16.115
+182.120.167.199
  182.120.186.159
  182.120.32.210
  182.120.33.50
  182.120.36.28bin.sh
  182.120.37.133
  182.120.38.53
-182.120.38.63
  182.120.40.42
-182.120.46.194
  182.120.46.93
-182.120.48.19
+182.120.5.147
+182.120.50.233
+182.120.53.102
  182.120.53.110
-182.120.55.115
-182.120.56.115
-182.120.56.27
  182.120.56.97
-182.120.63.254
-182.120.7.144
+182.120.57.150
+182.120.60.146
+182.120.61.20
  182.120.80.226
  182.120.83.212
  182.121.103.160
-182.121.11.177
-182.121.11.247
+182.121.11.100
+182.121.115.192
  182.121.116.185
  182.121.117.246
  182.121.117.254
-182.121.121.18
-182.121.126.70
-182.121.128.217
+182.121.117.73
+182.121.119.132
+182.121.119.33
+182.121.12.13
+182.121.122.224
  182.121.128.42
-182.121.130.141
+182.121.129.201
+182.121.129.29
  182.121.130.181
-182.121.130.209
  182.121.131.14
-182.121.131.197
+182.121.132.224
  182.121.132.3
-182.121.147.156
+182.121.134.132
  182.121.150.209
+182.121.150.61
+182.121.151.69
+182.121.152.109
  182.121.154.184
+182.121.155.91
  182.121.157.170
  182.121.157.18
-182.121.158.172
-182.121.159.115
-182.121.161.136
-182.121.17.233
+182.121.162.238
  182.121.196.246
+182.121.202.207
+182.121.203.109
+182.121.203.21
  182.121.206.150
-182.121.206.214
-182.121.209.124
-182.121.209.6
+182.121.206.251
+182.121.211.199
  182.121.212.138
  182.121.214.241
-182.121.22.198
-182.121.225.35
-182.121.232.255
+182.121.214.33
+182.121.215.200
  182.121.238.175
+182.121.243.252
  182.121.248.31
  182.121.248.97
+182.121.249.87
  182.121.25.182
-182.121.27.208
+182.121.250.175
+182.121.29.126
  182.121.30.20
-182.121.34.212
+182.121.32.232
+182.121.33.15
+182.121.35.192
  182.121.40.208
+182.121.46.146
  182.121.47.107
-182.121.52.209
+182.121.47.144
+182.121.52.138
+182.121.65.128
  182.121.65.221
  182.121.66.219
  182.121.66.61
  182.121.68.136
-182.121.68.140
  182.121.70.15
  182.121.70.24
-182.121.80.241
+182.121.70.98
+182.121.76.160
+182.121.8.199
  182.121.81.165
-182.121.82.122
-182.121.82.151
-182.121.82.71
  182.121.83.66
-182.121.84.227
  182.121.85.120
-182.121.85.67
+182.121.85.79
  182.121.85.84
  182.121.85.85
+182.121.86.71
+182.121.87.71
  182.121.89.218
-182.121.9.133
-182.121.92.225
-182.121.93.136
-182.121.94.199
+182.121.91.12
+182.121.94.222
+182.121.95.114
+182.121.95.17
  182.121.95.53
-182.121.96.89
-182.121.98.110
+182.121.97.4
  182.122.117.37
-182.122.134.135
-182.122.15.133
+182.122.133.198
+182.122.137.175
  182.122.155.192
  182.122.156.218
  182.122.160.137
  182.122.172.171
-182.122.19.152
  182.122.200.114
-182.122.200.125
  182.122.217.17
-182.122.219.133
  182.122.219.16
  182.122.224.225
-182.122.226.143
  182.122.226.78
  182.122.249.8
  182.122.25.85
+182.122.250.6
  182.122.251.231bin.sh
-182.122.252.111
-182.122.252.239
+182.122.253.104
  182.122.255.55
  182.122.27.55
  182.122.27.62
-182.122.55.241
  182.122.56.237
-182.122.59.236
-182.122.6.99
-182.122.69.227
-182.122.73.247
  182.122.81.231
  182.122.82.167
  182.122.94.117
+182.122.95.128
  182.123.144.233
  182.123.145.188
-182.123.189.191
  182.123.196.54
-182.123.197.169
-182.123.198.41
+182.123.199.31
  182.123.208.105
  182.123.208.31
+182.123.208.94
  182.123.210.25
-182.123.211.108
-182.123.211.118
  182.123.211.164
  182.123.211.187
  182.123.211.242
  182.123.211.68
  182.123.214.172
-182.123.215.79
-182.123.242.40
+182.123.240.115
+182.123.244.114
  182.123.250.34
  182.123.251.182
+182.123.252.38
  182.123.255.226
-182.124.136.2
+182.124.131.96
+182.124.140.174
+182.124.142.119
  182.124.159.26
-182.124.162.148
  182.124.162.4
-182.124.166.2
+182.124.167.218
  182.124.17.7
-182.124.197.219
-182.124.203.97
+182.124.171.200
+182.124.214.11
  182.124.235.70
  182.124.237.248
  182.124.237.57
+182.124.41.210
  182.124.5.172
-182.124.62.120
-182.124.95.100
-182.126.100.55
+182.124.61.210
+182.124.77.141
+182.126.100.247
  182.126.101.41
-182.126.101.66
  182.126.101.85
  182.126.106.170
  182.126.113.107
-182.126.114.232
  182.126.114.251
-182.126.115.245
+182.126.116.7
+182.126.117.212
  182.126.118.102
  182.126.118.161
-182.126.118.198
  182.126.118.245
-182.126.119.123
-182.126.119.137
-182.126.119.197
  182.126.119.34
-182.126.120.29
-182.126.121.2
  182.126.124.233
  182.126.124.254
  182.126.125.182
+182.126.126.100
  182.126.126.253
+182.126.127.121
  182.126.127.51
  182.126.128.140
  182.126.166.12
-182.126.176.138
  182.126.177.181
+182.126.179.185
  182.126.192.172
-182.126.193.123
  182.126.193.96
  182.126.198.248
-182.126.213.211
  182.126.234.24
  182.126.235.12
+182.126.240.235
+182.126.241.124
  182.126.65.75
  182.126.69.180
  182.126.69.88
  182.126.71.233
-182.126.80.69
  182.126.82.123
-182.126.83.111
+182.126.82.240
+182.126.82.255
  182.126.83.132
-182.126.83.48
-182.126.84.82
+182.126.85.53
  182.126.86.117
-182.126.86.152
  182.126.87.129
-182.126.87.194
  182.126.88.88
  182.126.89.209
-182.126.89.48
-182.126.91.250
  182.126.92.34
-182.126.94.162
+182.126.92.40
+182.126.94.159
  182.126.94.189
-182.126.95.221
-182.126.97.96
+182.126.94.236
+182.126.95.159
  182.126.98.22
  182.127.102.64
-182.127.110.134
-182.127.113.31
-182.127.117.254
-182.127.120.106
  182.127.123.213
-182.127.128.62
+182.127.128.13
+182.127.131.215
  182.127.136.210
-182.127.136.250
-182.127.137.120
-182.127.137.151
  182.127.137.33
  182.127.137.42
-182.127.139.249
+182.127.139.147
+182.127.139.88
  182.127.152.142
  182.127.152.32
  182.127.152.42
+182.127.152.61
  182.127.155.174
  182.127.156.246
-182.127.164.67
  182.127.171.4
  182.127.179.126
  182.127.179.49
+182.127.180.43
+182.127.180.86
+182.127.182.91
+182.127.185.149
  182.127.185.157
-182.127.185.213
-182.127.185.29
-182.127.188.175
  182.127.188.182
-182.127.210.15
-182.127.211.195
+182.127.191.147
+182.127.20.117
+182.127.209.71
  182.127.212.208
+182.127.219.151
+182.127.220.128
  182.127.221.171
+182.127.25.105
+182.127.29.189
  182.127.29.87
+182.127.31.125
+182.127.33.249
+182.127.34.12
  182.127.35.122
  182.127.49.147
-182.127.71.101
+182.127.50.238
+182.127.66.46
+182.127.70.244
  182.127.73.212
-182.127.81.169
-182.127.81.249
  182.127.81.57
-182.127.87.117
-182.127.88.20
-182.127.92.177
+182.127.86.221
  182.127.92.78
-182.127.93.228
-182.127.96.194
  182.127.98.113
-182.127.99.160
-182.128.12.196
  182.129.148.178
  182.129.150.184
  182.129.181.11
@@ -65246,13 +61171,13 @@
  182.133.122.65
  182.133.138.226
  182.135.63.227
-182.135.64.12
  182.137.190.247
  182.138.137.34
  182.138.150.183
  182.138.191.238
  182.139.71.92
  182.139.87.103
+182.139.87.87
  182.140.138.172
  182.140.138.55
  182.140.138.98
@@ -65266,7 +61191,6 @@
  182.140.235.233
  182.140.235.246
  182.140.244.41
-182.141.184.154
  182.141.233.218
  182.142.112.88
  182.142.115.84
@@ -65274,6 +61198,7 @@
  182.145.110.181
  182.145.40.110
  182.145.43.15
+182.145.43.204
  182.146.158.92
  182.146.209.94
  182.148.106.131
@@ -65304,24 +61229,19 @@
  182.148.122.9
  182.148.13.171
  182.148.14.16
-182.148.92.114
  182.148.92.39
-182.148.93.43
  182.149.83.251
-182.150.191.178
  182.150.2.136
  182.150.2.153
  182.150.2.83
  182.150.20.11
-182.150.22.233
+182.150.251.90
  182.150.3.106
  182.150.3.63
-182.150.44.41
  182.150.45.153
  182.150.45.30
  182.150.57.34
  182.150.58.24
-182.151.15.175
  182.151.15.213
  182.151.16.46
  182.151.173.129
@@ -65330,13 +61250,12 @@
  182.151.204.23
  182.151.205.83
  182.151.214.28
+182.151.234.146
  182.151.28.254
  182.151.3.137
  182.151.32.144
  182.151.37.230
-182.151.41.208
-182.151.44.175
-182.151.58.230
+182.151.46.222
  182.155.149.145
  182.155.152.129
  182.155.153.190
@@ -65348,20 +61267,19 @@
  182.155.62.69
  182.155.63.109
  182.155.77.67
+182.155.79.72
  182.155.92.182
  182.155.96.45
  182.156.209.222
  182.156.213.183
-182.156.216.51
  182.156.229.90
  182.156.251.155
  182.16.10.90
  182.16.10.91
  182.16.10.94
-182.16.103.34
-182.16.110.190
  182.16.117.203
  182.16.117.205
+182.16.156.121
  182.16.161.161
  182.16.161.18
  182.16.162.29
@@ -65383,10 +61301,10 @@
  182.16.178.178
  182.16.179.82
  182.16.181.90
-182.16.184.220
  182.16.245.54
  182.16.255.194
  182.16.28.134
+182.16.31.242
  182.16.4.38
  182.16.44.138
  182.16.5.102
@@ -65395,16 +61313,15 @@
  182.16.82.250
  182.160.104.213
  182.160.109.214
-182.160.110.156
  182.160.110.178
  182.160.115.180
  182.160.117.107
  182.160.117.130
  182.160.118.50
+182.160.121.114
  182.160.122.130
  182.160.123.148
  182.160.124.26
-182.160.125.188
  182.160.127.53
  182.160.163.131
  182.160.96.46
@@ -65412,7 +61329,6 @@
  182.161.157.122
  182.161.157.87
  182.161.19.122
-182.162.104.153
  182.162.104.239
  182.162.17.171
  182.162.17.202
@@ -65420,10 +61336,11 @@
  182.167.119.158
  182.172.36.95
  182.176.114.200
+182.176.129.75
  182.176.132.99
  182.176.147.198
+182.176.148.203
  182.176.184.201
-182.176.186.102
  182.176.228.147
  182.176.90.252
  182.176.91.11
@@ -65441,18 +61358,19 @@
  182.18.5.201
  182.18.72.11
  182.18.72.12
-182.18.72.13
  182.18.72.14
  182.18.72.16
-182.18.72.17
+182.18.72.18
  182.18.72.19
  182.18.72.2
  182.18.72.20
  182.18.72.23
+182.18.72.25
  182.18.72.26
  182.18.72.27
  182.18.72.4
  182.18.72.5
+182.18.72.58
  182.18.72.9
  182.180.110.188
  182.180.111.51
@@ -65469,20 +61387,15 @@
  182.180.83.118
  182.180.83.54
  182.180.95.121
-182.183.230.103
  182.184.108.221
  182.184.112.215
  182.184.58.173
-182.184.66.153
  182.184.69.132
  182.185.103.97
-182.185.148.153
  182.185.194.231
-182.185.209.56
  182.185.54.124
-182.186.38.32
  182.186.41.168
-182.186.42.11
+182.187.106.146
  182.187.139.159
  182.187.143.135
  182.188.38.174
@@ -65496,11 +61409,13 @@
  182.19.41.145
  182.19.65.177
  182.19.85.20
+182.190.3.182
  182.191.114.25
  182.191.75.88
  182.191.84.39
  182.200.185.136
  182.204.167.251
+182.205.55.181
  182.207.221.211
  182.208.124.155
  182.208.177.41
@@ -65510,7 +61425,6 @@
  182.208.30.18
  182.208.98.210
  182.209.199.174
-182.209.71.94
  182.210.203.218
  182.210.212.144
  182.210.241.145
@@ -65521,10 +61435,7 @@
  182.215.172.136
  182.218.152.87
  182.218.64.155
-182.219.172.224
  182.220.24.30
-182.221.229.214
-182.222.132.58
  182.222.167.237
  182.222.195.145
  182.222.195.192
@@ -65532,6 +61443,7 @@
  182.222.28.14
  182.222.28.27
  182.224.177.119
+182.224.198.84
  182.225.254.234
  182.226.116.136
  182.226.125.92
@@ -65542,7 +61454,6 @@
  182.228.217.166
  182.229.208.66
  182.23.103.6
-182.23.104.231
  182.23.118.114
  182.23.12.194
  182.23.126.68
@@ -65558,13 +61469,12 @@
  182.23.62.195
  182.23.67.49
  182.23.67.83
-182.23.68.119
  182.23.79.162
-182.23.82.19
  182.23.82.22
  182.23.93.140
  182.230.112.148
  182.230.183.103
+182.232.56.184
  182.233.8.171
  182.233.8.183
  182.233.8.5
@@ -65586,7 +61496,6 @@
  182.241.153.87
  182.241.203.234
  182.242.143.38
-182.242.143.78
  182.243.42.34
  182.243.42.96
  182.243.54.160
@@ -65602,15 +61511,11 @@
  182.245.155.118
  182.245.172.61
  182.245.190.68
-182.246.58.61
  182.247.166.52
  182.247.194.35
  182.247.239.24
-182.247.245.160
  182.252.131.200
  182.252.133.57
-182.252.133.70
-182.252.135.35
  182.253.102.102
  182.253.104.50
  182.253.105.42
@@ -65623,12 +61528,9 @@
  182.253.115.90
  182.253.117.99
  182.253.119.34
-182.253.119.50
-182.253.141.13
  182.253.141.3
  182.253.142.11
  182.253.142.16
-182.253.142.23
  182.253.142.9
  182.253.16.170
  182.253.16.172
@@ -65637,21 +61539,24 @@
  182.253.16.3
  182.253.168.195
  182.253.169.172
+182.253.170.122
  182.253.170.181
  182.253.172.86
  182.253.173.168
+182.253.174.130
  182.253.175.137
+182.253.175.238
  182.253.18.141
  182.253.190.12
  182.253.191.106
  182.253.191.122
  182.253.191.125
  182.253.192.186
+182.253.193.34
  182.253.196.218
  182.253.196.221
  182.253.197.100
  182.253.197.60
-182.253.200.171
  182.253.201.214
  182.253.201.26
  182.253.201.66
@@ -65659,17 +61564,15 @@
  182.253.202.166
  182.253.204.66
  182.253.205.29
-182.253.22.2
  182.253.223.75
  182.253.224.100
  182.253.226.88
  182.253.232.103
  182.253.232.245
-182.253.233.158
  182.253.233.47
  182.253.233.9
  182.253.234.166
-182.253.234.213
+182.253.234.211
  182.253.234.49
  182.253.235.112
  182.253.235.217
@@ -65684,43 +61587,36 @@
  182.253.68.18
  182.253.70.158
  182.253.70.232
-182.253.70.254
-182.253.70.40
  182.253.70.58
  182.253.70.84
  182.253.78.34
+182.253.91.197
  182.253.93.5
  182.254.129.29
  182.254.130.16
-182.254.136.14
  182.254.136.77
+182.254.137.75
  182.254.138.153
  182.254.141.147
  182.254.141.97
-182.254.145.29
  182.254.146.170
  182.254.146.173
  182.254.146.230
  182.254.147.247
  182.254.149.130
+182.254.152.219
  182.254.159.133
  182.254.161.109
-182.254.161.125
  182.254.161.202
-182.254.163.149
  182.254.164.34
  182.254.165.138
-182.254.166.136
-182.254.166.215
  182.254.166.97
  182.254.168.205
  182.254.171.125
-182.254.171.26
  182.254.172.63
  182.254.178.192
  182.254.180.17
  182.254.184.127
-182.254.186.229
  182.254.189.119
  182.254.194.38
  182.254.197.12
@@ -65732,12 +61628,12 @@
  182.254.217.198
  182.254.218.70
  182.254.222.155
-182.254.223.249
  182.254.223.96
  182.254.241.38
  182.254.244.109
  182.254.244.238
  182.255.52.46
+182.30.106.71
  182.30.89.143
  182.31.171.84
  182.31.245.174
@@ -65746,27 +61642,20 @@
  182.34.243.134
  182.34.33.78
  182.42.47.133
+182.42.61.216
  182.42.72.49
  182.43.132.212
-182.43.134.224
-182.43.136.178
-182.43.158.63
-182.43.171.208
-182.43.200.140
  182.43.225.166
  182.43.227.243
-182.43.234.153
-182.43.234.34
  182.43.245.54
-182.43.6.84
  182.45.93.90
  182.46.158.85
  182.46.50.58
+182.46.50.8
  182.47.228.174
  182.48.114.11
  182.48.119.121
  182.48.193.139
-182.48.230.18
  182.48.70.145
  182.48.70.154
  182.48.74.154
@@ -65776,7 +61665,6 @@
  182.48.87.170
  182.48.88.205
  182.48.90.130
-182.48.99.38
  182.50.117.244
  182.50.120.204
  182.50.130.173
@@ -65795,19 +61683,16 @@
  182.50.248.150
  182.50.248.201
  182.50.248.231
+182.50.4.192
  182.50.65.135
  182.50.69.70
  182.52.103.219
  182.52.108.104
-182.52.113.118
-182.52.131.213
  182.52.131.31
  182.52.131.37
-182.52.131.57
  182.52.136.107
  182.52.137.125
  182.52.137.23
-182.52.142.149
  182.52.149.120
  182.52.149.122
  182.52.149.123
@@ -65818,19 +61703,16 @@
  182.52.197.21
  182.52.198.205
  182.52.21.2
-182.52.216.205
  182.52.22.58
  182.52.224.39
  182.52.229.57
  182.52.23.206
  182.52.23.244
  182.52.23.40
-182.52.23.45
  182.52.238.111
  182.52.238.118
  182.52.238.119
  182.52.238.52
-182.52.32.65
  182.52.33.229
  182.52.40.170
  182.52.51.10
@@ -65851,12 +61733,12 @@
  182.52.90.117
  182.52.90.164
  182.52.90.42
+182.52.90.43
  182.52.91.235
  182.53.0.212
  182.53.135.219
  182.53.135.226
  182.53.14.89
-182.53.15.233
  182.53.163.111
  182.53.181.187
  182.53.193.171
@@ -65871,6 +61753,7 @@
  182.53.201.239
  182.53.201.84
  182.53.202.184
+182.53.202.227
  182.53.206.138
  182.53.206.175
  182.53.206.198
@@ -65878,7 +61761,6 @@
  182.53.206.40
  182.53.206.44
  182.53.206.47
-182.53.21.53
  182.53.216.55
  182.53.22.183
  182.53.39.241
@@ -65897,6 +61779,7 @@
  182.54.151.5
  182.54.151.9
  182.54.172.202
+182.54.175.187
  182.54.207.74
  182.54.220.101
  182.54.220.139
@@ -65907,32 +61790,23 @@
  182.55.26.152
  182.55.27.161
  182.55.83.186
-182.56.126.138
-182.56.197.93
-182.56.32.246
-182.56.91.77
-182.57.115.1
-182.57.88.181
+182.56.249.174
+182.57.219.111
+182.57.80.233
  182.58.49.77
+182.59.120.60
  182.59.138.249
-182.59.185.92
  182.59.2.193
  182.59.3.33
-182.59.37.52
-182.59.46.12
-182.59.96.205
-182.61.1.161
+182.59.37.197
+182.59.50.202
+182.59.72.113
+182.59.94.194
  182.61.1.203
  182.61.1.248
  182.61.1.88
-182.61.10.142
  182.61.10.28
  182.61.104.246
-182.61.105.104
-182.61.105.127
-182.61.105.89
-182.61.108.39
-182.61.11.3
  182.61.12.12
  182.61.12.58
  182.61.12.9
@@ -65951,9 +61825,7 @@
  182.61.14.93
  182.61.144.110
  182.61.146.188
-182.61.146.33
  182.61.149.188
-182.61.149.31
  182.61.150.12
  182.61.150.42
  182.61.16.73
@@ -65961,57 +61833,36 @@
  182.61.164.235
  182.61.165.33
  182.61.168.185
-182.61.169.8
  182.61.171.65
-182.61.172.57
  182.61.173.200
  182.61.173.94
  182.61.175.219
-182.61.175.36
-182.61.176.200
  182.61.179.157
  182.61.18.154
  182.61.18.216
-182.61.180.183
  182.61.184.155
-182.61.185.92
  182.61.187.66
  182.61.19.225
  182.61.2.135
-182.61.2.151
-182.61.2.231
-182.61.2.238
-182.61.2.67
-182.61.21.155
-182.61.21.200
  182.61.21.209
-182.61.22.140
  182.61.22.46
  182.61.24.26
  182.61.25.156
-182.61.25.163
  182.61.25.229
  182.61.26.73
  182.61.27.149
  182.61.29.203
-182.61.3.119
  182.61.3.13
-182.61.3.152
-182.61.3.223
  182.61.32.178
-182.61.32.65
  182.61.33.145
-182.61.35.17
  182.61.35.185
  182.61.36.206
  182.61.36.44
  182.61.36.56
  182.61.37.144
  182.61.37.34
-182.61.37.35
  182.61.38.191
  182.61.39.203
-182.61.39.254
  182.61.4.210
  182.61.40.124
  182.61.40.161
@@ -66021,43 +61872,29 @@
  182.61.43.127
  182.61.43.196
  182.61.43.202
-182.61.44.177
-182.61.44.2
  182.61.47.88
  182.61.49.107
-182.61.49.179
-182.61.49.91
-182.61.5.136
  182.61.50.68
  182.61.52.111
  182.61.52.135
-182.61.54.45
-182.61.55.154
-182.61.55.155
  182.61.55.39
  182.61.55.79
-182.61.57.103
  182.61.6.184
  182.61.60.191
  182.61.61.58
-182.61.65.120
  182.61.65.209
-182.61.65.47
  182.64.249.86
  182.65.229.177
  182.68.251.215
  182.68.44.133
  182.70.242.155
-182.70.253.202
  182.71.10.18
  182.71.111.138
-182.71.152.78
  182.71.163.244
  182.71.188.10
  182.71.197.195
-182.71.221.78
-182.71.246.162
  182.71.247.84
+182.71.73.26
  182.71.85.94
  182.71.87.34
  182.71.90.202
@@ -66072,13 +61909,9 @@
  182.72.28.210
  182.72.30.66
  182.72.94.146
-182.73.111.158
  182.73.136.210
-182.73.136.26
-182.73.142.74
  182.73.143.146
  182.73.15.70
-182.73.201.10
  182.73.221.154
  182.73.230.106
  182.73.35.234
@@ -66088,11 +61921,13 @@
  182.73.77.18
  182.73.85.38
  182.73.95.218
+182.73.97.82
  182.74.116.118
  182.74.18.26
  182.74.197.50
  182.74.246.42
  182.74.25.246
+182.74.51.206
  182.74.87.194
  182.75.115.59
  182.75.125.50
@@ -66100,16 +61935,18 @@
  182.75.139.222
  182.75.139.26
  182.75.165.202
+182.75.173.102
+182.75.175.14
  182.75.176.107
+182.75.202.174
  182.75.216.74
-182.75.245.150
  182.75.248.254
  182.75.249.110
  182.75.249.98
-182.75.33.14
  182.75.40.70
  182.75.48.98
  182.75.56.226
+182.75.8.198
  182.75.90.137
  182.75.99.50
  182.76.128.36
@@ -66118,38 +61955,35 @@
  182.76.168.232
  182.76.169.195
  182.76.213.139
-182.76.23.134
+182.76.224.174
  182.76.237.118
  182.76.28.148
  182.76.43.232
  182.76.43.42
-182.76.5.46
-182.76.58.12
-182.76.6.218
  182.76.74.78
  182.76.80.185
  182.78.194.78
  182.78.195.10
-182.84.124.18
+182.84.124.171
  182.84.124.231
-182.84.46.67
  182.84.47.181
  182.85.181.125
+182.86.226.15
  182.86.226.254
-182.86.226.97
  182.87.223.76
  182.88.224.153
+182.88.26.89
+182.88.27.175
  182.90.205.41
  182.90.248.25
  182.92.107.145
  182.92.113.148
+182.92.121.8
  182.92.195.165
  182.92.199.94
  182.92.216.63
  182.92.223.121
  182.92.242.11
-182.92.68.142
-182.92.79.232
  182.92.81.28
  182.92.84.176
  182.92.89.101
@@ -66165,12 +61999,13 @@
  182elexusbet.com
  183.100.104.143
  183.100.185.72
+183.100.189.194
  183.100.199.224
-183.100.232.58
  183.100.31.47
  183.100.79.19
  183.101.109.170
  183.101.109.252
+183.101.156.182
  183.101.176.223
  183.101.185.36
  183.101.195.158
@@ -66179,6 +62014,7 @@
  183.101.8.110
  183.101.88.190
  183.101.92.163
+183.102.114.251
  183.102.129.78
  183.102.145.72
  183.102.221.50
@@ -66188,6 +62024,7 @@
  183.102.63.211
  183.103.115.2
  183.103.12.247
+183.103.173.46
  183.103.230.41
  183.103.234.89
  183.103.24.107
@@ -66205,30 +62042,36 @@
  183.104.248.85
  183.105.103.138
  183.105.104.25
+183.105.14.179
  183.105.173.151
  183.105.209.206
+183.105.26.17
+183.105.39.48
+183.105.46.241
  183.105.5.48
  183.105.93.79
  183.105.99.30
  183.106.132.159
+183.106.134.77
  183.106.135.170
  183.106.163.107
  183.106.163.80
  183.106.180.12
  183.106.182.73
  183.106.198.70
-183.106.201.118
  183.106.227.164
  183.106.230.10
+183.106.241.54
  183.106.63.62
  183.106.83.96
  183.107.124.44
+183.107.168.188
  183.107.168.238
  183.107.206.110
-183.107.21.206
  183.107.51.106
  183.107.96.148
  183.108.117.99
+183.108.175.18
  183.108.23.87
  183.108.241.56
  183.108.27.244
@@ -66242,6 +62085,7 @@
  183.109.15.208
  183.109.151.79
  183.109.171.98
+183.109.186.193
  183.109.186.225
  183.109.189.106
  183.109.189.170
@@ -66251,24 +62095,18 @@
  183.109.225.138
  183.109.225.144
  183.109.247.8
-183.109.79.253
  183.109.80.156
  183.109.82.108
-183.11.238.29
  183.110.220.210
  183.110.223.149
  183.111.148.118
  183.111.204.148
  183.111.206.111
-183.111.96.20
  183.12.26.150
-183.125.109.123
  183.128.138.19
+183.128.239.100
  183.129.136.78
-183.129.141.44
-183.129.146.18
  183.129.158.194
-183.129.159.162
  183.129.159.211
  183.129.163.142
  183.129.164.148
@@ -66276,6 +62114,7 @@
  183.129.175.34
  183.129.177.196
  183.129.181.42
+183.129.182.34
  183.129.185.170
  183.129.189.109
  183.129.198.133
@@ -66287,7 +62126,6 @@
  183.129.202.2
  183.129.202.3
  183.129.202.4
-183.129.202.5
  183.129.202.6
  183.129.202.7
  183.129.202.8
@@ -66299,6 +62137,7 @@
  183.129.232.116
  183.129.251.178
  183.129.255.98
+183.129.48.200
  183.13.204.216
  183.130.21.168
  183.130.23.147
@@ -66321,22 +62160,18 @@
  183.131.206.98
  183.131.222.6
  183.131.231.14
-183.131.247.86
  183.131.249.58
-183.131.3.51
  183.131.66.7
  183.131.83.195
-183.131.84.141
  183.131.84.239
  183.131.85.11
  183.132.102.94
-183.132.123.241
  183.132.153.142
-183.132.16.193
-183.132.21.81
+183.132.159.168
  183.132.21.82
  183.132.22.120
  183.132.22.138
+183.132.22.216
  183.132.47.201
  183.134.100.19
  183.134.101.38
@@ -66350,15 +62185,10 @@
  183.134.199.68
  183.134.241.55
  183.134.245.122
-183.134.62.177
  183.134.63.144
  183.134.65.197
-183.134.66.108
  183.134.74.53
  183.134.75.216
-183.134.77.250
-183.134.90.250
-183.134.91.53
  183.135.152.220
  183.135.155.190
  183.136.113.22
@@ -66375,13 +62205,10 @@
  183.136.225.45
  183.136.225.56
  183.136.233.133
+183.136.252.5
  183.138.128.145
  183.138.160.135
-183.138.180.139
  183.138.96.63
-183.14.214.57
-183.14.24.168
-183.141.137.20
  183.141.65.55
  183.141.65.75
  183.142.153.88
@@ -66392,18 +62219,19 @@
  183.142.79.233
  183.142.82.232
  183.142.83.72
+183.142.84.92
  183.142.95.75
  183.143.113.62
  183.143.14.128
  183.143.183.106
  183.144.110.136
  183.144.156.2
-183.144.195.39
  183.144.204.225
+183.144.58.9
  183.145.123.9
  183.145.168.172
  183.145.172.93
-183.145.201.136
+183.145.175.228
  183.145.207.183
  183.145.58.140
  183.146.16.68
@@ -66411,7 +62239,9 @@
  183.146.190.101
  183.146.213.157
  183.146.213.198
+183.146.60.73
  183.147.6.18
+183.147.7.143
  183.147.7.184
  183.148.168.159
  183.148.169.228
@@ -66423,32 +62253,32 @@
  183.15.172.26
  183.15.172.5
  183.15.173.122
-183.15.177.102
  183.15.177.115
  183.15.177.117
-183.15.177.49
-183.15.177.51
-183.15.177.52
+183.15.177.119
  183.15.178.152
-183.15.179.149
-183.15.179.152
-183.15.179.153
-183.15.179.156
  183.15.179.23
-183.15.179.37
  183.15.205.232
  183.15.88.187
  183.15.88.36
  183.15.90.131
-183.150.161.30
  183.150.25.61
  183.150.28.20
  183.150.7.97
  183.151.1.217
+183.154.170.224
  183.154.19.12
  183.154.20.49
+183.154.59.20
+183.155.199.110
  183.156.2.119
-183.156.240.24
+183.156.240.144
+183.156.240.205
+183.156.240.231
+183.156.243.207
+183.156.244.173
+183.156.245.151
+183.156.245.25
  183.156.247.253
  183.156.76.220
  183.156.9.95
@@ -66464,6 +62294,7 @@
  183.157.168.191
  183.157.168.192
  183.157.168.196
+183.157.168.2
  183.157.168.204
  183.157.168.208
  183.157.168.211
@@ -66472,9 +62303,7 @@
  183.157.168.27
  183.157.168.52
  183.157.168.55
-183.157.168.70
  183.157.168.71
-183.157.168.89
  183.157.169.118
  183.157.169.123
  183.157.169.125
@@ -66483,10 +62312,10 @@
  183.157.169.182
  183.157.169.193
  183.157.169.195
+183.157.169.213
  183.157.169.33
  183.157.169.62
  183.157.169.63
-183.157.170.110
  183.157.170.135
  183.157.170.14
  183.157.170.176
@@ -66495,7 +62324,6 @@
  183.157.170.211
  183.157.170.221
  183.157.170.223
-183.157.170.230
  183.157.170.248
  183.157.170.250
  183.157.170.252
@@ -66524,6 +62352,7 @@
  183.157.171.82
  183.157.171.96
  183.157.172.1
+183.157.172.125
  183.157.172.132
  183.157.172.141
  183.157.172.144
@@ -66539,7 +62368,6 @@
  183.157.172.36
  183.157.172.37
  183.157.172.52
-183.157.172.54
  183.157.172.74
  183.157.172.90
  183.157.173.101
@@ -66560,7 +62388,6 @@
  183.157.173.255
  183.157.173.56
  183.157.173.57
-183.157.173.58
  183.157.173.65
  183.157.173.80
  183.157.173.9
@@ -66591,6 +62418,7 @@
  183.157.174.90
  183.157.175.0
  183.157.175.100
+183.157.175.120
  183.157.175.131
  183.157.175.136
  183.157.175.14
@@ -66608,7 +62436,6 @@
  183.157.175.230
  183.157.175.234
  183.157.175.24
-183.157.175.247
  183.157.175.252
  183.157.175.35
  183.157.175.40
@@ -66618,7 +62445,6 @@
  183.157.175.85
  183.157.175.91
  183.157.175.97
-183.157.25.100
  183.157.45.158
  183.158.233.141
  183.158.241.229
@@ -66628,14 +62454,12 @@
  183.159.74.192
  183.16.209.144
  183.16.209.95
-183.160.187.195
  183.162.79.39
  183.162.93.6
  183.164.244.220
-183.165.40.89
  183.166.111.196
-183.166.124.211
-183.166.136.131
+183.166.119.62
+183.166.149.184
  183.166.170.148
  183.166.171.134
  183.166.238.106
@@ -66646,7 +62470,6 @@
  183.166.239.33
  183.166.239.51
  183.166.59.149
-183.166.6.106
  183.167.208.66
  183.167.230.197
  183.17.144.37
@@ -66657,6 +62480,8 @@
  183.17.230.162
  183.17.230.208
  183.17.231.109
+183.17.231.127
+183.17.59.208
  183.171.197.51
  183.175.42.43
  183.176.8.208
@@ -66666,7 +62491,6 @@
  183.178.215.196
  183.178.244.182
  183.178.249.213
-183.178.60.201
  183.178.63.51
  183.179.137.63
  183.179.192.173
@@ -66679,7 +62503,6 @@
  183.181.88.119
  183.182.101.32
  183.182.107.104
-183.184.68.36
  183.185.168.187
  183.185.172.204
  183.185.193.29
@@ -66696,25 +62519,21 @@
  183.188.134.235
  183.188.140.128
  183.188.141.39
-183.188.151.166
  183.188.162.92
-183.188.166.18
  183.188.174.79
  183.188.184.238
  183.188.187.52
  183.188.198.118
  183.188.204.2
  183.188.207.37
-183.188.21.255
  183.188.243.245
-183.188.37.181
  183.188.55.170
  183.188.65.74
+183.188.7.59
  183.188.95.232
  183.189.99.152
  183.190.148.241
  183.190.198.4
-183.190.26.125
  183.190.89.237
  183.191.124.217
  183.191.216.103
@@ -66730,19 +62549,16 @@
  183.196.61.243
  183.196.92.35
  183.196.92.9
-183.197.56.129
  183.197.56.159
-183.197.56.169
  183.197.56.2
-183.197.56.212
  183.197.56.233
+183.197.56.30
  183.197.56.43
  183.197.56.73
  183.199.125.103
  183.199.125.11
  183.199.125.118
  183.199.125.13
-183.199.125.141
  183.199.125.156
  183.199.125.161
  183.199.125.164
@@ -66750,14 +62566,11 @@
  183.199.125.178
  183.199.125.184
  183.199.125.19
-183.199.125.192
  183.199.125.199
  183.199.125.20
  183.199.125.200
  183.199.125.203
-183.199.125.214
  183.199.125.217
-183.199.125.223
  183.199.125.23
  183.199.125.230
  183.199.125.24
@@ -66773,13 +62586,13 @@
  183.199.125.92
  183.2.101.48
  183.2.157.219
-183.2.168.102
  183.20.156.101
  183.20.156.200
  183.20.156.25
  183.20.230.30
  183.203.157.188
  183.203.161.195
+183.203.96.67
  183.212.179.189
  183.214.84.26
  183.214.85.202
@@ -66791,7 +62604,6 @@
  183.215.42.143
  183.215.90.25
  183.216.18.96
-183.22.26.120
  183.220.1.161
  183.220.146.247
  183.220.146.248
@@ -66808,6 +62620,7 @@
  183.221.242.60
  183.221.39.124
  183.222.218.246
+183.222.40.227
  183.223.222.190
  183.223.236.5
  183.224.129.162
@@ -66823,6 +62636,7 @@
  183.228.110.243
  183.230.10.172
  183.230.112.77
+183.230.13.171
  183.230.158.24
  183.230.166.204
  183.230.173.114
@@ -66837,19 +62651,19 @@
  183.233.221.204
  183.233.235.248
  183.233.237.73
+183.234.0.179
  183.234.11.43
  183.234.160.38
  183.234.17.149
-183.234.182.17
-183.234.184.4
+183.234.229.242
  183.234.58.41
  183.234.64.2
  183.235.245.86
  183.236.136.130
  183.236.247.9
-183.236.67.48
  183.236.95.123
  183.237.104.238
+183.237.15.14
  183.237.15.16
  183.237.154.180
  183.237.191.186
@@ -66872,8 +62686,8 @@
  183.245.15.19
  183.245.64.30
  183.245.83.174
-183.245.99.59
  183.246.180.131
+183.247.151.247
  183.247.192.169
  183.247.198.23
  183.247.206.116
@@ -66881,7 +62695,6 @@
  183.249.10.142
  183.249.120.148
  183.25.117.227
-183.25.166.166
  183.250.129.50
  183.250.154.149
  183.250.154.54
@@ -66898,13 +62711,11 @@
  183.251.103.235
  183.251.107.67
  183.251.151.28
-183.251.50.162
  183.252.48.160
  183.252.49.122
  183.253.55.188
  183.3.129.84
  183.3.150.178
-183.3.176.215
  183.3.221.136
  183.3.222.51
  183.3.223.86
@@ -66919,13 +62730,12 @@
  183.30.201.44
  183.30.201.68
  183.30.201.76
-183.30.201.86
  183.30.204.210
+183.31.103.181
  183.32.140.200
  183.32.216.178
  183.32.89.7
  183.33.77.240
-183.36.125.220
  183.36.126.195
  183.4.28.24
  183.4.30.105
@@ -66937,9 +62747,7 @@
  183.47.30.134
  183.47.30.191
  183.47.45.115
-183.47.50.8
  183.48.124.191
-183.48.32.132
  183.49.85.243
  183.5.85.12
  183.5.85.45
@@ -66973,18 +62781,12 @@
  183.56.167.10
  183.56.194.28
  183.56.195.195
-183.56.199.51
-183.56.201.121
-183.56.203.81
  183.56.205.26
-183.56.211.38
-183.56.213.81
  183.56.216.122
-183.56.218.62
  183.57.156.10
+183.57.240.218
  183.57.248.54
  183.57.249.52
-183.57.251.148
  183.57.251.33
  183.57.27.10
  183.57.43.251
@@ -66993,21 +62795,18 @@
  183.6.102.54
  183.6.107.20
  183.6.107.227
-183.6.107.248
  183.6.107.68
  183.6.107.75
-183.6.117.27
  183.6.132.4
  183.6.135.227
-183.6.151.86
  183.6.152.11
  183.6.156.76
-183.6.159.141
  183.6.17.5
  183.6.177.234
  183.60.108.155
  183.60.110.85
  183.60.141.171
+183.60.153.30
  183.60.161.131
  183.60.227.177
  183.60.244.37
@@ -67015,12 +62814,10 @@
  183.61.1.33
  183.61.1.34
  183.61.1.35
-183.61.1.58
  183.61.1.59
  183.61.109.23
  183.61.109.252
  183.61.243.181
-183.61.5.13
  183.61.5.198
  183.62.132.46
  183.62.139.167
@@ -67031,11 +62828,10 @@
  183.62.234.101
  183.62.238.34
  183.62.25.218
-183.62.49.212
  183.62.57.158
  183.62.69.34
  183.63.148.219
-183.63.172.52
+183.63.158.51
  183.63.207.3
  183.63.233.238
  183.63.25.194
@@ -67044,10 +62840,8 @@
  183.63.37.71
  183.63.47.102
  183.63.52.3
-183.63.53.171
  183.63.87.236
  183.63.88.244
-183.63.97.120
  183.64.118.114
  183.64.239.19
  183.65.30.2
@@ -67056,8 +62850,6 @@
  183.66.171.253
  183.66.187.10
  183.66.250.118
-183.66.65.203
-183.66.65.214
  183.7.172.56
  183.7.174.197
  183.7.32.245
@@ -67083,13 +62875,11 @@
  183.80.165.117
  183.80.175.140
  183.80.176.26
-183.80.182.179
  183.80.199.151
  183.80.20.215
  183.80.20.71
  183.80.20.94
  183.80.202.53
-183.80.21.137
  183.80.21.151
  183.80.21.186
  183.80.21.198
@@ -67103,7 +62893,6 @@
  183.80.46.122
  183.80.46.250
  183.80.46.49
-183.80.56.26
  183.80.56.91
  183.80.56.94
  183.80.57.64
@@ -67134,7 +62923,6 @@
  183.81.101.224
  183.81.120.33
  183.81.122.52
-183.81.152.109
  183.81.152.82
  183.81.152.85
  183.81.154.113
@@ -67147,18 +62935,15 @@
  183.81.157.140
  183.81.157.217
  183.81.158.105
-183.81.169.113
  183.81.17.33
  183.81.20.152
  183.81.20.53
-183.81.35.90
  183.81.44.0
  183.81.50.206
  183.81.57.185
  183.81.57.43
  183.81.78.83
  183.81.84.19
-183.81.85.246
  183.81.97.233
  183.82.0.15
  183.82.0.21
@@ -67169,18 +62954,13 @@
  183.82.119.101
  183.82.121.174
  183.82.121.34
-183.82.121.41
  183.82.123.14
-183.82.149.121
  183.82.153.96
-183.82.155.38
  183.82.156.193
  183.82.158.157
-183.82.250.50
  183.82.32.153
  183.82.33.196
  183.82.34.162
-183.82.34.246
  183.82.35.229
  183.82.41.250
  183.82.42.67
@@ -67198,9 +62978,6 @@
  183.87.14.250
  183.87.153.182
  183.87.153.98
-183.87.157.202
-183.87.17.159
-183.87.192.235
  183.87.20.71
  183.87.221.252
  183.87.221.50
@@ -67212,21 +62989,16 @@
  183.87.69.233
  183.87.70.210
  183.87.76.17
-183.88.104.75
  183.88.105.121
  183.88.105.170
  183.88.106.201
-183.88.106.72
  183.88.107.13
  183.88.146.66
-183.88.16.110
  183.88.16.250
  183.88.16.4
-183.88.169.104
  183.88.17.198
-183.88.176.151
  183.88.177.155
-183.88.186.161
+183.88.189.83
  183.88.212.141
  183.88.214.143
  183.88.214.88
@@ -67235,25 +63007,23 @@
  183.88.22.198
  183.88.223.208
  183.88.224.150
+183.88.224.206
  183.88.225.4
  183.88.227.76
-183.88.23.110
-183.88.230.98
  183.88.237.160
  183.88.237.226
  183.88.240.200
  183.88.240.53
+183.88.243.182
  183.88.252.5
  183.88.253.14
-183.88.48.179
  183.88.6.173
  183.88.6.183
  183.88.66.42
-183.88.67.232
  183.88.67.88
  183.88.75.215
  183.88.80.15
-183.88.84.182
+183.88.92.160
  183.88.95.179
  183.88.99.147
  183.89.0.36
@@ -67261,9 +63031,8 @@
  183.89.103.58
  183.89.113.219
  183.89.114.37
-183.89.115.64
+183.89.115.247
  183.89.116.43
-183.89.118.124
  183.89.119.134
  183.89.119.179
  183.89.12.198
@@ -67274,14 +63043,11 @@
  183.89.157.239
  183.89.158.4
  183.89.160.175
-183.89.160.84
  183.89.161.239
  183.89.162.1
  183.89.162.38
  183.89.162.62
  183.89.162.7
-183.89.167.181
-183.89.168.24
  183.89.170.104
  183.89.170.161
  183.89.2.32
@@ -67289,22 +63055,23 @@
  183.89.246.242
  183.89.27.5
  183.89.28.238
+183.89.33.186
  183.89.4.210
  183.89.4.63
  183.89.4.81
  183.89.40.4
-183.89.47.223
-183.89.47.51
+183.89.61.49
+183.89.62.219
  183.89.72.163
  183.89.81.110
  183.89.96.57
+183.89.97.208
  183.89.99.130
  183.89.99.36
  183.90.250.15
  183.90.250.38
  183.91.11.198
  183.91.11.21
-183.91.19.38
  183.91.193.186
  183.91.204.27
  183.91.204.74
@@ -67315,11 +63082,14 @@
  183.91.33.41
  183.91.6.225
  183.91.65.42
+183.91.66.99
  183.91.68.148
  183.91.77.38
  183.91.81.162
+183.92.134.2
  183.92.208.15
  183.92.214.38
+183.92.219.56
  183.92.255.135
  183.92.89.45
  183.93.10.57
@@ -67329,7 +63099,6 @@
  183.95.147.66
  183.95.246.160
  183.95.36.2
-183.95.84.34
  183.96.1.110
  183.96.12.137
  183.96.144.138
@@ -67342,18 +63111,26 @@
  183.96.89.113
  183.96.98.86
  183.97.19.64
+183.97.20.117
  183.97.234.18
  183.97.239.217
+183.97.242.248
  183.97.253.204
  183.97.3.185
  183.97.3.228
  183.97.39.5
+183.97.40.9
  183.97.5.73
-183.98.121.165
+183.97.59.160
+183.97.6.132
+183.97.7.219
+183.98.204.123
+183.98.31.32
  183.98.8.223
  183.99.128.152
  183.99.178.93
  183.99.191.93
+183.99.44.224
  1830488.synergyglobal.one
  1834.31cf4fdae.com
  183da2ac-98c9-41cf-9f59-0c377e76b19b.htmlcomponentservice.com
@@ -67366,9 +63143,9 @@
  184.0.72.251
  184.1.156.160
  184.1.208.33
-184.101.179.212
  184.102.100.106
  184.102.114.129
+184.102.117.81
  184.102.121.30
  184.102.197.11
  184.102.32.148
@@ -67494,11 +63271,11 @@
  184.106.159.175
  184.144.20.202
  184.144.204.194
-184.145.191.60
  184.145.74.67
  184.146.130.148
  184.147.0.8
  184.147.103.234
+184.148.54.222
  184.153.119.188
  184.153.135.2
  184.153.247.218
@@ -67560,9 +63337,7 @@
  184.170.145.60
  184.170.212.94
  184.170.223.148
-184.170.241.194
  184.170.242.135
-184.171.164.162
  184.171.208.109
  184.171.250.187
  184.171.250.188
@@ -67595,10 +63370,8 @@
  184.187.22.44
  184.189.123.68
  184.19.26.15
-184.190.159.248
  184.191.58.33
  184.2.203.46
-184.22.179.244
  184.22.234.114
  184.22.6.8
  184.24.4.195
@@ -67639,11 +63412,9 @@
  184.5.250.79
  184.5.46.192
  184.54.140.91
-184.54.188.191
  184.54.251.18
  184.57.184.168
  184.57.66.197
-184.58.164.106
  184.6.214.169
  184.60.188.106
  184.64.198.14
@@ -67662,6 +63433,7 @@
  184.7.3.103
  184.7.55.99
  184.70.15.166
+184.70.208.226
  184.70.244.67
  184.70.33.190
  184.70.46.94
@@ -67672,7 +63444,6 @@
  184.72.147.110
  184.72.177.210
  184.72.194.73
-184.72.195.224
  184.72.80.129
  184.73.116.131
  184.73.162.27
@@ -67684,8 +63455,9 @@
  184.74.135.242
  184.74.150.189
  184.74.240.157
-184.75.212.250
+184.75.212.146
  184.75.214.210
+184.75.221.43
  184.75.247.14
  184.75.247.21
  184.75.247.28
@@ -67708,7 +63480,6 @@
  184.82.196.236
  184.82.200.221
  184.82.201.194
-184.82.205.37
  184.82.224.13
  184.82.229.251
  184.82.234.28
@@ -67724,7 +63495,7 @@
  184.95.59.122
  184.96.133.93
  184.98.125.106
-184.98.235.195
+184.99.114.67
  184249-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  184betper.com
  185-20-227-112.ovz.vps.regruhosting.ru
@@ -67747,6 +63518,7 @@
  185.10.68.66
  185.10.73.233
  185.10.74.15
+185.100.13.193
  185.100.44.233
  185.100.84.149
  185.100.84.85
@@ -67764,8 +63536,6 @@
  185.100.87.120
  185.100.87.135
  185.100.87.139
-185.100.87.190
-185.100.87.191
  185.100.87.206
  185.100.87.207
  185.100.87.240
@@ -67794,11 +63564,10 @@
  185.103.110.146
  185.103.110.86
  185.103.181.2
-185.103.196.5
  185.103.219.150
+185.103.246.17
  185.103.252.12
  185.103.37.61
-185.103.51.85
  185.104.120.60
  185.104.120.7
  185.104.180.7
@@ -67818,6 +63587,7 @@
  185.104.187.92
  185.104.187.93
  185.104.216.164
+185.104.242.30
  185.104.29.4
  185.104.85.50
  185.105.121.70
@@ -67871,6 +63641,7 @@
  185.107.49.219
  185.107.49.220
  185.107.49.222
+185.107.49.226
  185.107.49.228
  185.107.49.231
  185.107.49.232
@@ -67891,11 +63662,12 @@
  185.107.94.233
  185.107.95.215
  185.107.95.217
-185.107.95.226
+185.108.107.25
+185.108.107.30
  185.108.107.31
+185.108.107.35
  185.108.164.144
  185.108.164.167
-185.108.171.11
  185.108.197.122
  185.108.244.41
  185.108.250.133
@@ -67912,12 +63684,10 @@
  185.110.216.1
  185.110.237.34
  185.110.31.249
-185.110.95.13
+185.110.75.15
  185.111.100.184
-185.111.190.176
-185.111.208.178
  185.111.216.164
-185.111.88.182
+185.111.83.50
  185.112.144.119
  185.112.148.142
  185.112.151.191
@@ -67927,7 +63697,6 @@
  185.112.249.208
  185.112.250.128
  185.112.33.46
-185.112.35.14
  185.112.35.27
  185.112.82.15
  185.112.82.176
@@ -67945,7 +63714,6 @@
  185.114.137.14
  185.114.157.61
  185.114.23.40
-185.116.161.177
  185.116.194.138
  185.116.194.27
  185.116.214.194
@@ -67956,12 +63724,12 @@
  185.116.254.5
  185.116.254.8
  185.117.10.122
+185.117.118.252
  185.117.118.34
  185.117.119.94
  185.117.168.46
  185.117.215.9
  185.117.244.136
-185.117.57.86
  185.117.72.78
  185.117.72.9
  185.117.72.90
@@ -67971,8 +63739,8 @@
  185.118.48.206
  185.118.65.230
  185.118.66.114
-185.119.81.11
  185.12.179.222
+185.12.21.107
  185.12.45.114
  185.12.45.115
  185.12.45.116
@@ -68008,8 +63776,6 @@
  185.125.230.203
  185.125.231.156
  185.125.231.178
-185.125.32.14
-185.125.52.172
  185.126.178.243
  185.126.179.33
  185.126.183.127
@@ -68023,9 +63789,7 @@
  185.128.38.146
  185.128.40.220
  185.128.43.174
-185.128.43.2
  185.129.1.165
-185.129.103.130
  185.129.148.167
  185.129.194.31
  185.129.198.17
@@ -68128,12 +63892,14 @@
  185.134.98.110
  185.134.99.238
  185.135.10.154
+185.135.108.25
  185.135.123.96
  185.135.156.94
  185.135.157.120
  185.135.157.138
  185.135.157.44
  185.135.158.157
+185.135.159.125
  185.135.159.153
  185.135.72.244
  185.135.81.185
@@ -68144,9 +63910,9 @@
  185.136.163.107
  185.136.169.191
  185.136.170.15
+185.136.204.206
  185.136.204.3
  185.136.242.193
-185.136.52.158
  185.137.233.121
  185.137.233.123
  185.137.233.125
@@ -68154,12 +63920,9 @@
  185.137.234.10
  185.137.234.205
  185.137.88.240
-185.137.92.170
  185.137.92.48
  185.138.123.78
-185.138.132.99
  185.138.94.139
-185.139.189.39
  185.139.239.66
  185.139.56.133
  185.139.70.143
@@ -68167,7 +63930,6 @@
  185.14.184.143
  185.14.186.15
  185.14.187.101
-185.14.187.133
  185.14.187.134
  185.14.187.39
  185.14.187.86
@@ -68183,8 +63945,8 @@
  185.14.192.82
  185.14.192.93
  185.14.194.107
-185.14.194.203
-185.14.194.232
+185.14.194.207
+185.14.194.216
  185.14.194.39
  185.14.194.72
  185.14.194.84
@@ -68195,11 +63957,8 @@
  185.14.251.4
  185.14.30.152
  185.14.31.113
-185.14.57.176
  185.14.59.15
  185.140.100.0
-185.140.12.220
-185.140.12.45
  185.140.126.254
  185.140.242.82
  185.140.252.253
@@ -68215,6 +63974,7 @@
  185.140.60.234
  185.141.10.67
  185.141.11.202
+185.141.207.246
  185.141.234.34
  185.141.24.195
  185.141.24.198
@@ -68222,6 +63982,7 @@
  185.141.27.112
  185.141.27.116
  185.141.36.130
+185.141.39.3
  185.141.60.33
  185.141.60.36
  185.141.61.189
@@ -68230,7 +63991,6 @@
  185.142.124.110
  185.142.172.35
  185.142.172.36
-185.142.189.6
  185.142.208.160
  185.142.236.163
  185.142.236.209
@@ -68239,10 +63999,8 @@
  185.142.239.16
  185.142.239.205
  185.142.239.42
-185.142.239.48
  185.142.239.49
  185.142.43.132
-185.142.44.124
  185.142.55.36
  185.142.95.250
  185.143.121.102
@@ -68268,7 +64026,6 @@
  185.145.156.211
  185.145.156.76
  185.145.253.67
-185.145.26.31
  185.145.39.217
  185.146.113.157
  185.146.146.17
@@ -68282,19 +64039,21 @@
  185.147.213.127
  185.147.213.19
  185.147.213.37
+185.147.213.43
  185.147.213.56
-185.147.213.73
+185.147.213.67
+185.147.213.85
  185.147.213.86
-185.147.214.49
+185.147.214.43
  185.147.215.14
  185.148.102.123
  185.148.102.152
  185.148.145.92
  185.148.147.47
  185.148.221.4
+185.148.240.205
  185.148.3.142
  185.148.3.227
-185.148.38.26
  185.148.38.70
  185.148.39.251
  185.148.44.65
@@ -68324,9 +64083,8 @@
  185.152.138.74
  185.152.164.135
  185.152.191.5
-185.153.151.7
+185.153.180.112
  185.153.180.45
-185.153.196.100
  185.153.196.112
  185.153.196.126
  185.153.196.209
@@ -68334,34 +64092,32 @@
  185.153.196.240
  185.153.196.241
  185.153.196.30
+185.153.196.36
+185.153.196.38
  185.153.196.45
  185.153.196.50
  185.153.196.81
-185.153.196.82
+185.153.196.88
  185.153.196.90
  185.153.197.208
-185.153.197.215
  185.153.197.32
  185.153.197.33
  185.153.197.52
+185.153.197.72
  185.153.198.229
  185.153.199.102
  185.153.199.132
  185.153.199.145
  185.153.199.146
  185.153.199.147
-185.153.199.155
-185.153.199.20
  185.153.199.252
-185.153.199.60
-185.153.199.86
+185.153.199.54
  185.153.199.94
-185.153.208.21
-185.153.208.26
  185.153.208.50
  185.153.242.11
  185.153.45.174
  185.154.111.28
+185.154.13.165
  185.154.131.4
  185.154.159.164
  185.154.204.242
@@ -68370,21 +64126,23 @@
  185.154.52.207
  185.154.53.147
  185.154.75.178
+185.155.122.52
  185.155.123.112
  185.155.34.129
  185.155.34.80
  185.155.81.203
  185.156.1.216
  185.156.173.116
-185.156.174.155
+185.156.174.115
+185.156.174.178
  185.156.179.206
  185.156.179.233
  185.156.214.34
  185.156.35.156
  185.156.35.77
-185.156.42.239
  185.156.72.3
  185.156.72.5
+185.156.72.7
  185.156.73.57
  185.156.73.60
  185.156.73.64
@@ -68395,8 +64153,6 @@
  185.157.171.71
  185.157.79.3
  185.158.104.169
-185.158.106.141
-185.158.107.180
  185.158.114.14
  185.158.114.184
  185.158.114.235
@@ -68404,6 +64160,11 @@
  185.158.115.191
  185.158.122.242
  185.158.152.159
+185.158.192.12
+185.158.192.136
+185.158.192.53
+185.158.192.71
+185.158.192.74
  185.158.248.80
  185.158.249.137
  185.158.249.171
@@ -68420,8 +64181,6 @@
  185.16.200.176
  185.16.204.58
  185.16.32.66
-185.16.37.135
-185.16.61.234
  185.160.229.240
  185.161.115.135
  185.161.208.127
@@ -68444,25 +64203,22 @@
  185.162.141.236
  185.162.141.25
  185.162.142.17
-185.162.142.81
  185.162.235.107
  185.162.235.109
  185.162.235.122
  185.162.235.150
  185.162.235.193
-185.162.235.64
  185.162.65.109
  185.162.8.125
  185.163.1.11
  185.163.126.12
+185.163.166.89
  185.163.45.42
-185.163.46.29
-185.164.138.21
-185.164.30.198
  185.164.56.29
  185.164.59.151
  185.164.72.222
  185.164.72.248
+185.164.74.21
  185.165.111.163
  185.165.125.47
  185.165.151.1
@@ -68470,7 +64226,6 @@
  185.165.168.196
  185.165.168.229
  185.165.168.77
-185.165.169.168
  185.165.169.83
  185.165.170.3
  185.165.172.38
@@ -68497,7 +64252,6 @@
  185.167.116.211
  185.167.116.61
  185.167.160.219
-185.167.33.167
  185.168.173.121
  185.168.173.122
  185.169.17.254
@@ -68528,12 +64282,11 @@
  185.17.32.140
  185.17.38.1
  185.170.114.25
-185.170.140.114
  185.170.210.47
  185.170.249.152
  185.170.42.18
+185.171.0.43
  185.171.0.75
-185.171.10.96
  185.171.105.212
  185.171.52.101
  185.171.54.26
@@ -68595,6 +64348,7 @@
  185.172.111.201
  185.172.111.202
  185.172.111.204
+185.172.111.205
  185.172.111.206
  185.172.111.209
  185.172.111.210
@@ -68609,7 +64363,6 @@
  185.172.111.226
  185.172.111.235
  185.172.144.12
-185.172.166.28
  185.172.215.74
  185.172.215.79
  185.172.56.213
@@ -68646,6 +64399,7 @@
  185.174.248.171
  185.174.248.175
  185.174.63.59
+185.175.105.89
  185.175.106.25
  185.175.222.58
  185.175.81.18
@@ -68679,7 +64433,6 @@
  185.180.196.143
  185.180.221.201
  185.180.221.7
-185.180.231.199
  185.180.231.42
  185.180.254.235
  185.181.10.234
@@ -68693,18 +64446,17 @@
  185.181.40.136
  185.181.40.137
  185.181.40.138
+185.181.40.139
  185.181.40.140
  185.181.40.195
  185.181.40.196
+185.181.41.134
  185.181.43.100
  185.181.61.140
-185.181.8.241
  185.182.56.123
-185.183.107.85
  185.183.111.148
  185.183.12.25
  185.183.16.47
-185.183.243.160
  185.183.243.45
  185.183.33.252
  185.183.95.199
@@ -68716,23 +64468,19 @@
  185.183.98.244
  185.183.99.214
  185.183.99.215
-185.184.12.132
  185.184.172.80
  185.184.24.77
  185.185.170.248
  185.185.170.27
  185.185.26.141
-185.185.40.211
  185.185.44.2
  185.186.142.137
  185.186.146.108
  185.186.17.36
  185.186.208.160
  185.186.240.174
-185.186.240.2
  185.186.244.218
  185.186.244.83
-185.186.245.227
  185.186.246.141
  185.186.69.114
  185.186.71.56
@@ -68791,14 +64539,15 @@
  185.189.252.121
  185.19.119.226
  185.19.176.237
+185.19.2.150
  185.19.24.111
-185.19.28.178
  185.19.28.195
  185.19.29.110
  185.19.30.68
  185.19.31.6
  185.19.78.160
  185.19.78.214
+185.19.85.134
  185.190.113.130
  185.190.152.159
  185.190.165.200
@@ -68807,7 +64556,6 @@
  185.191.126.241
  185.191.126.242
  185.191.126.243
-185.191.171.14
  185.191.204.254
  185.191.204.3
  185.191.32.155
@@ -68827,11 +64575,7 @@
  185.193.70.71
  185.193.88.29
  185.193.88.3
-185.193.90.122
-185.193.90.238
-185.193.90.250
  185.193.90.42
-185.193.90.62
  185.193.90.94
  185.193.91.122
  185.193.91.126
@@ -68857,6 +64601,7 @@
  185.195.53.216
  185.196.19.218
  185.197.142.50
+185.197.240.50
  185.197.243.172
  185.197.33.254
  185.198.0.168
@@ -68894,11 +64639,9 @@
  185.20.185.247
  185.20.187.20
  185.20.187.23
-185.20.222.54
  185.20.224.239
  185.20.245.90
  185.200.116.185
-185.200.117.169
  185.200.118.35
  185.200.118.36
  185.200.118.37
@@ -68951,13 +64694,16 @@
  185.200.37.181
  185.200.61.138
  185.200.73.232
-185.201.13.126
+185.201.11.227
+185.201.11.56
+185.201.136.181
  185.201.8.248
  185.201.89.122
  185.202.0.112
  185.202.0.78
  185.202.1.187
  185.202.1.6
+185.202.1.79
  185.202.101.40
  185.202.172.246
  185.202.174.84
@@ -68975,16 +64721,11 @@
  185.203.243.88
  185.204.1.74
  185.204.1.75
-185.204.118.116
  185.204.183.248
-185.204.2.153
-185.204.3.36
  185.204.56.34
  185.205.108.166
  185.205.108.206
-185.205.13.66
  185.205.17.17
-185.205.206.2
  185.205.209.166
  185.205.209.205
  185.205.209.215
@@ -69005,6 +64746,7 @@
  185.206.224.208
  185.206.224.216
  185.206.225.172
+185.206.227.180
  185.206.93.87
  185.207.177.2
  185.207.177.55
@@ -69015,7 +64757,6 @@
  185.208.100.47
  185.208.100.49
  185.208.100.72
-185.208.164.151
  185.208.174.134
  185.208.174.66
  185.208.182.54
@@ -69035,7 +64776,6 @@
  185.210.217.243
  185.210.217.246
  185.210.217.253
-185.210.217.3
  185.210.217.55
  185.210.217.61
  185.210.218.199
@@ -69045,7 +64785,6 @@
  185.211.48.17
  185.211.59.50
  185.211.59.7
-185.212.128.38
  185.212.129.198
  185.212.129.54
  185.212.130.34
@@ -69058,8 +64797,7 @@
  185.212.49.173
  185.213.155.163
  185.213.155.169
-185.213.191.208
-185.213.191.228
+185.213.73.150
  185.214.165.113
  185.214.166.158
  185.214.167.254
@@ -69069,7 +64807,6 @@
  185.215.227.107
  185.215.227.56
  185.215.227.77
-185.216.118.81
  185.216.119.235
  185.216.140.192
  185.216.140.240
@@ -69082,8 +64819,6 @@
  185.216.195.37
  185.216.215.10
  185.216.215.13
-185.216.25.122
-185.216.254.10
  185.216.32.130
  185.216.32.156
  185.216.33.135
@@ -69091,16 +64826,17 @@
  185.216.34.233
  185.216.35.232
  185.217.0.186
+185.217.1.114
  185.217.1.242
  185.217.1.243
  185.217.1.244
  185.217.1.245
  185.217.1.30
  185.217.160.233
-185.217.181.38
  185.217.188.147
  185.217.188.206
  185.217.188.252
+185.217.189.243
  185.217.191.61
  185.217.241.142
  185.217.90.140
@@ -69114,6 +64850,7 @@
  185.219.191.160
  185.219.81.127
  185.22.136.214
+185.22.152.170
  185.22.152.225
  185.22.172.137
  185.22.172.16
@@ -69265,7 +65002,6 @@
  185.220.50.253
  185.220.70.168
  185.220.87.179
-185.221.12.252
  185.221.201.34
  185.221.252.73
  185.222.202.104
@@ -69275,18 +65011,15 @@
  185.222.202.218
  185.222.210.27
  185.222.57.183
-185.222.57.211
  185.222.57.246
-185.222.57.250
  185.222.57.252
  185.222.58.102
  185.222.58.123
  185.222.58.134
-185.222.6.147
+185.222.58.158
  185.222.66.113
  185.222.66.121
  185.222.66.122
-185.223.28.123
  185.223.28.89
  185.223.29.137
  185.223.67.195
@@ -69315,32 +65048,34 @@
  185.225.38.226
  185.226.113.180
  185.226.145.140
+185.226.145.15
+185.226.145.152
+185.226.145.201
+185.226.145.207
+185.226.145.62
  185.226.196.92
  185.226.61.78
  185.226.90.141
  185.226.93.229
-185.227.109.215
-185.227.109.25
  185.227.109.30
  185.227.111.133
  185.227.118.181
  185.227.138.222
  185.227.68.78
-185.227.70.10
  185.227.82.32
  185.227.82.42
  185.228.113.65
  185.228.119.186
  185.228.133.4
  185.228.137.238
-185.228.153.46
  185.228.155.26
  185.228.4.195
  185.229.160.90
  185.229.243.106
  185.229.29.214
  185.23.106.140
-185.23.131.73
+185.23.131.133
+185.23.131.143
  185.23.151.171
  185.23.200.162
  185.23.40.12
@@ -69355,7 +65090,6 @@
  185.232.21.116
  185.232.21.118
  185.232.21.142
-185.232.21.147
  185.232.65.171
  185.232.65.192
  185.232.65.36
@@ -69368,7 +65102,6 @@
  185.233.27.25
  185.233.27.75
  185.233.91.26
-185.234.216.0
  185.234.216.198
  185.234.216.237
  185.234.216.42
@@ -69412,7 +65145,6 @@
  185.234.217.73
  185.234.217.74
  185.234.217.99
-185.234.218.0
  185.234.218.145
  185.234.218.247
  185.234.218.36
@@ -69420,10 +65152,6 @@
  185.234.218.41
  185.234.218.44
  185.234.218.50
-185.234.218.82
-185.234.218.83
-185.234.218.84
-185.234.218.85
  185.234.218.86
  185.234.219.0
  185.234.219.11
@@ -69440,6 +65168,7 @@
  185.234.219.28
  185.234.229.82
  185.234.72.64
+185.235.166.9
  185.235.241.221
  185.235.40.155
  185.236.202.151
@@ -69462,31 +65191,26 @@
  185.238.120.229
  185.238.128.48
  185.238.129.113
+185.238.131.19
  185.238.165.61
  185.238.165.86
-185.238.167.187
+185.238.167.50
+185.238.169.171
  185.238.171.97
-185.238.203.206
  185.238.250.200
-185.238.250.31
  185.238.29.11
  185.239.226.19
  185.239.227.63
  185.239.236.116
-185.239.236.206
  185.239.238.27
-185.239.242.114
  185.239.242.117
  185.239.242.121
  185.239.242.139
  185.239.242.149
  185.239.242.158
  185.239.242.16
-185.239.242.167
  185.239.242.174
-185.239.242.181
  185.239.242.188
-185.239.242.193
  185.239.242.195
  185.239.242.196
  185.239.242.197
@@ -69501,7 +65225,7 @@
  185.239.242.37
  185.239.242.50
  185.239.242.57
-185.239.242.69
+185.239.242.63
  185.239.242.73
  185.239.242.79
  185.239.242.87
@@ -69545,26 +65269,19 @@
  185.243.215.254
  185.243.215.38
  185.243.215.93
-185.243.241.141
-185.243.241.142
-185.243.241.155
  185.243.241.220
  185.243.241.3
-185.243.242.56
  185.243.56.115
-185.243.56.121
-185.243.57.184
  185.243.57.211
-185.243.8.98
  185.244.148.95
  185.244.150.165
  185.244.150.223
  185.244.150.241
  185.244.151.165
  185.244.151.83
+185.244.156.150
  185.244.165.250
  185.244.173.69
-185.244.175.147
  185.244.192.119
  185.244.214.115
  185.244.214.117
@@ -69576,6 +65293,7 @@
  185.244.214.248
  185.244.214.39
  185.244.214.40
+185.244.214.41
  185.244.214.42
  185.244.214.45
  185.244.214.46
@@ -69590,52 +65308,43 @@
  185.244.25.183
  185.244.25.185
  185.244.38.115
-185.244.39.106
  185.244.39.112
  185.244.39.123
  185.244.39.131
  185.244.39.14
  185.244.39.147
  185.244.39.166
+185.244.39.242
  185.244.39.52
  185.244.39.87
-185.244.41.10
-185.244.41.12
-185.244.41.13
-185.244.41.15
-185.244.41.18
-185.244.41.19
-185.244.41.20
-185.244.41.21
-185.244.41.6
  185.244.41.7
+185.244.43.124
+185.244.43.173
  185.244.43.183
  185.245.2.168
  185.245.246.169
  185.245.84.153
+185.245.85.139
  185.245.85.146
  185.245.85.32
  185.245.86.226
-185.245.96.220
-185.246.116.155
  185.246.128.26
  185.246.128.3
  185.246.231.28
  185.246.38.233
  185.246.65.34
-185.246.8.188
+185.246.8.183
+185.246.8.189
  185.246.8.211
  185.246.89.121
+185.246.9.18
+185.246.9.28
  185.246.9.4
-185.246.9.71
-185.246.9.8
  185.247.116.43
  185.247.119.10
  185.247.224.191
  185.247.228.36
-185.247.58.122
  185.248.103.100
-185.248.12.249
  185.248.140.206
  185.248.160.146
  185.248.160.21
@@ -69645,11 +65354,9 @@
  185.249.198.100
  185.249.198.170
  185.249.199.106
-185.249.42.43
  185.249.90.110
  185.25.148.240
  185.25.151.159
-185.25.206.242
  185.25.224.202
  185.25.48.114
  185.25.48.148
@@ -69666,7 +65373,6 @@
  185.25.51.155
  185.25.51.72
  185.250.106.208
-185.250.148.31
  185.250.206.56
  185.250.207.56
  185.250.221.105
@@ -69713,15 +65419,13 @@
  185.250.39.96
  185.250.39.97
  185.250.44.143
+185.250.44.163
  185.250.44.199
  185.250.45.82
-185.250.46.106
  185.250.47.213
-185.250.47.26
  185.250.47.38
  185.251.161.54
  185.251.39.230
-185.251.89.180
  185.252.101.3
  185.252.101.4
  185.252.112.165
@@ -69729,16 +65433,14 @@
  185.252.41.232
  185.252.77.220
  185.253.101.89
-185.253.184.106
  185.253.217.145
-185.253.224.13
  185.253.74.206
  185.253.97.246
-185.253.98.23
  185.253.99.148
  185.254.141.80
  185.254.44.102
  185.255.104.195
+185.255.107.35
  185.255.133.51
  185.255.135.33
  185.255.46.100
@@ -69747,6 +65449,7 @@
  185.255.47.27
  185.255.47.50
  185.255.96.50
+185.255.96.99
  185.26.126.48
  185.26.171.236
  185.26.197.11
@@ -69768,7 +65471,6 @@
  185.27.44.23
  185.27.60.83
  185.28.108.181
-185.28.196.15
  185.28.20.7
  185.29.11.145
  185.29.11.233
@@ -69784,32 +65486,25 @@
  185.29.9.171
  185.29.9.222
  185.3.133.11
-185.3.213.8
+185.3.134.149
  185.3.216.79
  185.3.38.194
-185.30.13.201
  185.30.166.38
  185.30.233.189
  185.30.233.233
  185.30.32.183
-185.30.45.178
-185.30.46.47
-185.30.47.158
+185.30.45.191
+185.30.45.245
+185.30.46.53
  185.30.83.110
  185.30.96.198
  185.31.166.155
  185.32.120.177
  185.32.124.152
-185.32.126.121
-185.32.126.122
-185.32.126.123
-185.32.126.129
  185.32.126.132
-185.32.126.187
-185.32.126.189
-185.32.126.193
  185.32.126.196
  185.32.126.198
+185.32.126.199
  185.32.137.88
  185.32.153.2
  185.32.165.78
@@ -69826,14 +65521,14 @@
  185.32.222.172
  185.32.222.173
  185.32.222.6
+185.32.222.7
  185.32.222.8
  185.32.231.84
+185.32.45.57
  185.32.63.21
  185.33.114.5
-185.33.144.232
  185.33.168.236
  185.33.168.237
-185.33.201.253
  185.33.251.94
  185.33.34.76
  185.34.17.184
@@ -69842,7 +65537,6 @@
  185.34.18.181
  185.34.192.176
  185.34.20.209
-185.34.20.65
  185.34.22.225
  185.34.33.2
  185.34.52.203
@@ -69853,7 +65547,7 @@
  185.35.142.70
  185.35.201.136
  185.35.202.222
-185.35.233.64
+185.35.217.51
  185.35.67.109
  185.35.78.77
  185.36.100.145
@@ -69861,12 +65555,12 @@
  185.36.189.6
  185.36.189.8
  185.36.191.0
+185.36.248.110
  185.36.55.210
  185.36.63.212
  185.36.81.174
  185.36.81.204
  185.36.81.33
-185.36.81.39
  185.36.81.42
  185.36.81.62
  185.36.81.92
@@ -69890,7 +65584,6 @@
  185.39.10.7
  185.39.10.73
  185.39.10.84
-185.39.10.87
  185.39.10.89
  185.39.10.90
  185.39.10.91
@@ -69898,7 +65591,6 @@
  185.39.11.109
  185.39.11.32
  185.39.11.63
-185.39.161.182
  185.39.212.172
  185.39.8.30
  185.4.132.135
@@ -69909,7 +65601,6 @@
  185.4.66.131
  185.40.241.48
  185.40.242.213
-185.40.242.238
  185.40.242.243
  185.40.4.108
  185.40.4.175
@@ -69923,7 +65614,6 @@
  185.42.223.211
  185.42.223.91
  185.42.224.195
-185.42.7.209
  185.43.108.13
  185.43.108.132
  185.43.108.133
@@ -69948,6 +65638,7 @@
  185.44.231.63
  185.44.231.68
  185.44.231.70
+185.44.76.187
  185.45.12.126
  185.45.165.225
  185.45.193.123
@@ -69966,19 +65657,18 @@
  185.46.149.234
  185.46.170.253
  185.46.18.99
-185.46.184.127
  185.46.222.74
  185.46.223.198
  185.46.84.181
  185.46.86.55
  185.47.184.253
+185.47.49.209
  185.47.65.30
  185.48.56.34
  185.49.14.190
  185.49.15.23
  185.49.156.141
  185.49.200.2
-185.49.240.20
  185.49.248.44
  185.49.84.133
  185.49.87.86
@@ -69990,9 +65680,7 @@
  185.5.101.161
  185.5.101.163
  185.5.101.167
-185.5.104.178
  185.5.166.28
-185.5.167.33
  185.5.19.234
  185.5.46.53
  185.5.55.219
@@ -70012,7 +65700,6 @@
  185.50.251.53
  185.50.37.152
  185.51.201.102
-185.51.201.115
  185.51.202.235
  185.51.246.4
  185.51.38.102
@@ -70023,17 +65710,15 @@
  185.51.92.84
  185.52.1.53
  185.52.1.89
-185.52.159.79
-185.52.2.130
  185.52.2.79
  185.52.55.237
  185.52.8.81
  185.53.152.189
-185.53.168.54
  185.53.168.96
  185.53.173.64
  185.53.178.12
  185.53.195.198
+185.53.231.117
  185.53.88.106
  185.53.88.182
  185.53.88.6
@@ -70044,8 +65729,6 @@
  185.55.242.187
  185.55.64.144
  185.56.136.106
-185.56.153.229
-185.56.153.236
  185.56.171.94
  185.56.80.233
  185.56.80.55
@@ -70055,15 +65738,12 @@
  185.56.82.14
  185.56.82.66
  185.56.82.82
-185.57.152.70
  185.57.166.177
+185.57.228.61
  185.57.29.193
  185.57.30.97
  185.57.70.149
-185.58.192.194
  185.58.216.182
-185.58.218.125
-185.58.226.235
  185.58.251.5
  185.58.4.8
  185.58.6.213
@@ -70076,12 +65756,12 @@
  185.59.221.66
  185.59.31.131
  185.59.44.23
+185.6.122.216
+185.6.148.189
  185.6.153.36
-185.6.172.152
  185.6.173.210
  185.60.135.103
  185.60.170.150
-185.60.247.109
  185.61.137.165
  185.61.138.104
  185.61.148.69
@@ -70100,6 +65780,7 @@
  185.61.92.228
  185.61.94.65
  185.61.94.70
+185.62.129.179
  185.62.136.25
  185.62.136.26
  185.62.188.193
@@ -70120,7 +65801,6 @@
  185.63.253.201
  185.63.253.26
  185.63.254.15
-185.63.46.250
  185.63.96.216
  185.64.104.18
  185.64.104.227
@@ -70128,6 +65808,8 @@
  185.64.104.234
  185.64.116.15
  185.64.18.25
+185.64.208.147
+185.64.221.26
  185.64.238.229
  185.64.247.43
  185.65.132.100
@@ -70147,8 +65829,8 @@
  185.66.230.206
  185.66.233.61
  185.66.56.3
-185.66.56.4
  185.66.57.102
+185.66.57.104
  185.66.57.107
  185.66.57.111
  185.66.57.114
@@ -70156,27 +65838,26 @@
  185.66.57.118
  185.66.57.122
  185.66.57.128
-185.66.57.130
+185.66.57.131
  185.66.57.138
  185.66.57.140
  185.66.57.146
  185.66.57.148
  185.66.57.155
-185.66.57.157
  185.66.57.158
  185.66.57.168
-185.66.57.176
+185.66.57.171
+185.66.57.179
  185.66.57.183
+185.66.57.185
  185.66.57.186
  185.66.57.195
  185.66.57.196
-185.66.57.198
  185.66.57.250
  185.66.58.100
  185.66.58.102
  185.66.58.108
  185.66.58.120
-185.66.58.122
  185.66.58.124
  185.66.58.131
  185.66.58.134
@@ -70185,8 +65866,8 @@
  185.66.58.150
  185.66.58.153
  185.66.58.162
+185.66.58.164
  185.66.58.166
-185.66.58.172
  185.66.58.174
  185.66.58.177
  185.66.58.182
@@ -70197,9 +65878,9 @@
  185.66.59.208
  185.66.59.215
  185.66.59.225
-185.66.59.229
-185.66.59.251
-185.66.59.252
+185.66.59.228
+185.66.59.230
+185.66.59.253
  185.66.59.254
  185.67.238.138
  185.67.45.160
@@ -70211,7 +65892,6 @@
  185.68.93.27
  185.69.154.206
  185.69.168.112
-185.69.24.243
  185.69.245.35
  185.69.247.219
  185.69.54.231
@@ -70223,11 +65903,8 @@
  185.70.185.34
  185.70.185.56
  185.70.189.82
-185.71.30.42
  185.72.224.86
  185.73.168.163
-185.73.207.28
-185.74.101.151
  185.74.145.29
  185.74.4.17
  185.74.4.189
@@ -70294,6 +65971,7 @@
  185.81.157.167
  185.81.157.170
  185.81.157.171
+185.81.157.175
  185.81.157.189
  185.81.157.19
  185.81.157.208
@@ -70307,13 +65985,12 @@
  185.81.158.101
  185.81.158.120
  185.81.158.124
+185.81.158.139
  185.81.163.180
  185.81.34.183
  185.81.95.180
  185.81.96.46
-185.82.127.31
  185.82.200.52
-185.82.201.152
  185.82.202.102
  185.82.202.109
  185.82.202.132
@@ -70330,20 +66007,19 @@
  185.82.202.6
  185.82.202.74
  185.82.212.95
-185.82.213.6
  185.82.216.149
  185.82.217.39
+185.82.218.186
+185.82.218.187
  185.82.218.192
  185.82.219.109
  185.82.219.12
-185.82.226.136
-185.82.250.195
  185.82.99.178
  185.83.13.24
  185.83.145.92
+185.83.186.93
  185.83.88.251
  185.83.88.252
-185.84.221.20
  185.85.0.8
  185.85.152.241
  185.85.152.247
@@ -70351,15 +66027,11 @@
  185.85.162.242
  185.85.163.224
  185.85.189.90
-185.85.191.201
  185.85.191.82
  185.85.219.74
-185.85.238.244
-185.85.239.110
  185.85.3.140
  185.85.38.54
  185.86.13.213
-185.86.145.191
  185.86.148.172
  185.86.148.227
  185.86.148.235
@@ -70375,11 +66047,7 @@
  185.86.150.192
  185.86.151.146
  185.86.151.152
-185.86.164.103
-185.86.164.109
-185.86.164.99
  185.86.166.174
-185.86.167.4
  185.86.180.167
  185.86.36.73
  185.87.122.86
@@ -70393,19 +66061,17 @@
  185.88.101.125
  185.88.101.126
  185.88.101.131
-185.88.101.161
  185.88.105.40
  185.88.158.227
  185.88.159.85
  185.88.177.111
  185.88.179.172
-185.88.36.80
  185.88.37.139
+185.88.37.157
  185.88.37.165
  185.88.37.215
  185.88.37.237
  185.88.37.24
-185.88.37.69
  185.88.37.99
  185.89.0.22
  185.89.0.237
@@ -70417,7 +66083,10 @@
  185.89.100.228
  185.89.100.69
  185.89.100.97
+185.89.101.215
  185.89.101.226
+185.89.101.229
+185.89.101.237
  185.89.101.60
  185.89.101.94
  185.89.124.10
@@ -70429,7 +66098,6 @@
  185.9.51.4
  185.9.62.140
  185.9.90.193
-185.90.132.84
  185.90.161.92
  185.90.210.112
  185.90.240.6
@@ -70439,7 +66107,6 @@
  185.91.166.37
  185.91.197.167
  185.91.252.109
-185.91.80.181
  185.92.220.7
  185.92.73.100
  185.92.73.125
@@ -70462,16 +66129,15 @@
  185.94.215.235
  185.94.218.57
  185.94.219.160
-185.94.244.171
  185.94.252.12
  185.94.252.13
  185.94.252.27
  185.94.88.158
  185.94.97.190
  185.94.98.98
-185.95.156.166
+185.95.156.168
  185.95.156.194
-185.95.156.20
+185.95.156.202
  185.95.162.84
  185.95.187.220
  185.95.219.53
@@ -70489,14 +66155,9 @@
  185.96.55.121
  185.96.6.106
  185.97.113.5
-185.97.115.186
-185.97.116.109
-185.97.119.150
  185.97.12.130
  185.97.134.30
  185.97.134.4
-185.97.66.142
-185.98.1.141
  185.98.226.3
  185.98.26.21
  185.99.184.150
@@ -70509,14 +66170,13 @@
  186.0.112.175
  186.0.113.244
  186.0.148.251
-186.0.176.147
  186.0.176.225
  186.0.181.134
  186.0.185.135
-186.0.231.139
  186.0.70.107
  186.0.74.77
  186.0.88.128
+186.0.89.194
  186.0.95.172
  186.1.10.218
  186.1.181.242
@@ -70525,9 +66185,9 @@
  186.1.41.143
  186.1.49.99
  186.1.5.35
-186.1.7.20
  186.10.0.116
  186.10.102.198
+186.10.122.210
  186.10.125.209
  186.10.151.254
  186.10.22.250
@@ -70543,19 +66203,14 @@
  186.101.16.90
  186.101.213.156
  186.101.229.202
-186.101.233.134
-186.101.32.102
  186.103.141.250
  186.103.144.133
  186.103.148.204
-186.103.184.227
  186.103.215.118
  186.103.234.178
-186.107.14.230
  186.109.88.187
  186.113.21.156
  186.114.184.195
-186.116.13.64
  186.116.150.98
  186.119.116.226
  186.119.119.233
@@ -70575,13 +66230,11 @@
  186.121.251.75
  186.122.148.216
  186.122.148.9
-186.122.149.144
  186.122.149.191
  186.122.57.83
  186.123.166.82
  186.123.80.25
  186.123.83.47
-186.124.218.207
  186.124.239.80
  186.125.171.245
  186.125.59.8
@@ -70593,17 +66246,15 @@
  186.136.250.31
  186.136.45.239
  186.137.79.39
-186.138.103.30
  186.138.116.146
  186.138.132.148
  186.138.170.18
  186.138.186.74
-186.138.193.216
  186.138.224.119
+186.138.237.235
  186.139.169.241
  186.139.183.56
  186.139.216.13
-186.139.218.8
  186.139.227.247
  186.139.46.155
  186.145.120.68
@@ -70611,17 +66262,12 @@
  186.145.239.237
  186.145.241.133
  186.145.254.158
-186.146.1.122
  186.146.1.186
  186.146.2.111
-186.146.229.172
  186.147.129.110
  186.147.160.161
  186.147.160.189
-186.147.160.195
  186.147.161.171
-186.147.162.18
-186.147.236.4
  186.147.35.76
  186.148.162.100
  186.148.172.19
@@ -70630,6 +66276,7 @@
  186.149.199.90
  186.15.116.27
  186.15.133.180
+186.15.133.208
  186.15.148.229
  186.15.149.25
  186.15.162.45
@@ -70646,7 +66293,6 @@
  186.151.197.189
  186.151.218.93
  186.153.124.124
-186.153.96.176
  186.154.1.11
  186.154.197.178
  186.154.221.154
@@ -70656,7 +66302,6 @@
  186.154.33.131
  186.154.33.235
  186.154.34.157
-186.154.35.255
  186.154.35.97
  186.154.36.143
  186.154.36.144
@@ -70667,7 +66312,6 @@
  186.154.38.137
  186.154.40.229
  186.154.49.103
-186.154.6.73
  186.154.73.232
  186.154.73.83
  186.154.74.30
@@ -70676,9 +66320,7 @@
  186.155.12.5
  186.155.13.16
  186.155.13.225
-186.155.14.115
  186.155.14.231
-186.155.15.39
  186.155.15.78
  186.155.16.17
  186.155.16.187
@@ -70713,13 +66355,11 @@
  186.159.246.121
  186.159.3.193
  186.159.3.41
-186.159.5.161
  186.159.8.218
  186.16.209.222
  186.167.16.242
  186.167.33.244
  186.167.48.45
-186.168.170.203
  186.168.178.196
  186.170.184.127
  186.170.28.46
@@ -70729,27 +66369,24 @@
  186.177.165.196
  186.178.4.190
  186.178.57.211
-186.178.61.168
-186.178.62.231
  186.178.62.42
  186.179.100.104
-186.179.100.156
-186.179.100.208
-186.179.100.217
-186.179.100.86
+186.179.100.147
+186.179.100.229
+186.179.100.252
  186.179.103.118
  186.179.103.14
  186.179.112.254
  186.179.118.59
+186.179.194.5
  186.179.219.105
  186.179.219.86
  186.179.243.112
  186.179.243.77
  186.179.253.150
-186.179.74.190
+186.179.97.242
  186.18.224.149
  186.18.253.51
-186.18.41.1
  186.182.106.5
  186.182.140.18
  186.183.151.2
@@ -70761,17 +66398,12 @@
  186.189.139.167
  186.189.193.193
  186.189.195.45
-186.189.208.246
-186.189.224.80
  186.189.233.28
  186.189.235.210
-186.189.238.152
  186.189.249.2
  186.19.134.70
  186.19.14.180
-186.19.189.97
-186.19.190.108
-186.19.224.152
+186.190.224.116
  186.190.224.130
  186.192.17.242
  186.192.195.252
@@ -70785,29 +66417,33 @@
  186.192.98.250
  186.193.120.80
  186.193.130.58
-186.193.136.152
  186.193.155.207
  186.193.181.215
  186.193.2.22
  186.193.2.25
  186.193.226.59
+186.193.228.75
  186.193.229.123
  186.193.24.136
  186.193.7.110
  186.193.8.100
  186.193.8.106
  186.193.8.113
+186.193.8.115
  186.193.8.116
  186.193.8.118
  186.194.116.54
  186.194.22.70
-186.194.235.46
  186.194.26.240
+186.195.59.223
+186.2.251.253
+186.20.154.22
  186.200.181.130
  186.200.205.170
  186.200.65.242
  186.200.68.34
  186.201.31.186
+186.201.4.42
  186.201.43.66
  186.201.78.13
  186.204.29.230
@@ -70817,8 +66453,6 @@
  186.206.108.115
  186.206.129.160
  186.206.129.189
-186.206.131.61
-186.206.139.166
  186.206.157.14
  186.206.164.39
  186.207.131.216
@@ -70844,8 +66478,8 @@
  186.209.133.238
  186.209.135.4
  186.209.61.87
-186.209.76.16
  186.209.88.222
+186.210.10.204
  186.210.10.46
  186.210.10.82
  186.210.153.43
@@ -70877,10 +66511,8 @@
  186.212.144.226
  186.212.182.98
  186.212.185.192
-186.212.185.52
  186.212.207.21
  186.213.152.70
-186.213.154.17
  186.213.158.136
  186.213.24.136
  186.214.7.55
@@ -70900,21 +66532,12 @@
  186.215.70.67
  186.216.67.142
  186.216.67.241
-186.216.67.57
-186.216.68.109
+186.216.67.36
  186.216.68.147
  186.216.68.218
-186.216.69.230
  186.216.69.240
-186.216.69.247
-186.216.69.25
-186.216.69.61
  186.216.70.122
  186.216.70.137
-186.216.70.140
-186.216.70.153
-186.216.70.200
-186.216.71.224
  186.216.81.21
  186.216.82.107
  186.219.103.166
@@ -70931,7 +66554,6 @@
  186.219.211.6
  186.219.211.9
  186.219.214.94
-186.219.3.65
  186.219.3.68
  186.219.3.73
  186.219.3.74
@@ -70945,28 +66567,25 @@
  186.219.99.12
  186.22.198.141
  186.220.212.101
+186.222.217.146
  186.222.224.238
  186.222.50.187
  186.223.144.163
  186.223.144.185
-186.223.161.185
-186.223.164.152
-186.223.164.247
-186.223.165.121
  186.223.248.8
+186.224.159.114
  186.224.18.180
  186.224.225.98
-186.224.238.253
  186.224.238.32
  186.224.240.53
  186.224.247.74
  186.224.249.215
+186.224.249.234
  186.224.250.31
  186.224.80.30
  186.224.9.73
  186.225.100.74
  186.225.102.187
-186.225.102.58
  186.225.124.90
  186.225.135.54
  186.225.146.173
@@ -70994,9 +66613,10 @@
  186.225.61.182
  186.225.63.134
  186.225.80.194
+186.225.83.25
  186.225.98.234
-186.226.145.228
  186.226.160.4
+186.226.164.33
  186.226.167.12
  186.226.170.240
  186.226.171.94
@@ -71008,16 +66628,14 @@
  186.226.188.138
  186.226.227.199
  186.226.228.187
+186.226.229.202
  186.226.229.3
  186.226.37.125
  186.226.37.187
-186.226.37.206
-186.227.130.11
+186.227.137.15
  186.227.148.107
-186.227.160.29
  186.227.161.38
  186.227.166.154
-186.227.195.190
  186.227.252.53
  186.227.55.214
  186.228.147.58
@@ -71041,22 +66659,21 @@
  186.233.169.4
  186.233.176.26
  186.233.222.226
-186.233.73.117
+186.233.53.104
  186.233.94.46
  186.233.98.146
  186.233.98.173
  186.234.249.196
+186.234.80.90
  186.235.43.7
  186.235.53.196
  186.235.59.134
+186.235.62.161
  186.235.84.34
  186.236.14.68
-186.236.14.8
  186.236.162.5
-186.236.20.135
  186.236.23.188
  186.236.237.248
-186.236.48.242
  186.237.114.95
  186.237.129.26
  186.237.131.122
@@ -71075,10 +66692,9 @@
  186.237.79.76
  186.237.87.238
  186.238.23.10
-186.239.155.106
+186.238.31.10
  186.24.218.195
  186.24.34.227
-186.24.44.114
  186.24.5.98
  186.24.50.164
  186.24.6.36
@@ -71091,7 +66707,6 @@
  186.248.175.138
  186.248.175.152
  186.248.175.3
-186.248.75.42
  186.249.13.62
  186.249.180.104
  186.249.181.38
@@ -71110,27 +66725,17 @@
  186.249.231.162
  186.249.240.146
  186.250.105.160
-186.250.158.198
-186.250.158.234
  186.250.161.254
  186.250.161.69
  186.250.161.70
  186.250.163.72
  186.250.17.103
-186.250.193.133
-186.250.193.28
  186.250.200.69
-186.250.200.75
-186.250.201.231
-186.250.202.134
-186.250.202.150
  186.250.202.163
  186.250.203.133
-186.250.203.138
-186.250.203.8
  186.250.203.90
  186.250.213.254
-186.250.239.225
+186.250.222.40
  186.250.253.42
  186.250.253.49
  186.250.253.53
@@ -71139,7 +66744,6 @@
  186.250.55.5
  186.250.56.135
  186.251.135.7
-186.251.162.137
  186.251.166.245
  186.251.208.121
  186.251.208.139
@@ -71148,6 +66752,7 @@
  186.251.229.2
  186.251.247.58
  186.251.248.15
+186.251.253.234
  186.251.253.53
  186.251.254.233
  186.251.254.253
@@ -71155,7 +66760,8 @@
  186.251.255.101
  186.251.255.105
  186.251.255.113
-186.251.255.125
+186.251.255.121
+186.251.255.129
  186.251.255.133
  186.251.255.137
  186.251.255.141
@@ -71166,11 +66772,9 @@
  186.251.255.185
  186.251.255.189
  186.251.255.197
-186.251.255.201
-186.251.255.209
-186.251.255.21
  186.251.255.217
  186.251.255.221
+186.251.255.233
  186.251.255.237
  186.251.255.241
  186.251.255.245
@@ -71179,13 +66783,12 @@
  186.251.255.49
  186.251.255.53
  186.251.255.57
-186.251.255.61
  186.251.255.65
  186.251.255.73
  186.251.255.77
  186.251.255.81
-186.251.255.89
  186.251.255.97
+186.251.3.31
  186.26.124.170
  186.28.125.169
  186.28.126.232
@@ -71195,12 +66798,12 @@
  186.28.29.171
  186.28.4.180
  186.28.61.116
+186.28.79.30
  186.29.135.133
  186.29.135.64
  186.29.139.197
  186.29.143.70
  186.29.163.97
-186.29.180.244
  186.29.181.165
  186.29.181.19
  186.29.182.154
@@ -71213,9 +66816,7 @@
  186.29.34.136
  186.29.70.82
  186.29.70.85
-186.3.12.54
  186.3.123.66
-186.3.131.61
  186.3.142.2
  186.3.147.10
  186.3.147.251
@@ -71236,7 +66837,6 @@
  186.31.116.154
  186.31.160.233
  186.31.163.130
-186.31.36.242
  186.31.40.183
  186.31.43.123
  186.32.36.68
@@ -71259,22 +66859,18 @@
  186.38.26.5
  186.38.38.2
  186.38.38.33
+186.38.38.65
  186.4.136.153
  186.4.147.40
-186.4.148.195
  186.4.162.165
  186.4.172.5
  186.4.183.12
  186.4.186.222
-186.4.188.3
  186.4.192.202
  186.4.222.45
-186.4.233.17
  186.4.235.4
-186.4.242.37
  186.42.101.234
  186.42.120.170
-186.42.123.195
  186.42.124.130
  186.42.161.30
  186.42.174.162
@@ -71296,7 +66892,6 @@
  186.46.3.238
  186.46.85.194
  186.47.102.166
-186.47.153.126
  186.47.208.50
  186.47.212.166
  186.47.213.34
@@ -71308,12 +66903,15 @@
  186.5.203.1
  186.5.204.2
  186.5.207.1
+186.5.249.176
  186.50.47.170
+186.51.116.67
  186.53.148.112
  186.53.28.35
-186.56.10.51
  186.58.144.249
+186.58.164.52
  186.58.172.230
+186.58.188.219
  186.58.208.239
  186.58.238.34
  186.58.75.91
@@ -71324,12 +66922,8 @@
  186.61.46.33
  186.64.118.125
  186.64.119.85
-186.64.121.21
  186.64.165.203
-186.65.117.139
-186.66.162.127
  186.66.171.22
-186.66.176.239
  186.66.185.208
  186.66.20.125
  186.66.200.13
@@ -71350,10 +66944,7 @@
  186.66.254.9
  186.66.26.204
  186.66.27.211
-186.66.29.151
  186.66.29.213
-186.66.35.252
-186.66.36.41
  186.66.36.83
  186.66.4.4
  186.66.40.228
@@ -71372,19 +66963,13 @@
  186.67.74.53
  186.67.77.171
  186.67.9.172
-186.68.0.161
  186.68.113.181
-186.68.115.220
-186.68.12.68
  186.68.126.224
-186.68.126.3
  186.68.136.121
  186.68.136.180
  186.68.136.90
-186.68.14.151
  186.68.141.218
  186.68.143.2
-186.68.148.150
  186.68.152.11
  186.68.171.255
  186.68.172.144
@@ -71393,7 +66978,6 @@
  186.68.182.174
  186.68.182.183
  186.68.188.4
-186.68.188.44
  186.68.188.77
  186.68.193.10
  186.68.193.11
@@ -71428,21 +67012,15 @@
  186.68.42.228
  186.68.59.144
  186.68.65.200
-186.68.67.121
-186.68.67.18
  186.68.74.178
  186.68.82.162
  186.68.93.46
  186.68.96.11
  186.68.97.15
-186.69.106.160
-186.69.149.246
  186.69.189.30
  186.69.189.60
-186.69.196.123
  186.69.212.40
  186.69.212.9
-186.69.220.130
  186.69.250.15
  186.69.28.125
  186.69.58.182
@@ -71450,7 +67028,6 @@
  186.69.60.244
  186.69.80.245
  186.7.22.92
-186.7.226.138
  186.7.253.196
  186.70.112.126
  186.70.112.61
@@ -71469,7 +67046,6 @@
  186.70.145.7
  186.70.149.168
  186.70.153.203
-186.70.171.90
  186.70.173.90
  186.70.174.118
  186.70.174.146
@@ -71483,34 +67059,22 @@
  186.70.175.212
  186.70.175.235
  186.70.196.113
-186.70.197.174
-186.70.211.3
  186.70.213.170
  186.70.216.82
  186.70.225.18
  186.70.228.139
  186.70.233.130
-186.70.237.193
  186.70.239.219
-186.70.24.28
  186.70.243.126
  186.70.245.16
  186.70.25.24
  186.70.250.152
  186.70.251.129
  186.70.252.120
-186.70.252.211
-186.70.253.25
-186.70.34.59
-186.70.34.9
  186.70.40.197
-186.70.42.141
-186.70.51.181
  186.70.56.94
  186.70.59.232
-186.70.89.89
  186.71.106.229
-186.71.107.227
  186.71.113.42
  186.71.139.125
  186.71.144.66
@@ -71523,7 +67087,6 @@
  186.71.215.220
  186.71.228.152
  186.71.231.120
-186.71.231.26
  186.71.233.23
  186.71.240.100
  186.71.252.111
@@ -71549,16 +67112,12 @@
  186.83.133.72
  186.83.138.45
  186.83.66.200
-186.83.66.217
-186.84.172.25
  186.84.172.7
  186.84.173.153
  186.84.21.164
  186.85.149.21
-186.85.159.135
  186.86.247.169
  186.87.132.34
-186.87.32.48
  186.88.114.124
  186.88.137.195
  186.88.33.21
@@ -71566,10 +67125,12 @@
  186.89.10.78
  186.89.212.45
  186.9.11.188
+186.90.102.38
  186.90.29.228
  186.91.201.210
  186.91.240.234
  186.91.44.36
+186.92.218.246
  186.92.225.185
  186.93.74.12
  186.94.42.146
@@ -71579,6 +67140,7 @@
  186.96.109.181
  186.96.110.5
  186.96.127.221
+186.96.192.246
  186.96.254.239
  186.96.72.166
  186.96.98.160
@@ -71587,34 +67149,32 @@
  186181.com
  18655.aqq.ru
  186bahsegel.com
-187.0.160.130
  187.0.177.153
  187.0.184.250
  187.0.195.66
  187.1.188.158
-187.1.30.134
  187.1.81.155
  187.1.81.161
  187.10.133.100
  187.10.135.26
  187.10.217.1
  187.10.237.178
-187.10.25.193
  187.10.72.201
  187.10.72.50
  187.101.169.83
-187.101.22.2
  187.102.146.222
  187.102.16.70
+187.102.24.251
  187.102.71.1
  187.102.71.12
  187.102.96.95
  187.103.0.234
  187.103.15.17
  187.103.15.54
-187.103.73.133
  187.103.74.137
+187.103.81.33
  187.103.81.4
+187.103.82.100
  187.103.82.104
  187.103.82.110
  187.103.82.73
@@ -71625,9 +67185,10 @@
  187.106.203.217
  187.106.81.102
  187.107.186.87
+187.107.53.241
  187.107.68.86
  187.108.118.60
-187.108.211.117
+187.108.203.53
  187.108.218.32
  187.108.223.12
  187.108.38.170
@@ -71637,26 +67198,20 @@
  187.108.76.136
  187.109.10.100
  187.109.107.209
-187.109.114.29
  187.109.181.77
  187.109.192.254
-187.109.21.245
  187.109.245.67
-187.109.253.246
  187.109.36.248
  187.109.36.251
  187.109.40.9
  187.109.46.62
-187.11.124.60
  187.11.216.80
  187.11.232.71
-187.11.242.196
  187.110.208.2
  187.110.238.251
  187.111.160.10
  187.111.160.23
  187.111.160.29
-187.111.160.6
  187.111.160.8
  187.111.161.84
  187.111.192.125
@@ -71679,25 +67234,27 @@
  187.111.193.88
  187.111.193.90
  187.111.193.92
-187.111.223.148
-187.111.28.202
+187.111.54.110
  187.112.103.216
  187.112.128.229
  187.112.150.8
  187.112.197.90
  187.112.31.18
-187.113.117.31
+187.113.102.243
  187.113.217.79
-187.114.136.242
+187.113.249.116
  187.114.245.38
+187.114.25.25
  187.115.10.50
  187.115.122.2
+187.115.160.220
  187.115.18.6
  187.116.96.186
  187.119.191.48
  187.12.157.82
  187.12.167.85
  187.12.181.106
+187.12.216.126
  187.120.116.54
  187.120.137.190
  187.120.143.207
@@ -71735,6 +67292,7 @@
  187.121.109.251
  187.121.114.250
  187.121.115.165
+187.121.121.154
  187.121.121.224
  187.121.122.183
  187.121.122.8
@@ -71743,6 +67301,7 @@
  187.121.75.116
  187.121.78.146
  187.121.80.98
+187.121.86.218
  187.121.88.117
  187.121.91.99
  187.121.92.197
@@ -71753,7 +67312,6 @@
  187.123.164.217
  187.123.167.16
  187.123.56.57
-187.125.100.253
  187.125.106.34
  187.130.139.197
  187.131.192.59
@@ -71765,6 +67323,7 @@
  187.133.59.220
  187.134.216.118
  187.134.43.157
+187.134.58.51
  187.136.254.218
  187.137.149.202
  187.137.161.233
@@ -71779,16 +67338,10 @@
  187.137.71.110
  187.138.81.50
  187.139.236.151
-187.140.8.8
  187.141.128.42
-187.141.135.181
-187.141.53.35
  187.142.15.136
-187.142.21.226
  187.142.7.84
  187.143.75.193
-187.144.214.236
-187.144.236.101
  187.144.50.63
  187.145.118.104
  187.146.152.197
@@ -71802,12 +67355,10 @@
  187.148.90.241
  187.149.12.83
  187.149.223.239
-187.149.46.206
  187.149.50.65
  187.149.72.101
  187.149.73.15
  187.150.24.210
-187.150.30.199
  187.151.25.61
  187.151.38.34
  187.151.7.126
@@ -71821,28 +67372,27 @@
  187.153.106.71
  187.153.142.123
  187.153.173.170
+187.153.191.170
  187.153.20.144
  187.153.3.184
  187.153.86.240
  187.154.245.224
  187.154.250.196
-187.155.200.84
  187.157.115.238
  187.157.189.84
  187.158.21.71
+187.159.10.106
  187.159.122.29
  187.159.126.52
  187.159.193.66
  187.159.220.221
  187.159.39.67
+187.159.43.163
  187.159.47.38
-187.16.108.154
  187.16.109.209
  187.16.189.36
  187.16.255.199
  187.16.4.126
-187.16.43.242
-187.16.96.35
  187.160.140.130
  187.160.239.75
  187.160.245.156
@@ -71857,7 +67407,6 @@
  187.162.251.26
  187.162.41.111
  187.162.44.90
-187.162.51.63
  187.162.61.184
  187.162.96.23
  187.163.124.62
@@ -71872,22 +67421,18 @@
  187.17.168.58
  187.17.19.90
  187.17.63.66
-187.170.146.54
+187.170.147.171
  187.170.147.84
-187.170.150.162
-187.170.150.178
  187.170.16.34
  187.170.186.5
-187.170.226.205
-187.170.235.77
  187.170.252.41
+187.170.7.203
  187.170.76.13
  187.170.92.199
  187.171.177.119
  187.171.190.128
  187.174.176.238
  187.174.215.147
-187.174.219.142
  187.174.65.4
  187.176.185.65
  187.177.155.123
@@ -71896,10 +67441,7 @@
  187.178.238.192
  187.178.241.208
  187.178.242.57
-187.178.25.88
  187.178.69.224
-187.18.108.73
-187.18.115.25
  187.18.116.158
  187.18.125.34
  187.180.181.220
@@ -71907,17 +67449,20 @@
  187.180.92.7
  187.181.189.182
  187.182.114.105
-187.185.224.2
+187.182.121.25
+187.184.172.154
  187.185.68.99
  187.188.10.169
  187.188.102.237
  187.188.102.9
  187.188.107.115
  187.188.111.161
+187.188.115.81
  187.188.116.224
  187.188.124.229
  187.188.148.188
  187.188.16.178
+187.188.160.98
  187.188.166.192
  187.188.167.138
  187.188.168.69
@@ -71926,23 +67471,17 @@
  187.188.179.141
  187.188.182.87
  187.188.190.217
-187.188.193.211
  187.188.195.27
  187.188.200.2
-187.188.206.106
-187.188.213.38
  187.188.213.4
  187.188.240.7
  187.188.241.216
-187.188.35.120
-187.188.48.220
  187.188.50.40
  187.188.59.12
-187.188.83.115
  187.188.90.141
  187.189.108.139
-187.189.11.49
  187.189.11.69
+187.189.110.16
  187.189.111.251
  187.189.131.34
  187.189.136.120
@@ -71950,86 +67489,78 @@
  187.189.149.224
  187.189.153.136
  187.189.170.100
-187.189.176.171
  187.189.178.28
  187.189.178.37
  187.189.184.243
  187.189.190.69
+187.189.193.216
  187.189.195.208
  187.189.197.211
  187.189.211.33
  187.189.228.110
  187.189.228.190
  187.189.228.25
-187.189.233.242
-187.189.237.7
  187.189.241.135
  187.189.241.98
  187.189.243.167
  187.189.243.22
  187.189.26.198
  187.189.35.36
-187.189.41.11
  187.189.45.8
  187.189.51.117
-187.189.52.132
  187.189.52.17
  187.189.52.49
  187.189.60.10
-187.189.61.8
  187.189.64.71
-187.189.65.241
-187.189.65.51
-187.189.7.31
  187.189.74.203
  187.189.75.245
  187.189.82.7
  187.189.83.154
  187.189.92.38
+187.19.0.2
  187.19.114.2
-187.19.12.123
  187.19.127.178
  187.19.127.180
  187.19.127.222
  187.19.127.238
  187.19.127.253
-187.19.13.96
  187.19.150.221
-187.19.155.106
  187.19.167.56
-187.19.197.144
+187.19.197.145
  187.19.197.148
  187.19.197.50
-187.19.198.6
  187.19.202.42
  187.19.203.194
+187.19.204.146
  187.19.204.23
  187.19.205.226
+187.19.219.60
+187.19.235.121
  187.19.6.150
  187.190.109.142
  187.190.109.201
+187.190.114.244
  187.190.137.200
  187.190.159.248
  187.190.165.109
  187.190.176.19
  187.190.184.189
  187.190.187.34
-187.190.206.252
  187.190.236.88
  187.190.237.67
  187.190.237.69
  187.190.237.71
-187.190.239.55
  187.190.249.106
  187.190.250.138
  187.190.254.161
+187.190.255.230
  187.190.40.101
  187.190.48.12
+187.190.48.20
  187.190.48.251
  187.190.48.62
  187.190.58.39
-187.190.95.126
-187.191.0.108
+187.191.0.13
  187.191.20.10
  187.191.20.12
  187.191.20.14
@@ -72037,10 +67568,9 @@
  187.191.4.88
  187.191.96.60
  187.192.119.193
+187.193.120.178
  187.193.221.143
-187.194.135.21
  187.194.203.167
-187.194.244.59
  187.194.80.233
  187.195.231.121
  187.195.241.51
@@ -72049,7 +67579,6 @@
  187.198.66.118
  187.199.198.153
  187.199.208.125
-187.199.59.92
  187.199.65.185
  187.199.92.175
  187.2.112.107
@@ -72058,8 +67587,7 @@
  187.20.18.160
  187.20.210.240
  187.200.135.130
-187.200.151.119
-187.200.65.242
+187.200.142.58
  187.201.138.28
  187.201.3.104
  187.202.145.24
@@ -72067,20 +67595,10 @@
  187.202.243.187
  187.202.61.24
  187.204.244.209
-187.204.3.250
-187.204.48.243
  187.205.167.91
  187.205.61.225
  187.205.62.204
  187.205.79.241
-187.207.120.133
-187.207.136.190
-187.207.144.205
-187.207.163.224
-187.207.177.131
-187.207.181.244
-187.207.183.58
-187.207.196.25
  187.207.197.195
  187.207.207.129
  187.207.242.6
@@ -72094,14 +67612,12 @@
  187.210.122.62
  187.210.226.214
  187.210.82.3
-187.210.83.194
-187.212.108.232
-187.212.197.136
  187.212.207.109
  187.212.226.176
  187.212.24.35
  187.213.126.146
  187.213.204.150
+187.213.94.58
  187.214.150.224
  187.216.81.178
  187.216.81.180
@@ -72111,8 +67627,6 @@
  187.216.81.188
  187.216.81.189
  187.216.81.190
-187.216.90.46
-187.216.93.20
  187.217.199.20
  187.217.246.82
  187.217.88.134
@@ -72122,12 +67636,10 @@
  187.220.129.254
  187.220.73.211
  187.225.157.241
-187.225.166.245
  187.225.181.113
  187.225.187.171
  187.226.133.154
  187.226.204.82
-187.227.114.56
  187.227.16.96
  187.227.4.47
  187.228.128.122
@@ -72151,15 +67663,14 @@
  187.237.16.197
  187.237.164.212
  187.237.164.37
-187.243.250.197
  187.243.250.222
  187.243.253.182
-187.243.255.174
-187.243.6.106
+187.245.140.28
  187.247.158.247
  187.247.231.220
-187.248.75.228
+187.247.242.27
  187.248.80.173
+187.25.240.141
  187.250.154.103
  187.250.17.247
  187.250.44.163
@@ -72168,23 +67679,26 @@
  187.254.15.2
  187.254.15.41
  187.255.1.124
+187.26.2.136
+187.27.216.134
  187.32.153.90
  187.32.160.173
  187.32.161.77
+187.32.17.105
  187.32.175.203
  187.32.227.4
  187.32.48.59
  187.32.58.98
  187.32.63.186
+187.32.85.66
  187.33.160.252
  187.33.202.36
  187.33.208.180
  187.33.245.2
  187.33.60.201
-187.34.249.201
  187.34.28.177
  187.34.5.218
-187.35.129.125
+187.35.176.89
  187.35.188.203
  187.35.30.33
  187.36.111.60
@@ -72192,8 +67706,6 @@
  187.36.186.3
  187.36.34.175
  187.37.38.154
-187.37.71.95
-187.38.172.64
  187.38.53.245
  187.39.146.201
  187.39.147.104
@@ -72228,7 +67740,6 @@
  187.44.89.211
  187.44.93.223
  187.45.10.138
-187.45.103.15
  187.45.106.54
  187.45.116.207
  187.45.123.110
@@ -72238,28 +67749,26 @@
  187.45.147.193
  187.45.193.159
  187.45.24.131
+187.45.68.166
+187.45.96.8
  187.49.207.65
-187.49.226.17
  187.5.199.200
  187.5.25.200
-187.5.3.56
  187.50.136.210
  187.50.45.130
  187.51.12.106
  187.52.70.252
+187.53.60.82
  187.54.225.76
  187.54.30.83
-187.54.72.197
  187.54.74.23
-187.55.216.3
  187.55.223.76
-187.56.79.31
  187.57.209.32
  187.57.210.101
-187.57.247.78
  187.58.107.22
  187.58.107.81
  187.58.132.251
+187.58.152.82
  187.58.199.228
  187.58.20.218
  187.58.28.162
@@ -72268,7 +67777,6 @@
  187.59.247.185
  187.6.213.88
  187.60.145.49
-187.60.169.230
  187.60.34.234
  187.60.36.164
  187.60.43.94
@@ -72291,15 +67799,15 @@
  187.63.10.28
  187.63.232.64
  187.63.233.110
-187.63.34.149
  187.63.47.230
+187.63.9.19
  187.65.151.91
  187.65.22.214
  187.65.49.88
  187.65.55.231
  187.66.128.85
  187.66.86.49
-187.68.123.154
+187.68.110.14
  187.68.37.234
  187.68.45.39
  187.68.48.235
@@ -72309,8 +67817,6 @@
  187.69.24.117
  187.7.213.24
  187.70.130.98
-187.70.228.103
-187.71.104.116
  187.71.223.192
  187.71.47.50
  187.71.60.11
@@ -72322,13 +67828,13 @@
  187.72.223.28
  187.72.231.193
  187.72.239.185
+187.72.243.97
  187.72.253.112
  187.72.53.89
  187.72.66.1
  187.72.66.11
  187.72.66.16
  187.72.66.2
-187.72.66.9
  187.72.89.126
  187.73.151.178
  187.73.199.164
@@ -72338,7 +67844,7 @@
  187.73.214.161
  187.73.222.193
  187.73.68.14
-187.73.71.24
+187.73.74.13
  187.74.130.211
  187.74.132.130
  187.74.132.139
@@ -72356,9 +67862,9 @@
  187.78.25.17
  187.8.113.122
  187.8.116.12
+187.8.168.140
  187.8.182.30
  187.8.226.10
-187.84.126.8
  187.84.132.20
  187.84.141.140
  187.84.141.141
@@ -72371,6 +67877,7 @@
  187.84.191.177
  187.84.191.2
  187.84.191.225
+187.84.191.25
  187.84.191.29
  187.84.191.41
  187.84.191.50
@@ -72389,25 +67896,23 @@
  187.86.129.132
  187.86.129.134
  187.86.171.227
-187.86.200.250
  187.86.200.42
  187.86.201.4
  187.87.15.164
  187.87.15.85
-187.87.2.242
+187.87.2.96
  187.87.204.202
  187.87.204.205
  187.87.204.211
  187.87.204.212
  187.87.204.216
  187.87.204.220
-187.87.206.10
  187.87.5.218
  187.87.7.116
+187.87.7.214
  187.87.84.51
  187.9.6.157
  187.9.86.122
-187.91.19.175
  187.93.176.2
  187.94.102.102
  187.94.16.5
@@ -72421,7 +67926,6 @@
  187.95.114.125
  187.95.123.122
  187.95.124.103
-187.95.124.230
  187.95.162.2
  187.95.194.123
  187.95.194.125
@@ -72439,9 +67943,9 @@
  1875-financeinvest.com
  187bahsegel.com
  188.0.110.50
-188.0.128.53
  188.0.135.237
  188.0.152.32
+188.0.188.122
  188.0.191.81
  188.0.238.62
  188.0.238.71
@@ -72451,13 +67955,13 @@
  188.10.210.132
  188.10.231.246
  188.10.32.1
-188.108.54.203
  188.11.61.14
-188.112.10.120
  188.112.145.230
  188.112.148.163
+188.112.9.185
  188.113.106.183
  188.113.116.133
+188.113.119.31
  188.113.154.189
  188.113.158.112
  188.113.176.12
@@ -72491,20 +67995,16 @@
  188.120.219.108
  188.120.224.201
  188.120.232.181
-188.120.233.138
  188.120.233.37
  188.120.235.117
  188.120.235.130
-188.120.235.217
  188.120.243.11
  188.121.16.216
-188.121.16.85
  188.121.3.75
  188.121.57.10
  188.121.57.5
  188.121.8.146
  188.122.2.55
-188.122.240.7
  188.122.82.146
  188.123.121.16
  188.124.10.46
@@ -72515,7 +68015,6 @@
  188.124.42.119
  188.124.69.201
  188.125.107.117
-188.125.174.185
  188.126.240.95
  188.126.45.161
  188.126.73.10
@@ -72537,6 +68036,7 @@
  188.126.73.219
  188.126.80.11
  188.126.81.155
+188.126.89.194
  188.126.89.4
  188.126.94.176
  188.126.94.68
@@ -72549,40 +68049,36 @@
  188.127.232.71
  188.127.237.128
  188.127.239.3
-188.127.247.60
  188.127.249.210
  188.127.37.94
  188.128.202.35.bc.googleusercontent.com
-188.128.39.113
  188.128.39.127
-188.128.43.28
  188.128.83.10
  188.129.153.88
  188.129.161.55
  188.129.192.132
  188.129.246.244
-188.129.34.213
  188.13.91.61
+188.130.128.190
  188.130.136.251
+188.130.142.250
  188.130.149.125
+188.130.185.151
  188.130.185.220
  188.130.187.210
+188.130.188.72
  188.130.197.199
  188.130.219.223
-188.130.220.235
  188.130.254.66
  188.130.7.221
  188.131.129.184
  188.131.130.100
-188.131.131.191
  188.131.131.228
  188.131.131.52
-188.131.131.59
  188.131.132.83
  188.131.133.196
  188.131.133.79
  188.131.134.216
-188.131.135.18
  188.131.135.213
  188.131.135.227
  188.131.136.191
@@ -72604,27 +68100,22 @@
  188.131.157.61
  188.131.160.154
  188.131.160.183
-188.131.160.94
  188.131.169.178
  188.131.171.47
  188.131.173.220
-188.131.176.36
  188.131.176.62
  188.131.177.130
  188.131.177.59
-188.131.178.32
  188.131.179.87
-188.131.180.15
  188.131.183.217
  188.131.191.40
  188.131.192.122
  188.131.192.131
+188.131.193.22
  188.131.204.154
  188.131.218.217
  188.131.233.36
  188.131.235.218
-188.131.239.119
-188.131.244.11
  188.131.246.128
  188.131.247.56
  188.132.219.172
@@ -72635,6 +68126,7 @@
  188.134.34.43
  188.134.5.47
  188.134.6.84
+188.134.75.152
  188.134.8.36
  188.134.81.196
  188.134.83.45
@@ -72662,7 +68154,6 @@
  188.138.88.42
  188.138.88.47
  188.138.92.211
-188.138.95.39
  188.141.233.87
  188.141.240.59
  188.141.34.156
@@ -73192,7 +68683,8 @@
  188.148.176.13
  188.148.182.134
  188.148.183.118
-188.148.8.201
+188.148.228.50
+188.149.167.44
  188.149.29.155
  188.149.29.172
  188.149.29.228
@@ -73200,13 +68692,13 @@
  188.149.75.83
  188.15.185.140
  188.15.22.45
-188.150.240.54
  188.151.1.5
  188.151.242.70
  188.151.32.51
  188.151.41.56
  188.151.6.88
  188.151.7.63
+188.152.101.150
  188.152.189.220
  188.152.209.66
  188.152.27.111
@@ -73220,7 +68712,6 @@
  188.155.1.237
  188.155.219.114
  188.155.91.186
-188.156.97.88
  188.157.101.114
  188.157.143.144
  188.157.194.52
@@ -73251,12 +68742,13 @@
  188.16.75.20
  188.161.216.64
  188.161.217.47
-188.161.72.140
  188.163.104.113
  188.163.170.130
  188.163.19.0
  188.163.42.254
  188.163.74.184
+188.163.83.70
+188.165.11.130
  188.165.11.196
  188.165.119.138
  188.165.119.36
@@ -73264,10 +68756,6 @@
  188.165.138.11
  188.165.140.127
  188.165.141.219
-188.165.141.33
-188.165.162.97
-188.165.162.99
-188.165.169.238
  188.165.180.120
  188.165.196.203
  188.165.198.108
@@ -73276,7 +68764,6 @@
  188.165.207.127
  188.165.210.14
  188.165.210.176
-188.165.211.206
  188.165.212.171
  188.165.218.62
  188.165.222.158
@@ -73285,10 +68772,7 @@
  188.165.229.5
  188.165.230.116
  188.165.230.24
-188.165.232.202
-188.165.236.122
  188.165.238.140
-188.165.238.199
  188.165.239.119
  188.165.239.211
  188.165.24.200
@@ -73298,7 +68782,6 @@
  188.165.246.50
  188.165.247.31
  188.165.25.196
-188.165.251.208
  188.165.255.8
  188.165.27.218
  188.165.29.122
@@ -73306,18 +68789,17 @@
  188.165.42.223
  188.165.46.18
  188.165.50.197
-188.165.51.56
  188.165.56.214
  188.165.73.28
  188.165.89.65
  188.165.95.14
  188.166.0.135
-188.166.1.140
  188.166.1.171
  188.166.1.95
  188.166.10.218
  188.166.100.231
  188.166.100.65
+188.166.101.23
  188.166.101.78
  188.166.102.103
  188.166.102.232
@@ -73341,7 +68823,6 @@
  188.166.116.147
  188.166.117.154
  188.166.117.161
-188.166.117.213
  188.166.118.131
  188.166.119.140
  188.166.119.244
@@ -73350,15 +68831,10 @@
  188.166.121.60
  188.166.144.207
  188.166.145.53
-188.166.147.211
  188.166.150.17
  188.166.150.241
  188.166.150.243
-188.166.150.254
  188.166.153.212
-188.166.153.254
-188.166.157.12
-188.166.157.39
  188.166.159.127
  188.166.16.36
  188.166.161.103
@@ -73367,7 +68843,7 @@
  188.166.170.70
  188.166.172.189
  188.166.172.79
-188.166.175.35
+188.166.177.22
  188.166.177.99
  188.166.178.124
  188.166.178.39
@@ -73375,13 +68851,14 @@
  188.166.179.105
  188.166.18.102
  188.166.181.190
+188.166.182.113
  188.166.182.246
+188.166.182.56
+188.166.182.77
  188.166.182.84
  188.166.183.217
  188.166.183.237
-188.166.185.157
  188.166.185.236
-188.166.186.179
  188.166.186.85
  188.166.187.179
  188.166.188.185
@@ -73391,6 +68868,7 @@
  188.166.190.166
  188.166.190.187
  188.166.190.221
+188.166.190.237
  188.166.191.147
  188.166.191.195
  188.166.193.249
@@ -73405,7 +68883,6 @@
  188.166.209.251
  188.166.209.76
  188.166.21.143
-188.166.21.197
  188.166.21.245
  188.166.21.247
  188.166.210.143
@@ -73433,28 +68910,21 @@
  188.166.223.102
  188.166.223.220
  188.166.224.191
-188.166.224.24
  188.166.224.51
  188.166.225.221
  188.166.225.238
  188.166.225.37
  188.166.226.188
-188.166.226.209
-188.166.226.26
  188.166.226.67
-188.166.227.130
  188.166.229.193
  188.166.229.254
  188.166.23.215
  188.166.230.60
-188.166.231.134
  188.166.231.212
  188.166.231.248
  188.166.231.44
-188.166.232.14
  188.166.232.158
  188.166.232.159
-188.166.232.195
  188.166.233.216
  188.166.234.1
  188.166.234.135
@@ -73462,7 +68932,6 @@
  188.166.235.123
  188.166.235.139
  188.166.235.141
-188.166.236.182
  188.166.236.56
  188.166.236.57
  188.166.237.0
@@ -73474,15 +68943,12 @@
  188.166.240.66
  188.166.241.194
  188.166.242.30
-188.166.243.156
  188.166.244.121
  188.166.244.203
  188.166.244.9
  188.166.245.183
  188.166.246.158
-188.166.246.22
  188.166.246.32
-188.166.246.46
  188.166.247.41
  188.166.247.82
  188.166.248.126
@@ -73495,10 +68961,12 @@
  188.166.251.91
  188.166.252.13
  188.166.253.195
-188.166.254.200
+188.166.254.170
  188.166.254.248
+188.166.254.252
  188.166.255.113
  188.166.255.227
+188.166.255.49
  188.166.255.77
  188.166.27.111
  188.166.3.185
@@ -73530,6 +68998,7 @@
  188.166.53.127
  188.166.55.212
  188.166.56.189
+188.166.56.218
  188.166.56.221
  188.166.58.130
  188.166.58.159
@@ -73539,6 +69008,7 @@
  188.166.58.29
  188.166.58.96
  188.166.6.130
+188.166.60.138
  188.166.61.141
  188.166.61.49
  188.166.64.245
@@ -73562,7 +69032,6 @@
  188.166.74.148
  188.166.74.250
  188.166.74.51
-188.166.75.134
  188.166.76.123
  188.166.76.35
  188.166.77.159
@@ -73613,7 +69082,6 @@
  188.166.99.62
  188.166.99.74
  188.167.158.203
-188.168.172.184
  188.168.173.110
  188.168.27.71
  188.168.27.73
@@ -73641,6 +69109,7 @@
  188.169.179.107
  188.169.179.127
  188.169.179.14
+188.169.179.144
  188.169.179.214
  188.169.179.220
  188.169.179.48
@@ -73679,6 +69148,7 @@
  188.169.45.241
  188.169.45.57
  188.169.45.8
+188.169.45.89
  188.169.45.92
  188.169.61.108
  188.169.61.115
@@ -73694,41 +69164,41 @@
  188.169.76.166
  188.17.100.97
  188.17.148.154
+188.17.152.15
+188.17.152.30
  188.17.155.103
  188.17.168.75
  188.170.122.155
  188.170.13.225
  188.170.183.138
-188.170.189.26
  188.170.189.28
  188.170.193.178
  188.170.196.0
-188.170.208.210
  188.170.28.69
  188.170.41.6
  188.170.52.188
  188.170.63.9
  188.170.8.109
+188.172.156.126
  188.172.220.69
  188.172.220.70
  188.172.220.71
  188.172.246.67
  188.172.94.56
  188.173.14.99
-188.173.176.84
  188.173.215.77
  188.173.80.134
  188.173.84.9
  188.173.97.144
  188.174.103.98
  188.174.20.160
-188.174.6.221
+188.174.3.56
  188.177.179.8
  188.178.169.129
  188.179.204.169
  188.18.104.70
+188.18.104.73
  188.18.105.202
-188.18.105.229
  188.18.23.189
  188.18.54.130
  188.18.54.242
@@ -73741,9 +69211,8 @@
  188.187.0.42
  188.187.108.131
  188.187.144.193
-188.187.190.220
  188.187.62.173
-188.188.112.194
+188.188.112.21
  188.188.112.73
  188.19.124.120
  188.19.13.56
@@ -73777,6 +69246,7 @@
  188.19.185.107
  188.19.185.110
  188.19.185.113
+188.19.185.200
  188.19.185.83
  188.19.185.87
  188.19.186.151
@@ -73809,7 +69279,6 @@
  188.190.81.135
  188.191.103.67
  188.191.166.23
-188.191.18.129
  188.191.202.129
  188.191.204.198
  188.191.204.72
@@ -73830,10 +69299,9 @@
  188.191.239.92
  188.192.12.35
  188.192.175.128
+188.192.44.142
  188.192.46.137
  188.193.117.90
-188.193.166.68
-188.193.167.36
  188.194.188.22
  188.194.56.118
  188.194.58.113
@@ -73845,12 +69313,11 @@
  188.209.255.241
  188.209.49.164
  188.21.152.205
-188.210.52.37
+188.210.49.206
  188.212.100.2
  188.213.134.114
  188.213.134.164
  188.213.170.40
-188.213.173.52
  188.213.34.109
  188.213.34.23
  188.213.34.36
@@ -73876,7 +69343,6 @@
  188.214.30.238
  188.214.30.78
  188.215.232.1
-188.215.51.242
  188.215.70.115
  188.215.83.52
  188.216.254.72
@@ -73902,7 +69368,6 @@
  188.218.47.5
  188.218.83.160
  188.219.117.26
-188.219.251.4
  188.219.31.12
  188.220.230.46
  188.221.63.121
@@ -73939,13 +69404,10 @@
  188.226.180.234
  188.226.188.45
  188.226.192.115
-188.226.197.249
  188.226.199.22
  188.226.233.196
  188.226.250.187
  188.227.106.56
-188.227.124.32
-188.227.124.53
  188.227.170.139
  188.227.193.27
  188.227.193.35
@@ -73957,7 +69419,6 @@
  188.228.192.194
  188.23.40.134
  188.230.103.90
-188.230.122.84
  188.230.140.199
  188.230.141.9
  188.230.168.114
@@ -73965,6 +69426,7 @@
  188.230.189.138
  188.230.241.10
  188.231.191.134
+188.232.169.169
  188.233.191.121
  188.234.134.42
  188.234.134.47
@@ -73989,7 +69451,6 @@
  188.235.61.22
  188.235.61.25
  188.235.76.27
-188.235.8.5
  188.237.119.104
  188.237.135.3
  188.237.190.44
@@ -74006,7 +69467,6 @@
  188.240.210.192
  188.240.24.236
  188.240.26.111
-188.241.121.171
  188.241.24.13
  188.241.39.65
  188.241.45.61
@@ -74028,18 +69488,13 @@
  188.243.32.211
  188.243.58.75
  188.244.11.106
-188.244.144.90
  188.244.190.98
  188.244.20.242
  188.244.21.196
  188.244.22.48
-188.244.229.130
-188.244.38.187
  188.246.181.50
  188.246.20.122
  188.246.224.126
-188.246.224.140
-188.246.224.185
  188.246.224.29
  188.246.226.71
  188.246.236.122
@@ -74056,16 +69511,10 @@
  188.250.249.131
  188.251.213.180
  188.252.64.154
-188.254.0.112
  188.254.0.116
-188.254.0.124
  188.254.0.160
  188.254.0.182
-188.254.0.183
-188.254.0.197
  188.254.0.2
-188.254.110.205
-188.254.110.243
  188.254.110.77
  188.254.159.122
  188.254.159.164
@@ -74076,31 +69525,37 @@
  188.255.120.102
  188.255.120.9
  188.255.131.128
-188.255.131.157
-188.255.131.185
-188.255.131.61
+188.255.131.149
+188.255.131.174
+188.255.131.228
+188.255.131.231
+188.255.131.66
  188.255.131.87
+188.255.132.1
  188.255.132.104
  188.255.132.11
-188.255.132.127
  188.255.132.14
-188.255.132.146
-188.255.132.171
+188.255.132.15
+188.255.132.157
+188.255.132.172
  188.255.132.204
-188.255.132.242
+188.255.132.209
+188.255.132.30
+188.255.132.7
  188.255.132.88
  188.255.132.89
  188.255.132.91
+188.255.19.216
+188.255.237.102
  188.255.237.107
-188.255.237.151
-188.255.237.162
+188.255.237.115
  188.255.237.179
-188.255.237.213
-188.255.237.222
+188.255.237.181
+188.255.237.183
+188.255.237.251
  188.255.237.59
  188.255.36.78
  188.255.4.208
-188.255.87.214
  188.26.102.85
  188.26.105.108
  188.26.106.150
@@ -74109,6 +69564,7 @@
  188.26.5.254
  188.26.6.188
  188.26.7.21
+188.27.107.169
  188.27.137.163
  188.27.227.38
  188.27.235.141
@@ -74117,13 +69573,12 @@
  188.27.86.27
  188.3.101.110
  188.3.36.167
+188.31.78.164
  188.32.121.140
  188.32.128.165
  188.32.128.29
  188.32.145.79
  188.35.167.7
-188.35.187.50
-188.37.166.236
  188.37.24.190
  188.38.102.54
  188.38.134.252
@@ -74153,27 +69608,26 @@
  188.43.51.154
  188.43.52.166
  188.44.13.253
-188.49.6.216
  188.50.127.101
  188.50.161.202
  188.50.246.4
-188.50.251.7
+188.50.27.65
  188.51.37.120
  188.51.41.172
  188.51.66.194
  188.51.92.191
  188.52.47.47
+188.53.31.161
  188.53.7.172
  188.53.88.202
  188.54.75.83
+188.55.247.78
  188.55.47.202
  188.59.106.244
  188.59.186.124
  188.59.189.40
  188.59.38.227
  188.59.38.231
-188.6.133.212
-188.6.161.77
  188.6.164.138
  188.6.91.94
  188.60.212.140
@@ -74201,9 +69655,8 @@
  188.65.74.60
  188.65.85.4
  188.65.89.101
+188.67.2.199
  188.68.118.177
-188.68.185.100
-188.68.211.235
  188.68.216.61
  188.68.217.63
  188.68.45.143
@@ -74212,7 +69665,6 @@
  188.68.56.223
  188.69.135.214
  188.69.231.104
-188.71.2.203
  188.72.202.147
  188.72.6.98
  188.72.82.196
@@ -74231,7 +69683,6 @@
  188.80.27.54
  188.82.169.152
  188.82.39.247
-188.83.195.193
  188.83.199.187
  188.83.202.25
  188.84.151.76
@@ -74239,9 +69690,10 @@
  188.85.137.146
  188.85.143.170
  188.85.166.88
+188.85.218.246
+188.9.65.88
  188.9.71.68
  188.92.190.38
-188.92.209.161
  188.92.209.195
  188.92.214.10
  188.92.244.38
@@ -74249,14 +69701,12 @@
  188.92.75.219
  188.92.77.235
  188.93.104.2
-188.93.104.86
  188.93.111.77
  188.93.133.214
  188.93.208.12
  188.93.233.162
  188.93.233.165
  188.93.234.203
-188.93.235.237
  188.93.238.17
  188.93.238.29
  188.93.64.242
@@ -74267,17 +69717,14 @@
  188.95.20.84
  188.95.234.6
  188.97.166.176
-188.98.117.201
  18850306919.mer.lstest.siquality.com
  18850306929.mer.lstest.siquality.com
  188elexusbet.blogspot.com
  188winerium.com
  189.1.123.19
-189.1.132.75
  189.1.152.26
  189.1.162.2
  189.1.163.101
-189.1.167.23
  189.1.175.69
  189.100.253.150
  189.100.68.157
@@ -74293,9 +69740,6 @@
  189.11.126.17
  189.111.105.208
  189.111.223.25
-189.111.254.129
-189.112.109.185
-189.112.109.189
  189.112.125.131
  189.112.125.209
  189.112.125.212
@@ -74304,8 +69748,6 @@
  189.112.175.105
  189.112.179.115
  189.112.196.1
-189.112.228.153
-189.112.244.24
  189.112.4.168
  189.112.47.20
  189.112.72.29
@@ -74336,6 +69778,7 @@
  189.113.185.3
  189.113.185.36
  189.113.185.52
+189.113.185.54
  189.113.185.60
  189.113.185.62
  189.113.185.76
@@ -74380,6 +69823,8 @@
  189.113.187.37
  189.113.187.51
  189.113.187.64
+189.113.187.65
+189.113.187.97
  189.113.2.23
  189.113.217.35
  189.113.32.117
@@ -74387,12 +69832,12 @@
  189.114.157.22
  189.114.204.100
  189.114.67.195
+189.114.67.217
  189.114.72.96
  189.115.120.155
  189.115.129.6
  189.115.144.95
  189.115.151.156
-189.120.134.221
  189.120.91.67
  189.121.174.91
  189.121.226.181
@@ -74407,12 +69852,11 @@
  189.124.180.40
  189.124.20.186
  189.124.21.173
+189.124.221.252
  189.124.8.180
  189.124.8.192
  189.124.94.171
-189.125.93.12
  189.126.168.43
-189.126.169.139
  189.126.173.41
  189.126.195.70
  189.126.43.64
@@ -74421,7 +69865,6 @@
  189.126.70.202
  189.126.71.203
  189.126.72.148
-189.126.73.51
  189.127.106.16
  189.127.107.43
  189.127.128.226
@@ -74432,11 +69875,9 @@
  189.128.24.69
  189.128.40.114
  189.128.43.191
-189.129.138.193
  189.129.199.13
  189.130.0.89
  189.130.104.70
-189.130.120.155
  189.130.168.33
  189.130.200.243
  189.130.233.146
@@ -74447,19 +69888,20 @@
  189.131.117.75
  189.131.16.8
  189.131.192.235
+189.131.202.0
  189.131.202.44
  189.131.235.125
  189.131.254.186
  189.132.111.232
  189.132.112.125
  189.132.181.36
+189.132.19.74
  189.132.194.152
  189.132.215.192
  189.132.22.31
  189.132.25.94
  189.132.27.158
  189.132.59.220
-189.132.9.16
  189.134.1.255
  189.134.32.244
  189.134.38.156
@@ -74468,7 +69910,6 @@
  189.135.128.65
  189.135.174.63
  189.135.177.224
-189.135.197.7
  189.135.233.171
  189.135.26.187
  189.136.227.141
@@ -74478,10 +69919,10 @@
  189.139.104.34
  189.139.106.62
  189.139.118.189
-189.139.162.245
  189.139.33.248
+189.139.74.188
+189.14.120.129
  189.14.122.4
-189.14.193.242
  189.14.193.94
  189.14.194.113
  189.14.253.154
@@ -74499,7 +69940,6 @@
  189.146.183.121
  189.146.41.176
  189.146.72.13
-189.147.245.28
  189.147.71.95
  189.147.94.196
  189.148.103.223
@@ -74519,11 +69959,11 @@
  189.15.27.166
  189.15.30.106
  189.15.48.53
-189.15.49.9
  189.15.50.203
  189.15.50.65
  189.15.51.215
  189.15.54.171
+189.15.68.224
  189.151.196.196
  189.151.210.170
  189.151.42.249
@@ -74561,25 +70001,18 @@
  189.162.183.5
  189.163.187.189
  189.163.22.106
-189.163.44.102
-189.164.110.79
  189.164.130.229
  189.164.131.241
-189.164.139.126
  189.164.145.194
-189.164.156.106
-189.164.187.3
-189.164.196.91
  189.164.212.162
+189.164.230.106
  189.166.212.235
  189.167.230.200
  189.167.3.120
  189.17.42.19
  189.170.126.209
  189.170.5.155
-189.170.72.30
  189.170.79.21
-189.170.88.178
  189.171.25.104
  189.171.65.89
  189.172.38.251
@@ -74590,7 +70023,6 @@
  189.173.150.78
  189.173.18.229
  189.173.23.88
-189.173.44.69
  189.173.58.119
  189.173.65.60
  189.173.81.33
@@ -74610,17 +70042,16 @@
  189.178.1.1
  189.178.113.25
  189.178.114.46
-189.178.117.244
  189.178.117.65
  189.178.120.194
  189.178.138.180
-189.178.157.245
  189.178.160.30
  189.178.202.196
  189.178.206.211
  189.178.207.63
  189.178.245.189
  189.178.249.239
+189.178.28.103
  189.178.29.227
  189.178.38.57
  189.178.46.164
@@ -74628,12 +70059,14 @@
  189.178.70.36
  189.178.80.188
  189.178.82.69
+189.178.90.135
  189.178.95.196
  189.179.127.202
  189.179.169.238
  189.179.229.196
  189.179.239.219
  189.179.248.243
+189.179.251.112
  189.179.253.183
  189.179.254.234
  189.179.31.215
@@ -74642,7 +70075,6 @@
  189.18.179.196
  189.18.180.111
  189.18.209.111
-189.18.209.133
  189.18.209.251
  189.18.3.28
  189.18.91.218
@@ -74650,8 +70082,7 @@
  189.180.114.184
  189.180.116.59
  189.180.34.244
-189.180.4.150
-189.186.12.111
+189.181.94.242
  189.186.13.31
  189.186.28.63
  189.186.56.26
@@ -74665,23 +70096,21 @@
  189.189.219.35
  189.189.8.73
  189.19.220.75
+189.190.212.21
  189.190.231.191
  189.190.52.73
-189.191.0.16
  189.191.56.155
  189.192.133.225
  189.194.190.56
-189.194.48.26
  189.194.58.119
+189.194.93.154
  189.195.143.166
  189.195.161.24
-189.195.41.134
  189.196.91.122
  189.197.60.58
  189.198.134.214
  189.198.135.158
  189.198.138.118
-189.198.28.119
  189.198.7.143
  189.198.86.146
  189.198.93.183
@@ -74701,28 +70130,28 @@
  189.201.191.69
  189.201.242.186
  189.201.242.24
+189.201.248.170
  189.201.250.173
  189.201.251.247
-189.202.204.230
  189.202.204.88
  189.202.204.94
  189.202.84.115
  189.203.105.93
  189.203.130.134
  189.203.145.131
+189.203.164.116
  189.203.182.73
  189.203.194.2
  189.203.235.205
  189.203.237.120
  189.203.240.2
-189.203.240.84
  189.203.26.46
+189.203.37.16
  189.203.72.138
  189.203.73.102
  189.203.79.116
  189.204.141.211
  189.204.49.40
-189.204.52.235
  189.205.111.44
  189.205.249.204
  189.206.147.226
@@ -74730,7 +70159,6 @@
  189.206.166.12
  189.206.216.18
  189.206.216.20
-189.207.103.22
  189.207.242.90
  189.207.250.88
  189.207.37.10
@@ -74759,8 +70187,7 @@
  189.213.85.3
  189.213.92.76
  189.214.64.34
-189.216.199.52
-189.216.204.57
+189.216.115.169
  189.218.107.128
  189.218.156.138
  189.219.147.141
@@ -74784,6 +70211,7 @@
  189.225.162.157
  189.225.165.129
  189.226.103.220
+189.226.116.196
  189.226.117.38
  189.226.5.76
  189.226.61.161
@@ -74798,8 +70226,10 @@
  189.232.48.230
  189.232.75.111
  189.235.87.72
+189.236.110.195
  189.236.122.23
  189.236.153.30
+189.236.160.251
  189.236.206.143
  189.236.21.208
  189.236.212.18
@@ -74808,7 +70238,6 @@
  189.236.31.206
  189.236.32.128
  189.236.4.142
-189.237.113.4
  189.237.235.233
  189.237.240.89
  189.238.240.62
@@ -74822,7 +70251,6 @@
  189.240.15.66
  189.240.225.205
  189.240.62.227
-189.241.242.170
  189.243.10.187
  189.243.115.185
  189.243.126.116
@@ -74830,6 +70258,7 @@
  189.243.139.30
  189.243.19.253
  189.243.244.127
+189.243.51.211
  189.243.55.149
  189.243.63.0
  189.243.64.103
@@ -74861,8 +70290,8 @@
  189.253.16.65
  189.253.233.203
  189.253.86.161
+189.253.92.225
  189.254.117.97
-189.254.149.228
  189.254.177.90
  189.254.242.60
  189.254.255.168
@@ -74872,7 +70301,6 @@
  189.26.251.122
  189.26.78.155
  189.27.178.1
-189.28.166.216
  189.28.186.26
  189.29.240.144
  189.29.243.14
@@ -74880,7 +70308,6 @@
  189.30.181.98
  189.31.20.254
  189.32.214.28
-189.33.163.168
  189.33.53.14
  189.33.54.19
  189.34.104.177
@@ -74893,8 +70320,6 @@
  189.38.88.105
  189.38.90.83
  189.39.102.67
-189.39.112.219
-189.39.112.94
  189.39.127.118
  189.39.177.11
  189.39.216.61
@@ -74914,14 +70339,12 @@
  189.41.210.170
  189.41.213.117
  189.41.214.194
-189.41.245.51
  189.41.6.207
+189.41.67.131
  189.41.7.233
  189.41.7.53
  189.41.77.133
-189.43.102.34
  189.43.48.2
-189.43.68.12
  189.44.178.170
  189.45.144.26
  189.45.172.100
@@ -74929,21 +70352,24 @@
  189.45.37.254
  189.45.78.104
  189.46.21.232
-189.46.210.250
  189.46.236.164
  189.47.156.120
-189.47.214.28
-189.47.42.116
-189.48.78.44
+189.5.124.232
  189.5.164.173
  189.5.244.181
  189.50.145.18
  189.50.219.192
  189.51.101.126
  189.51.101.145
+189.51.103.123
  189.51.103.125
+189.51.104.66
  189.51.116.5
  189.51.118.22
+189.51.121.228
+189.51.121.8
+189.51.123.182
+189.51.123.223
  189.51.127.1
  189.51.133.183
  189.51.156.29
@@ -74954,29 +70380,18 @@
  189.51.164.78
  189.51.164.81
  189.51.165.0
-189.51.165.108
-189.51.165.118
  189.51.165.12
-189.51.165.173
  189.51.165.202
  189.51.165.214
-189.51.165.228
-189.51.165.236
-189.51.165.251
  189.51.165.26
  189.51.165.29
  189.51.165.4
  189.51.165.46
  189.51.166.105
-189.51.166.14
  189.51.166.19
  189.51.166.225
-189.51.166.37
  189.51.166.89
-189.51.167.102
  189.51.167.137
-189.51.167.139
-189.51.167.148
  189.51.167.164
  189.51.167.175
  189.51.167.178
@@ -74988,7 +70403,6 @@
  189.51.167.51
  189.51.167.90
  189.51.167.96
-189.51.167.97
  189.51.167.99
  189.51.220.107
  189.51.247.141
@@ -75001,6 +70415,7 @@
  189.52.165.84
  189.54.216.47
  189.54.62.128
+189.55.153.234
  189.55.194.94
  189.55.24.72
  189.56.109.162
@@ -75012,7 +70427,6 @@
  189.58.98.157
  189.59.13.202
  189.59.155.47
-189.59.158.198
  189.59.178.16
  189.59.5.49
  189.59.69.3
@@ -75020,22 +70434,17 @@
  189.6.188.131
  189.6.27.161
  189.6.37.81
-189.6.45.130
  189.6.78.34
  189.61.174.184
  189.61.19.111
  189.61.25.110
-189.62.149.220
  189.62.220.195
  189.62.69.106
  189.63.225.139
  189.63.235.19
-189.63.8.60
  189.63.92.173
  189.68.145.6
-189.68.241.208
  189.69.243.113
-189.7.119.154
  189.7.129.60
  189.7.217.152
  189.7.217.23
@@ -75053,13 +70462,12 @@
  189.78.247.136
  189.78.47.239
  189.79.193.173
-189.79.245.14
  189.8.0.244
  189.8.108.50
+189.8.11.13
  189.8.13.94
  189.8.16.174
  189.8.23.170
-189.8.68.19
  189.8.86.38
  189.8.95.30
  189.80.111.66
@@ -75084,10 +70492,8 @@
  189.84.65.144
  189.85.112.69
  189.85.144.75
-189.85.146.85
  189.85.40.2
  189.85.85.10
-189.85.88.218
  189.88.240.103
  189.89.132.38
  189.89.135.78
@@ -75096,7 +70502,6 @@
  189.89.168.132
  189.89.18.86
  189.89.187.162
-189.89.223.71
  189.89.242.122
  189.89.27.17
  189.9.25.66
@@ -75107,10 +70512,7 @@
  189.9.25.94
  189.90.114.1
  189.90.114.37
-189.90.14.101
  189.90.177.169
-189.90.195.188
-189.90.210.202
  189.90.244.46
  189.90.244.82
  189.90.255.173
@@ -75120,19 +70522,14 @@
  189.91.101.54
  189.91.115.6
  189.91.192.195
-189.91.231.252
  189.91.238.124
  189.91.238.21
  189.91.239.194
-189.91.3.159
-189.91.3.190
-189.91.3.89
  189.91.4.195
  189.91.4.229
  189.91.84.25
  189.93.126.161
-189.93.179.255
-189.93.89.70
+189.93.93.126
  189.94.224.220
  189.95.234.34
  189cj.cn
@@ -75163,16 +70560,13 @@
  190-365.net
  190.0.159.74
  190.0.159.86
+190.0.177.150
  190.0.242.217
-190.0.246.2
  190.0.246.9
-190.0.30.90
  190.0.53.213
  190.0.61.18
  190.0.8.134
  190.1.111.114
-190.1.200.116
-190.1.200.157
  190.1.203.180
  190.10.136.136
  190.10.140.142
@@ -75184,17 +70578,14 @@
  190.10.176.204
  190.10.8.67
  190.101.168.19
-190.102.140.7
  190.102.147.6
  190.102.152.138
  190.102.153.152
  190.102.226.91
  190.103.125.194
  190.103.125.199
-190.103.181.229
  190.103.187.54
  190.103.196.16
-190.103.202.7
  190.103.244.236
  190.103.28.14
  190.103.28.76
@@ -75202,7 +70593,6 @@
  190.103.29.236
  190.103.31.106
  190.104.149.167
-190.104.150.2
  190.104.157.142
  190.104.17.3
  190.104.209.62
@@ -75220,27 +70610,22 @@
  190.104.254.196
  190.104.26.227
  190.104.32.123
-190.104.44.53
  190.104.64.162
  190.104.64.242
  190.104.67.159
  190.104.68.246
  190.104.69.241
  190.104.69.66
+190.104.73.9
  190.104.75.116
  190.105.184.2
  190.105.213.165
-190.105.217.204
-190.105.217.207
  190.105.217.217
  190.106.103.250
  190.106.104.2
-190.106.107.130
-190.106.77.164
  190.106.97.230
  190.107.20.117
  190.107.21.4
-190.107.226.232
  190.107.235.143
  190.107.240.237
  190.108.116.189
@@ -75254,7 +70639,6 @@
  190.109.164.58
  190.109.167.9
  190.109.167.98
-190.109.168.18
  190.109.168.241
  190.109.168.99
  190.109.170.105
@@ -75266,7 +70650,7 @@
  190.109.196.44
  190.109.223.50
  190.109.227.247
-190.109.43.128
+190.109.43.40
  190.109.64.104
  190.109.64.92
  190.109.67.220
@@ -75277,6 +70661,7 @@
  190.109.72.41
  190.109.74.1
  190.109.75.253
+190.11.10.31
  190.11.15.14
  190.11.15.2
  190.11.168.226
@@ -75288,19 +70673,18 @@
  190.110.179.106
  190.110.197.18
  190.110.86.134
-190.111.100.67
  190.111.119.69
  190.111.184.2
  190.111.211.52
  190.111.231.8
  190.111.243.146
-190.111.246.168
  190.111.246.85
  190.111.25.133
  190.111.251.232
  190.112.136.177
  190.112.136.181
  190.112.136.185
+190.112.136.193
  190.112.140.58
  190.112.178.215
  190.112.178.216
@@ -75310,29 +70694,23 @@
  190.113.123.187
  190.113.133.244
  190.113.134.32
-190.113.142.197
  190.113.153.132
  190.113.156.127
-190.113.157.155
  190.113.162.53
-190.113.215.25
+190.113.214.2
+190.113.224.12
  190.113.236.48
  190.113.239.244
  190.113.239.245
  190.113.31.251
  190.114.152.235
  190.114.168.97
-190.114.253.26
  190.114.253.78
-190.114.254.138
-190.114.255.162
  190.114.70.166
  190.115.10.45
  190.115.18.139
  190.115.218.2
-190.115.254.13
  190.115.30.146
-190.115.80.11
  190.116.41.227
  190.117.126.169
  190.117.127.45
@@ -75352,7 +70730,6 @@
  190.12.47.246
  190.12.66.27
  190.12.8.146
-190.12.81.54
  190.12.86.98
  190.12.95.170
  190.120.123.2
@@ -75363,7 +70740,6 @@
  190.120.249.57
  190.120.253.113
  190.121.114.60
-190.121.118.98
  190.121.136.3
  190.121.142.158
  190.121.142.165
@@ -75374,9 +70750,9 @@
  190.121.5.210
  190.121.6.65
  190.121.6.66
+190.122.112.57
  190.122.133.144
  190.122.3.113
-190.122.3.167
  190.123.23.22
  190.123.31.247
  190.123.35.138
@@ -75406,21 +70782,16 @@
  190.124.60.10
  190.128.118.185
  190.128.127.89
-190.128.129.18
  190.128.135.130
  190.128.142.218
  190.128.148.198
  190.128.154.222
  190.128.171.250
-190.128.175.6
  190.128.186.218
-190.128.230.206
  190.128.231.18
-190.128.231.2
  190.128.237.142
  190.128.238.26
  190.128.239.146
-190.128.241.2
  190.128.26.98
  190.128.68.123
  190.128.82.34
@@ -75428,17 +70799,13 @@
  190.128.90.92
  190.129.12.90
  190.129.24.18
-190.129.47.148
  190.129.48.226
  190.129.49.62
-190.129.60.125
  190.129.69.101
  190.129.72.242
-190.13.106.123
  190.13.130.242
  190.13.136.53
  190.13.138.50
-190.13.143.157
  190.13.173.67
  190.13.176.106
  190.13.178.65
@@ -75463,13 +70830,14 @@
  190.14.231.211
  190.14.39.239
  190.14.42.27
-190.140.144.206
  190.140.187.126
  190.140.194.62
  190.140.207.122
  190.140.53.173
  190.140.9.126
+190.140.92.234
  190.141.1.88
+190.141.133.115
  190.141.237.92
  190.141.238.178
  190.141.249.37
@@ -75487,16 +70855,12 @@
  190.142.132.172
  190.142.132.188
  190.143.11.12
-190.143.117.178
  190.143.137.114
  190.143.212.173
-190.143.39.211
-190.144.100.58
  190.144.104.154
  190.144.135.118
  190.144.139.76
  190.144.14.170
-190.144.182.85
  190.144.182.86
  190.144.187.188
  190.144.217.72
@@ -75525,8 +70889,6 @@
  190.145.200.126
  190.145.224.18
  190.145.233.162
-190.145.235.126
-190.145.239.13
  190.145.254.138
  190.145.255.246
  190.145.33.211
@@ -75543,7 +70905,6 @@
  190.146.13.180
  190.146.131.105
  190.146.131.138
-190.146.184.215
  190.146.184.225
  190.146.197.27
  190.146.234.92
@@ -75552,7 +70913,6 @@
  190.147.137.66
  190.147.158.104
  190.147.158.196
-190.147.159.34
  190.147.16.184
  190.147.165.128
  190.147.165.13
@@ -75564,11 +70924,9 @@
  190.147.33.171
  190.147.52.242
  190.147.81.16
-190.147.84.191
  190.147.94.109
  190.148.39.222
  190.148.50.161
-190.148.51.194
  190.148.69.74
  190.149.156.91
  190.149.165.162
@@ -75582,11 +70940,8 @@
  190.15.226.115
  190.15.42.109
  190.15.46.93
-190.15.59.5
-190.151.105.182
  190.151.143.140
  190.151.156.241
-190.151.159.18
  190.151.170.133
  190.151.32.205
  190.151.46.154
@@ -75598,7 +70953,6 @@
  190.152.12.54
  190.152.15.194
  190.152.150.54
-190.152.17.62
  190.152.180.90
  190.152.181.106
  190.152.181.74
@@ -75607,7 +70961,6 @@
  190.152.19.62
  190.152.2.122
  190.152.213.126
-190.152.22.210
  190.152.221.82
  190.152.37.174
  190.152.39.78
@@ -75627,9 +70980,7 @@
  190.153.242.186
  190.153.246.146
  190.153.249.99
-190.153.27.98
  190.153.27.99
-190.153.32.25
  190.153.42.176
  190.153.47.236
  190.154.108.234
@@ -75668,19 +71019,14 @@
  190.154.96.42
  190.154.96.51
  190.154.97.142
-190.154.97.244
-190.154.99.197
  190.154.99.80
-190.155.106.74
  190.155.115.196
  190.155.132.146
  190.155.132.24
  190.155.132.26
  190.155.132.3
-190.155.135.138
  190.155.140.154
  190.155.140.194
-190.155.147.29
  190.155.151.2
  190.155.152.13
  190.155.152.72
@@ -75707,28 +71053,25 @@
  190.156.229.215
  190.156.231.182
  190.156.231.245
-190.156.232.32
  190.156.238.155
  190.159.72.55
-190.16.102.150
  190.16.124.195
  190.16.155.176
  190.16.159.223
-190.16.229.107
  190.16.37.98
-190.16.93.190
  190.160.178.110
  190.160.53.126
  190.161.6.24
  190.161.67.63
  190.162.135.242
+190.162.215.233
  190.163.31.26
  190.164.104.62
  190.164.230.9
  190.164.35.84
-190.165.166.138
  190.166.177.82
  190.166.90.2
+190.167.141.75
  190.167.215.170
  190.167.220.7
  190.167.87.209
@@ -75746,22 +71089,20 @@
  190.171.232.165
  190.171.236.43
  190.171.240.51
-190.177.46.79
+190.177.53.207
  190.177.6.66
  190.18.145.210
  190.18.207.58
  190.18.216.131
-190.18.3.250
  190.18.63.166
  190.180.108.215
-190.180.139.113
  190.180.31.248
+190.180.33.226
  190.181.122.225
  190.181.122.233
  190.181.190.30
  190.181.4.133
  190.181.4.26
-190.181.6.94
  190.181.60.196
  190.181.60.2
  190.181.91.31
@@ -75770,6 +71111,7 @@
  190.182.23.52
  190.182.232.250
  190.182.88.214
+190.182.88.226
  190.183.129.18
  190.183.239.249
  190.183.59.186
@@ -75804,7 +71146,7 @@
  190.186.76.19
  190.186.89.150
  190.186.9.227
-190.187.112.3
+190.186.9.82
  190.187.112.66
  190.187.253.29
  190.187.58.50
@@ -75815,9 +71157,9 @@
  190.188.245.242
  190.189.140.25
  190.189.188.120
+190.189.188.178
  190.189.203.25
  190.189.42.121
-190.189.62.237
  190.19.142.144
  190.19.5.32
  190.190.194.194
@@ -75826,19 +71168,14 @@
  190.190.90.17
  190.191.118.158
  190.191.163.147
-190.191.163.43
  190.191.171.72
  190.192.39.136
-190.192.40.18
  190.192.84.18
  190.193.107.202
-190.193.177.22
-190.193.39.63
  190.193.8.28
  190.194.12.132
  190.194.127.201
  190.194.130.180
-190.194.159.199
  190.195.129.227
  190.195.148.163
  190.195.170.83
@@ -75851,8 +71188,6 @@
  190.196.23.170
  190.196.44.245
  190.196.60.122
-190.196.60.85
-190.196.64.93
  190.196.66.74
  190.196.66.76
  190.196.66.78
@@ -75863,12 +71198,12 @@
  190.198.207.209
  190.198.81.192
  190.199.175.76
-190.199.247.191
  190.199.82.38
  190.2.109.108
  190.2.113.228
  190.2.130.195
  190.2.130.44
+190.2.132.8
  190.2.134.140
  190.2.142.44
  190.2.142.60
@@ -75887,7 +71222,6 @@
  190.200.89.199
  190.202.109.244
  190.202.124.93
-190.202.129.172
  190.202.14.130
  190.202.147.253
  190.202.203.241
@@ -75908,8 +71242,8 @@
  190.205.185.95
  190.205.3.224
  190.205.35.106
-190.205.59.6
  190.206.113.156
+190.206.55.79
  190.206.61.61
  190.206.64.56
  190.207.100.201
@@ -75927,10 +71261,8 @@
  190.210.166.140
  190.210.182.179
  190.210.184.138
-190.210.186.35
  190.210.231.34
  190.210.236.139
-190.210.237.42
  190.210.238.77
  190.210.47.73
  190.210.72.84
@@ -75956,13 +71288,13 @@
  190.213.71.109
  190.213.84.115
  190.213.87.244
-190.214.10.179
  190.214.12.34
  190.214.13.2
  190.214.13.90
  190.214.14.9
  190.214.18.70
  190.214.20.10
+190.214.27.106
  190.214.27.26
  190.214.27.46
  190.214.30.146
@@ -75974,13 +71306,13 @@
  190.214.55.138
  190.214.76.11
  190.214.76.214
-190.214.77.233
  190.214.9.10
  190.215.117.149
  190.215.117.69
  190.215.153.14
  190.215.16.82
  190.215.18.121
+190.215.22.54
  190.215.220.34
  190.215.220.36
  190.215.88.61
@@ -76002,6 +71334,7 @@
  190.217.1.9
  190.217.13.220
  190.217.138.7
+190.217.171.176
  190.217.223.104
  190.217.241.105
  190.217.4.102
@@ -76031,9 +71364,8 @@
  190.224.232.31
  190.224.243.1
  190.224.35.254
-190.225.173.159
-190.226.244.8
  190.226.244.9
+190.226.33.211
  190.226.46.114
  190.226.46.116
  190.228.147.172
@@ -76047,15 +71379,13 @@
  190.231.66.165
  190.232.223.60
  190.233.144.118
-190.234.110.183
  190.235.179.168
-190.235.214.116
  190.235.86.137
  190.236.225.222
-190.236.28.120
  190.236.58.65
-190.237.204.102
+190.237.183.138
  190.237.68.226
+190.238.103.9
  190.238.35.27
  190.239.1.225
  190.24.119.19
@@ -76072,11 +71402,10 @@
  190.24.59.103
  190.24.59.172
  190.24.59.199
-190.24.6.162
  190.24.64.156
+190.240.194.77
  190.242.119.220
  190.242.126.114
-190.242.25.20
  190.242.41.133
  190.242.47.102
  190.242.47.126
@@ -76099,7 +71428,6 @@
  190.247.118.30
  190.247.16.37
  190.248.133.62
-190.248.150.138
  190.248.153.162
  190.248.68.18
  190.248.68.78
@@ -76116,7 +71444,6 @@
  190.25.242.34
  190.25.242.37
  190.25.45.189
-190.25.49.114
  190.25.76.224
  190.251.149.173
  190.252.101.118
@@ -76153,34 +71480,32 @@
  190.27.63.71
  190.27.73.196
  190.27.94.208
+190.28.108.222
  190.28.109.196
-190.28.114.39
  190.28.131.206
  190.28.153.171
  190.28.88.92
  190.29.166.0
-190.29.166.226
  190.29.26.190
  190.29.96.187
  190.3.117.18
  190.3.194.209
-190.3.194.237
  190.3.23.35
  190.32.21.250
-190.32.84.38
  190.34.149.226
  190.34.204.10
  190.36.4.79
  190.37.169.245
+190.37.22.236
  190.37.222.55
  190.38.14.52
+190.38.150.82
  190.39.215.179
  190.4.0.246
  190.4.187.228
  190.4.202.123
  190.4.204.163
  190.4.205.226
-190.4.26.125
  190.4.31.25
  190.4.54.170
  190.4.56.17
@@ -76188,7 +71513,6 @@
  190.41.94.93
  190.41.94.94
  190.44.137.65
-190.44.187.174
  190.44.188.179
  190.44.87.211
  190.45.149.98
@@ -76197,7 +71521,6 @@
  190.46.140.125
  190.46.198.151
  190.47.117.248
-190.47.136.120
  190.47.211.205
  190.49.147.124
  190.49.255.248
@@ -76205,13 +71528,11 @@
  190.5.122.174
  190.5.162.204
  190.5.216.131
-190.5.228.74
-190.5.242.114
  190.5.243.179
  190.5.85.242
  190.52.106.50
  190.52.131.234
-190.52.166.83
+190.52.160.6
  190.52.168.20
  190.52.183.28
  190.52.187.226
@@ -76221,6 +71542,7 @@
  190.52.193.91
  190.52.193.97
  190.52.199.200
+190.52.199.50
  190.52.203.130
  190.52.203.132
  190.52.34.43
@@ -76233,6 +71555,7 @@
  190.54.22.66
  190.54.22.67
  190.54.97.154
+190.55.137.36
  190.55.181.54
  190.55.186.229
  190.55.198.25
@@ -76249,11 +71572,9 @@
  190.57.189.82
  190.57.20.115
  190.57.20.115bin.sh
-190.57.231.227
  190.57.236.124
  190.57.30.138
  190.57.30.149
-190.58.113.170
  190.58.130.230
  190.58.4.185
  190.6.111.251
@@ -76261,8 +71582,8 @@
  190.6.166.209
  190.6.193.152
  190.6.27.3
+190.6.58.87
  190.60.174.90
-190.60.200.126
  190.61.47.226
  190.63.144.26
  190.63.144.29
@@ -76270,8 +71591,6 @@
  190.63.191.83
  190.63.7.166
  190.64.131.130
-190.64.135.122
-190.64.137.173
  190.64.141.18
  190.64.142.122
  190.64.147.19
@@ -76283,7 +71602,7 @@
  190.64.90.154
  190.64.90.50
  190.66.10.152
-190.66.3.92
+190.66.24.37
  190.69.27.137
  190.7.0.249
  190.7.141.66
@@ -76308,18 +71627,17 @@
  190.75.24.89
  190.77.135.36
  190.77.21.148
+190.78.207.61
  190.79.113.224
  190.79.131.206
  190.79.191.63
  190.79.198.148
  190.8.100.18
  190.8.117.5
-190.8.149.149
  190.8.168.145
  190.8.169.206
  190.8.46.139
  190.8.82.58
-190.80.159.189
  190.80.243.251
  190.80.61.113
  190.82.111.22
@@ -76331,13 +71649,10 @@
  190.83.180.220
  190.83.255.23
  190.83.84.208
-190.83.84.210
-190.84.119.19
  190.84.225.4
  190.84.232.82
  190.84.245.179
  190.85.10.147
-190.85.108.186
  190.85.115.78
  190.85.115.84
  190.85.12.42
@@ -76355,21 +71670,14 @@
  190.85.235.84
  190.85.28.154
  190.85.34.142
-190.85.34.203
  190.85.46.52
-190.85.54.158
-190.85.65.236
  190.85.65.50
  190.85.67.171
  190.85.96.74
-190.86.203.60
  190.88.186.86
-190.88.224.78
-190.88.226.239
+190.88.228.209
+190.88.230.87
  190.88.236.62
-190.88.237.177
-190.88.242.99
-190.88.250.33
  190.89.166.123
  190.89.166.24
  190.89.236.145
@@ -76377,7 +71685,6 @@
  190.89.28.1
  190.89.28.10
  190.89.28.103
-190.89.28.104
  190.89.28.107
  190.89.28.109
  190.89.28.111
@@ -76393,12 +71700,12 @@
  190.89.28.199
  190.89.28.21
  190.89.28.216
+190.89.28.22
  190.89.28.24
  190.89.28.26
  190.89.28.28
  190.89.28.3
  190.89.28.33
-190.89.28.45
  190.89.28.49
  190.89.28.50
  190.89.28.52
@@ -76413,6 +71720,7 @@
  190.9.169.22
  190.9.249.221
  190.9.29.31
+190.90.156.90
  190.90.20.229
  190.90.20.230
  190.90.239.42
@@ -76439,7 +71747,6 @@
  190.96.118.78
  190.96.126.2
  190.96.15.50
-190.96.159.79
  190.96.192.69
  190.96.214.59
  190.96.24.89
@@ -76448,6 +71755,7 @@
  190.96.54.3
  190.96.7.34
  190.97.11.35
+190.97.123.84
  190.97.167.214
  190.97.219.241
  190.97.219.4
@@ -76456,10 +71764,8 @@
  190.97.30.167
  190.97.35.149
  190.98.228.54
-190.98.231.87
  190.98.36.178
  190.99.211.125
-190.99.73.56
  190.99.76.98
  190.99.92.139
  190.99.92.179
@@ -76489,7 +71795,7 @@
  190.99.94.139
  190.99.94.146
  190.99.94.166
-190.99.94.168
+190.99.94.176
  190.99.94.180
  190.99.94.184
  190.99.94.187
@@ -76504,10 +71810,7 @@
  190.99.95.212
  190.99.95.254
  191-365.net
-191.10.158.215
-191.10.201.212
  191.100.243.197
-191.100.25.217
  191.100.26.20
  191.100.27.229
  191.100.28.217
@@ -76543,19 +71846,13 @@
  191.101.39.208
  191.101.39.8
  191.101.44.141
-191.101.46.22
-191.101.65.8
-191.101.66.48
  191.101.66.50
  191.101.87.146
-191.101.92.120
-191.101.95.12
-191.101.95.63
  191.101.99.11
  191.101.99.154
-191.102.103.250
  191.102.106.1
-191.102.120.182
+191.102.113.107
+191.102.122.180
  191.102.148.105
  191.102.148.107
  191.102.148.70
@@ -76575,40 +71872,46 @@
  191.102.151.42
  191.102.151.44
  191.102.151.8
-191.102.153.137
+191.102.153.11
  191.102.153.222
  191.102.153.240
-191.102.153.47
-191.102.153.74
-191.102.153.77
-191.102.153.93
-191.102.154.119
+191.102.153.26
+191.102.153.36
+191.102.153.62
+191.102.153.76
+191.102.154.158
  191.102.154.35
-191.102.154.48
  191.102.154.6
  191.102.156.100
  191.102.156.105
-191.102.156.120
-191.102.156.132
+191.102.156.126
  191.102.156.143
+191.102.156.159
  191.102.156.165
-191.102.156.166
+191.102.156.184
+191.102.156.186
+191.102.156.215
  191.102.156.216
-191.102.156.225
  191.102.156.232
  191.102.156.235
  191.102.156.24
  191.102.156.247
  191.102.156.250
-191.102.156.3
+191.102.156.253
+191.102.156.37
+191.102.156.49
  191.102.156.59
+191.102.156.76
+191.102.156.87
  191.102.164.109
  191.102.164.118
  191.102.164.194
  191.102.164.208
  191.102.164.221
  191.102.164.51
+191.102.165.201
  191.102.166.167
+191.102.166.215
  191.102.166.227
  191.102.166.38
  191.102.166.8
@@ -76617,18 +71920,18 @@
  191.102.232.130
  191.102.25.10
  191.102.35.238
-191.102.64.210
-191.102.83.164
+191.102.78.240
+191.102.78.246
+191.102.83.31
  191.102.86.91
  191.102.88.218
  191.102.95.171
+191.102.98.192
  191.103.219.225
  191.103.254.125
  191.103.254.145
  191.113.244.94
-191.114.224.143
  191.115.59.255
-191.13.117.252
  191.13.137.128
  191.13.151.189
  191.13.16.93
@@ -76637,26 +71940,23 @@
  191.14.90.236
  191.143.218.13
  191.162.1.30
+191.162.10.152
  191.162.130.247
  191.162.135.196
  191.162.207.132
-191.162.213.227
-191.162.218.41
  191.162.219.95
  191.17.150.10
-191.17.16.130
  191.17.65.36
  191.177.92.204
  191.177.94.103
  191.178.64.109
  191.178.84.239
  191.180.224.239
+191.180.33.199
  191.182.208.108
  191.182.217.145
  191.182.6.118
  191.183.21.190
-191.184.40.60
-191.184.42.175
  191.185.42.248
  191.186.233.32
  191.186.28.191
@@ -76666,54 +71966,41 @@
  191.19.229.119
  191.191.107.15
  191.191.59.220
-191.191.81.179
  191.193.143.115
  191.193.229.147
-191.195.172.38
-191.195.188.48
  191.209.114.65
  191.209.114.90
  191.209.21.188
  191.209.21.39
  191.209.21.52
  191.209.225.41
-191.209.82.106
  191.211.12.180
+191.211.68.32
  191.217.170.33
  191.220.231.200
-191.220.7.220
-191.221.46.21
+191.221.111.245
  191.222.154.83
  191.222.161.80
-191.222.206.209
  191.222.206.9
  191.223.66.127
  191.232.136.43
  191.232.136.87
-191.232.160.145
-191.232.169.189
  191.232.169.208
  191.232.172.50
  191.232.174.130
-191.232.174.253
  191.232.176.226
-191.232.179.168
-191.232.191.78
  191.232.193.231
-191.232.197.189
  191.232.211.168
  191.232.211.83
  191.232.214.89
  191.232.233.98
  191.232.236.96
-191.232.238.183
  191.232.238.25
  191.232.242.195
  191.232.242.70
  191.232.243.132
  191.232.244.135
  191.232.247.86
-191.232.249.156
  191.232.251.219
  191.232.252.88
  191.232.255.95
@@ -76725,50 +72012,37 @@
  191.233.192.40
  191.233.193.6
  191.233.194.99
-191.233.197.100
  191.233.198.107
  191.233.199.123
-191.233.199.78
  191.233.232.133
  191.233.232.175
  191.233.232.243
  191.233.254.251
-191.234.161.50
-191.234.162.205
  191.234.164.130
  191.234.166.50
  191.234.167.154
  191.234.169.50
-191.234.170.222
  191.234.174.180
  191.234.175.191
  191.234.175.56
  191.234.176.158
  191.234.177.188
  191.234.179.79
-191.234.180.212
  191.234.187.127
  191.234.187.194
  191.234.189.215
  191.235.100.197
  191.235.104.211
  191.235.104.32
-191.235.104.37
-191.235.105.15
  191.235.110.78
  191.235.111.159
  191.235.112.72
  191.235.239.157
-191.235.239.168
  191.235.64.156
-191.235.65.29
  191.235.65.97
-191.235.70.209
  191.235.71.181
  191.235.72.144
  191.235.78.124
-191.235.80.118
-191.235.82.109
  191.235.83.242
  191.235.84.120
  191.235.89.181
@@ -76786,32 +72060,26 @@
  191.239.246.25
  191.239.247.246
  191.239.249.144
+191.239.249.178
  191.239.251.246
  191.239.251.98
  191.239.255.175
  191.240.113.212
  191.240.114.249
-191.240.115.101
-191.240.116.117
-191.240.116.123
-191.240.116.197
-191.240.116.44
-191.240.117.93
+191.240.115.155
+191.240.117.38
+191.240.118.105
  191.240.119.38
  191.240.152.129
  191.240.152.132
  191.240.152.134
  191.240.157.186
-191.240.175.246
  191.240.228.41
  191.240.28.25
  191.240.99.142
  191.241.145.111
-191.241.160.108
-191.241.160.134
-191.241.160.147
+191.241.160.191
  191.241.160.220
-191.241.160.221
  191.241.160.73
  191.241.161.115
  191.241.161.59
@@ -76827,7 +72095,6 @@
  191.241.33.51
  191.241.34.186
  191.241.34.210
-191.241.4.3
  191.241.67.10
  191.242.108.102
  191.242.108.241
@@ -76851,24 +72118,28 @@
  191.243.72.34
  191.243.8.173
  191.243.93.95
-191.245.242.214
  191.246.252.60
  191.246.71.163
+191.248.113.22
  191.248.208.145
  191.249.208.51
  191.249.217.73
  191.249.98.162
  191.250.136.157
  191.250.140.114
+191.250.227.126
  191.250.240.155
  191.251.158.220
  191.252.113.123
  191.252.153.191
  191.252.179.218
+191.252.182.211
  191.252.195.130
  191.252.205.120
  191.252.56.65
+191.253.120.116
  191.253.14.73
+191.253.14.99
  191.253.194.12
  191.253.196.134
  191.253.207.22
@@ -76885,37 +72156,33 @@
  191.255.228.105
  191.255.232.53
  191.255.250.51
-191.28.63.166
  191.30.134.179
+191.30.235.31
  191.30.44.83
+191.31.1.116
  191.31.104.17
  191.31.132.29
  191.31.174.138
-191.31.174.212
-191.31.20.236
-191.31.24.151
  191.31.31.224
  191.31.92.51
  191.32.157.177
  191.32.190.45
-191.32.218.21
  191.33.138.180
  191.33.144.162
  191.33.160.36
  191.33.228.162
-191.33.25.184
+191.33.24.94
  191.33.7.67
  191.33.81.18
-191.34.162.186
  191.34.170.0
  191.34.41.218
-191.35.179.115
  191.36.141.200
  191.36.141.41
  191.36.142.49
  191.36.148.236
  191.36.173.34
  191.36.217.37
+191.36.231.228
  191.37.0.214
  191.37.147.38
  191.37.165.82
@@ -76924,76 +72191,78 @@
  191.37.203.174
  191.37.220.93
  191.37.227.133
-191.37.240.159
  191.37.37.238
  191.37.79.238
  191.40.94.91
  191.43.12.85
  191.43.35.67
  191.47.93.174
-191.5.0.79
  191.5.100.10
+191.5.100.106
  191.5.100.140
+191.5.100.142
  191.5.100.20
-191.5.100.215
+191.5.100.206
  191.5.100.22
-191.5.101.103
+191.5.100.255
+191.5.101.149
+191.5.101.87
+191.5.101.90
+191.5.102.146
+191.5.102.39
+191.5.102.76
+191.5.102.8
  191.5.103.51
  191.5.46.31
  191.5.55.7
+191.5.97.128
  191.5.97.129
+191.5.97.142
  191.5.97.146
  191.5.97.155
-191.5.97.156
-191.5.97.171
-191.5.97.218
+191.5.97.212
  191.5.97.231
-191.5.97.24
  191.5.97.240
-191.5.97.76
-191.5.97.79
  191.5.97.90
  191.5.98.207
  191.5.98.248
-191.5.99.103
+191.5.98.252
+191.5.99.114
  191.5.99.148
-191.5.99.173
  191.5.99.191
  191.5.99.194
-191.5.99.199
+191.5.99.196
+191.5.99.220
  191.5.99.30
-191.5.99.53
+191.5.99.67
+191.5.99.81
  191.53.104.122
  191.53.105.182
  191.53.112.170
  191.53.113.116
-191.53.193.102
  191.53.193.154
  191.53.193.255
  191.53.194.116
  191.53.194.135
+191.53.194.193
  191.53.194.45
+191.53.194.76
  191.53.195.119
-191.53.195.216
  191.53.196.127
-191.53.196.165
-191.53.196.180
-191.53.197.0
-191.53.197.18
+191.53.196.237
+191.53.196.8
  191.53.197.211
  191.53.199.243
-191.53.220.126
-191.53.236.174
+191.53.220.237
+191.53.221.21
  191.53.237.3
-191.53.250.16
  191.53.250.193
-191.53.251.228
-191.53.47.152
-191.53.52.4
+191.53.52.17
  191.53.52.42
  191.53.52.79
  191.54.117.159
  191.54.131.239
+191.54.132.127
  191.54.209.193
  191.54.211.205
  191.54.212.184
@@ -77001,7 +72270,6 @@
  191.55.10.174
  191.55.13.202
  191.55.14.99
-191.55.73.171
  191.55.8.48
  191.6.132.104
  191.6.132.105
@@ -77011,6 +72279,7 @@
  191.6.133.20
  191.6.133.21
  191.6.133.22
+191.6.133.23
  191.6.133.93
  191.6.134.20
  191.6.135.177
@@ -77019,16 +72288,11 @@
  191.6.135.93
  191.6.143.179
  191.6.143.184
-191.6.63.23
-191.6.88.12
  191.6.88.217
  191.6.92.181
-191.6.93.142
  191.6.93.224
  191.6.95.60
  191.7.14.224
-191.7.145.246
-191.7.158.65
  191.7.160.55
  191.7.192.10
  191.7.192.149
@@ -77054,12 +72318,12 @@
  191.8.181.115
  191.8.187.245
  191.8.83.229
-191.8.86.135
+191.80.169.162
  191.81.21.137
-191.83.205.86
+191.81.32.142
  191.83.209.106
  191.83.242.102
-191.83.34.51
+191.92.80.73
  191.96.149.36
  191.96.164.95
  191.96.170.107
@@ -77074,7 +72338,6 @@
  191.96.25.226
  191.96.97.74
  191.97.3.195
-191.97.3.31
  191.97.53.43
  191.97.7.165
  191.98.144.217
@@ -77096,19 +72359,17 @@
  191.98.195.254
  191gm.com
  192-168-1-45.000webhostapp.com
-192.0.103.4
  192.0.145.15
  192.0.197.123
  192.0.240.80
+192.0.82.48
  192.0.91.201
  192.100.213.83
  192.109.110.217
  192.109.165.156
  192.109.165.177
-192.109.165.96
  192.109.98.169
  192.109.98.48
-192.110.161.10
  192.111.129.145
  192.111.129.148
  192.111.130.3
@@ -77124,7 +72385,6 @@
  192.111.143.91
  192.111.143.92
  192.111.146.37
-192.116.109.136
  192.116.142.153
  192.117.146.110
  192.119.106.9
@@ -77170,8 +72430,6 @@
  192.119.72.241
  192.119.73.212
  192.119.73.218
-192.119.73.68
-192.119.73.72
  192.119.84.230
  192.119.86.105
  192.119.87.242
@@ -77188,6 +72446,7 @@
  192.124.170.224
  192.124.170.231
  192.124.170.240
+192.124.170.40
  192.124.170.43
  192.124.170.55
  192.124.170.65
@@ -77202,7 +72461,7 @@
  192.126.160.218
  192.126.160.255
  192.126.160.89
-192.126.206.43
+192.126.165.173
  192.126.255.48
  192.129.186.62
  192.129.188.98
@@ -77226,81 +72485,57 @@
  192.141.11.17
  192.141.12.223
  192.141.12.70
-192.141.168.192
-192.141.200.20
  192.141.208.1
  192.141.232.12
  192.141.233.65
-192.141.235.228
  192.141.28.207
  192.141.28.232
-192.141.80.72
  192.141.84.67
-192.142.182.131
+192.142.168.28
  192.144.104.1
  192.144.104.33
  192.144.118.110
  192.144.12.47
  192.144.128.129
  192.144.129.98
-192.144.136.109
  192.144.137.82
  192.144.140.20
  192.144.141.35
  192.144.142.62
  192.144.143.101
  192.144.148.220
-192.144.154.178
  192.144.154.209
  192.144.155.110
-192.144.155.63
+192.144.156.250
  192.144.156.68
  192.144.157.134
  192.144.157.33
  192.144.160.53
-192.144.161.16
  192.144.171.165
  192.144.172.241
-192.144.172.50
-192.144.180.59
-192.144.182.47
-192.144.183.188
-192.144.183.47
-192.144.185.175
  192.144.185.74
  192.144.186.22
-192.144.187.153
-192.144.188.169
  192.144.188.237
  192.144.189.51
  192.144.190.178
  192.144.190.244
  192.144.191.17
-192.144.192.201
-192.144.199.158
  192.144.204.6
-192.144.207.22
  192.144.210.27
  192.144.210.67
+192.144.214.19
  192.144.215.146
  192.144.216.70
  192.144.217.101
  192.144.218.101
  192.144.218.46
  192.144.219.75
-192.144.225.182
  192.144.225.186
-192.144.226.142
-192.144.226.241
  192.144.226.252
-192.144.227.105
  192.144.227.36
  192.144.227.85
  192.144.227.95
-192.144.228.253
-192.144.228.40
  192.144.228.77
-192.144.230.158
  192.144.230.221
  192.144.230.43
  192.144.231.98
@@ -77308,7 +72543,6 @@
  192.144.233.197
  192.144.234.119
  192.144.235.147
-192.144.239.87
  192.144.253.167
  192.144.253.70
  192.144.254.245
@@ -77320,6 +72554,7 @@
  192.144.60.33
  192.144.60.34
  192.144.65.46
+192.145.124.238
  192.145.127.42
  192.145.195.126
  192.145.205.74
@@ -77327,6 +72562,7 @@
  192.145.239.17
  192.145.239.209
  192.145.239.210
+192.145.239.218
  192.145.239.48
  192.145.45.196
  192.146.137.18
@@ -77349,7 +72585,6 @@
  192.155.89.38
  192.155.93.237
  192.155.94.15
-192.155.96.153
  192.157.201.202
  192.157.202.178
  192.157.233.175
@@ -77376,19 +72611,18 @@
  192.162.132.95
  192.162.143.109
  192.162.150.241
+192.162.165.117
+192.162.177.213
  192.162.192.148
  192.162.193.243
  192.162.238.77
  192.162.27.108
  192.162.27.155
+192.162.49.130
  192.162.62.197
-192.162.70.66
  192.162.80.87
  192.162.81.246
  192.162.96.79
-192.162.98.111
-192.162.98.201
-192.162.99.211
  192.163.192.224
  192.163.199.254
  192.163.221.191
@@ -77397,6 +72631,7 @@
  192.165.228.139
  192.166.128.1
  192.166.134.148
+192.166.134.173
  192.166.134.179
  192.166.223.155
  192.166.245.138
@@ -77409,7 +72644,6 @@
  192.169.189.120
  192.169.201.143
  192.169.227.134
-192.169.249.201
  192.169.6.101
  192.169.6.144
  192.169.6.178
@@ -77426,14 +72660,12 @@
  192.181.88.225
  192.182.157.119
  192.185.129.96
-192.185.130.230
  192.185.2.172
  192.185.4.62
  192.186.11.25
  192.186.130.87
  192.186.134.116
  192.186.134.62
-192.186.134.67
  192.186.134.92
  192.186.143.127
  192.186.143.22
@@ -77443,11 +72675,8 @@
  192.186.153.226
  192.186.153.234
  192.186.153.235
-192.186.153.98
-192.186.157.106
  192.186.157.77
  192.186.161.194
-192.186.161.226
  192.186.169.75
  192.186.171.133
  192.186.171.156
@@ -77460,8 +72689,6 @@
  192.186.181.158
  192.186.181.233
  192.186.182.1
-192.186.182.117
-192.186.182.121
  192.186.182.58
  192.186.190.148
  192.187.101.130
@@ -77470,7 +72697,9 @@
  192.187.123.242
  192.187.125.75
  192.187.126.42
+192.187.63.55
  192.187.99.194
+192.188.2.58
  192.190.170.45
  192.190.19.6
  192.195.80.10
@@ -77478,16 +72707,14 @@
  192.197.122.117
  192.198.102.135
  192.198.102.199
+192.198.104.122
  192.198.104.85
  192.198.114.140
-192.198.114.152
  192.198.114.184
  192.198.115.206
-192.198.125.221
-192.198.125.49
+192.198.115.207
  192.198.125.59
  192.198.127.19
-192.198.127.28
  192.198.80.186
  192.198.80.62
  192.198.82.51
@@ -77499,9 +72726,12 @@
  192.198.93.7
  192.199.53.131
  192.200.122.226
-192.200.158.122
  192.200.158.125
-192.200.158.225
+192.200.158.222
+192.200.158.226
+192.200.158.244
+192.200.158.86
+192.200.158.88
  192.200.192.2
  192.200.207.100
  192.200.215.162
@@ -77529,9 +72759,8 @@
  192.210.181.32
  192.210.185.120
  192.210.185.125
-192.210.185.184
  192.210.185.192
-192.210.185.216
+192.210.185.93
  192.210.186.195
  192.210.189.120
  192.210.191.131
@@ -77561,6 +72790,7 @@
  192.222.203.204
  192.223.26.251
  192.223.30.89
+192.223.66.150
  192.223.67.203
  192.225.214.132
  192.225.226.15
@@ -77570,8 +72800,6 @@
  192.227.121.138
  192.227.131.149
  192.227.131.159
-192.227.137.233
-192.227.138.113
  192.227.138.119
  192.227.138.124
  192.227.138.125
@@ -77589,6 +72817,7 @@
  192.227.180.47
  192.227.180.98
  192.227.206.125
+192.227.207.108
  192.227.209.203
  192.227.209.21
  192.227.209.228
@@ -77619,7 +72848,6 @@
  192.236.146.5
  192.236.146.95
  192.236.147.131
-192.236.147.155
  192.236.147.189
  192.236.147.67
  192.236.154.89
@@ -77638,7 +72866,6 @@
  192.236.176.44
  192.236.177.142
  192.236.177.39
-192.236.179.246
  192.236.192.114
  192.236.192.170
  192.236.192.73
@@ -77648,17 +72875,15 @@
  192.236.198.174
  192.236.208.241
  192.236.232.172
+192.24.117.40
  192.24.158.46
+192.240.123.115
  192.240.150.133
-192.241.105.139
  192.241.106.65
  192.241.106.74
  192.241.111.3
-192.241.113.199
  192.241.113.206
  192.241.12.185
-192.241.128.214
-192.241.129.146
  192.241.130.116
  192.241.130.65
  192.241.131.150
@@ -77667,7 +72892,6 @@
  192.241.134.101
  192.241.134.102
  192.241.135.146
-192.241.135.34
  192.241.137.219
  192.241.138.236
  192.241.139.236
@@ -77676,17 +72900,15 @@
  192.241.141.168
  192.241.142.27
  192.241.143.186
-192.241.143.49
  192.241.143.52
  192.241.145.8
  192.241.146.155
  192.241.146.84
-192.241.147.118
  192.241.147.98
-192.241.148.178
  192.241.148.219
  192.241.150.222
  192.241.151.77
+192.241.152.112
  192.241.152.212
  192.241.153.102
  192.241.153.164
@@ -77696,7 +72918,6 @@
  192.241.154.86
  192.241.155.88
  192.241.156.94
-192.241.158.179
  192.241.161.181
  192.241.161.199
  192.241.162.216
@@ -77705,7 +72926,6 @@
  192.241.167.114
  192.241.169.184
  192.241.171.169
-192.241.172.175
  192.241.172.229
  192.241.173.142
  192.241.173.157
@@ -77726,12 +72946,10 @@
  192.241.185.214
  192.241.190.145
  192.241.194.61
-192.241.195.30
  192.241.195.43
  192.241.196.148
  192.241.196.201
  192.241.196.22
-192.241.197.141
  192.241.197.245
  192.241.199.202
  192.241.200.176
@@ -77767,7 +72985,6 @@
  192.241.210.136
  192.241.210.14
  192.241.210.222
-192.241.210.224
  192.241.210.24
  192.241.210.61
  192.241.210.65
@@ -78099,7 +73316,6 @@
  192.241.235.10
  192.241.235.104
  192.241.235.108
-192.241.235.11
  192.241.235.112
  192.241.235.115
  192.241.235.121
@@ -78421,32 +73637,29 @@
  192.241.246.167
  192.241.247.149
  192.241.249.226
-192.241.249.53
  192.241.250.189
  192.241.254.131
  192.241.255.117
  192.241.255.77
  192.241.64.114
-192.241.64.228
  192.241.64.245
+192.241.64.252
  192.241.64.3
  192.241.64.92
  192.241.65.35
  192.241.70.54
  192.241.73.198
  192.241.76.61
-192.241.80.131
  192.241.80.143
-192.241.80.16
  192.241.80.161
  192.241.80.21
+192.241.80.235
  192.241.80.239
+192.241.92.6
  192.243.100.114
  192.243.102.171
  192.243.114.21
-192.243.116.123
  192.243.116.235
-192.243.119.201
  192.243.119.81
  192.243.215.234
  192.243.55.129
@@ -78463,12 +73676,12 @@
  192.248.146.74
  192.248.148.109
  192.248.168.159
-192.248.177.197
  192.249.47.172
  192.249.53.158
  192.249.53.67
  192.249.73.222
  192.250.167.11
+192.250.196.235
  192.250.196.242
  192.250.196.26
  192.250.197.98
@@ -78754,7 +73967,6 @@
  192.254.75.51
  192.254.75.53
  192.254.75.54
-192.255.234.85
  192.3.105.183
  192.3.11.20
  192.3.11.24
@@ -78763,9 +73975,9 @@
  192.3.12.113
  192.3.12.121
  192.3.120.53
+192.3.122.123
  192.3.122.27
  192.3.124.40
-192.3.139.167
  192.3.139.25
  192.3.139.56
  192.3.141.134
@@ -78780,47 +73992,46 @@
  192.3.147.233
  192.3.152.134
  192.3.161.156
-192.3.161.163
-192.3.166.83
+192.3.165.228
  192.3.170.110
-192.3.172.173
  192.3.176.197
-192.3.177.213
-192.3.177.219
  192.3.178.14
  192.3.178.76
  192.3.178.85
  192.3.180.232
+192.3.180.233
  192.3.185.210
  192.3.185.27
  192.3.185.29
+192.3.188.204
  192.3.188.251
  192.3.193.251
  192.3.194.164
  192.3.194.166
  192.3.194.169
  192.3.199.135
+192.3.203.134
+192.3.203.158
  192.3.203.177
  192.3.203.188
  192.3.203.39
+192.3.203.55
  192.3.207.121
  192.3.207.170
-192.3.208.116
  192.3.208.121
+192.3.208.124
  192.3.208.153
-192.3.208.98
  192.3.209.168
  192.3.213.17
  192.3.214.13
  192.3.214.29
-192.3.214.8
+192.3.214.6
  192.3.224.229
  192.3.224.230
  192.3.23.41
  192.3.233.234
  192.3.245.103
  192.3.245.22
-192.3.247.10
  192.3.247.112
  192.3.247.119
  192.3.25.177
@@ -78832,8 +74043,6 @@
  192.3.27.173
  192.3.27.185
  192.3.28.114
-192.3.28.48
-192.3.28.63
  192.3.3.143
  192.3.31.212
  192.3.31.213
@@ -78844,7 +74053,6 @@
  192.3.41.172
  192.3.41.205
  192.3.45.185
-192.3.48.122
  192.3.52.197
  192.3.67.106
  192.3.7.118
@@ -78856,21 +74064,17 @@
  192.3.80.156
  192.3.91.66
  192.3.92.10
-192.3.93.195
  192.3.93.56
  192.34.21.114
-192.34.56.59
  192.34.56.82
  192.34.57.210
  192.34.57.220
  192.34.58.174
  192.34.59.22
  192.34.61.230
-192.34.61.86
  192.34.62.193
  192.34.62.208
  192.34.62.213
-192.34.63.128
  192.34.80.176
  192.35.168.100
  192.35.168.101
@@ -78989,7 +74193,6 @@
  192.35.168.238
  192.35.168.239
  192.35.168.24
-192.35.168.240
  192.35.168.25
  192.35.168.26
  192.35.168.27
@@ -79158,13 +74361,13 @@
  192.64.52.124
  192.64.6.162
  192.64.7.151
-192.64.80.135
  192.65.170.15
  192.65.170.50
  192.69.235.189
  192.72.190.56
  192.72.191.60
  192.73.242.140
+192.74.235.226
  192.80.99.38
  192.81.129.60
  192.81.129.82
@@ -79174,7 +74377,6 @@
  192.81.209.190
  192.81.209.72
  192.81.210.179
-192.81.210.42
  192.81.211.71
  192.81.212.110
  192.81.212.16
@@ -79184,7 +74386,6 @@
  192.81.216.101
  192.81.217.100
  192.81.217.138
-192.81.218.93
  192.81.219.123
  192.81.220.148
  192.81.221.84
@@ -79193,13 +74394,12 @@
  192.81.35.151
  192.81.38.31
  192.82.253.140
-192.82.65.159
+192.82.67.94
  192.82.76.83
  192.87.172.121
  192.95.12.175
  192.95.16.165
  192.95.18.190
-192.95.2.243
  192.95.20.43
  192.95.24.39
  192.95.29.218
@@ -79213,7 +74413,6 @@
  192.95.31.9
  192.95.37.160
  192.95.49.93
-192.95.52.242
  192.95.6.110
  192.96.159.234
  192.96.203.69
@@ -79222,12 +74421,10 @@
  192.96.24.1
  192.99.0.56
  192.99.0.98
-192.99.1.215
  192.99.1.38
  192.99.10.122
  192.99.10.177
  192.99.101.152
-192.99.101.57
  192.99.11.13
  192.99.11.195
  192.99.11.224
@@ -79240,8 +74437,6 @@
  192.99.137.85
  192.99.14.187
  192.99.141.252
-192.99.144.170
-192.99.145.164
  192.99.149.195
  192.99.15.139
  192.99.152.234
@@ -79253,7 +74448,6 @@
  192.99.166.42
  192.99.168.9
  192.99.169.223
-192.99.175.111
  192.99.175.176
  192.99.175.177
  192.99.175.178
@@ -79277,24 +74471,20 @@
  192.99.200.213
  192.99.208.205
  192.99.212.104
-192.99.212.132
-192.99.212.202
  192.99.221.33
  192.99.221.37
  192.99.221.38
  192.99.245.135
  192.99.247.102
  192.99.252.90
-192.99.28.247
-192.99.3.160
  192.99.3.173
  192.99.31.119
+192.99.31.122
  192.99.32.109
  192.99.34.142
  192.99.35.135
  192.99.35.149
  192.99.36.177
-192.99.4.145
  192.99.4.179
  192.99.4.59
  192.99.4.63
@@ -79304,12 +74494,9 @@
  192.99.47.125
  192.99.5.123
  192.99.5.94
-192.99.57.32
  192.99.59.91
  192.99.7.106
-192.99.70.208
  192.99.70.54
-192.99.8.102
  192.99.8.157
  192.99.8.58
  192.99.83.47
@@ -79322,7 +74509,6 @@
  193.104.115.8
  193.104.41.59
  193.104.68.80
-193.104.83.97
  193.105.112.22
  193.105.134.89
  193.105.154.146
@@ -79335,7 +74521,6 @@
  193.106.128.137
  193.106.130.249
  193.106.175.103
-193.106.229.186
  193.106.231.145
  193.106.247.24
  193.106.26.133
@@ -79352,6 +74537,7 @@
  193.106.57.239
  193.106.58.51
  193.106.60.145
+193.106.61.20
  193.106.95.186
  193.107.111.135
  193.107.112.79
@@ -79374,7 +74560,6 @@
  193.110.17.54
  193.110.183.208
  193.110.201.100
-193.110.246.232
  193.110.85.65
  193.111.136.162
  193.111.140.106
@@ -79386,95 +74571,71 @@
  193.111.243.124
  193.111.4.131
  193.111.4.163
-193.111.5.195
  193.111.5.214
  193.111.5.221
  193.112.1.26
-193.112.100.92
  193.112.102.52
  193.112.104.178
  193.112.107.200
-193.112.107.55
  193.112.108.11
  193.112.108.135
  193.112.108.148
  193.112.109.108
+193.112.11.242
  193.112.110.35
  193.112.111.207
-193.112.111.28
-193.112.112.78
  193.112.117.113
  193.112.118.128
  193.112.118.135
  193.112.123.100
  193.112.126.64
  193.112.127.245
-193.112.132.75
-193.112.137.231
  193.112.138.148
  193.112.139.159
  193.112.140.108
-193.112.143.141
-193.112.143.80
  193.112.154.159
-193.112.156.178
-193.112.158.202
-193.112.158.242
  193.112.16.224
-193.112.16.245
  193.112.160.203
  193.112.162.48
  193.112.163.159
  193.112.164.105
  193.112.169.87
-193.112.171.201
  193.112.172.57
  193.112.174.15
  193.112.18.214
  193.112.180.221
-193.112.180.237
  193.112.187.205
-193.112.19.70
  193.112.191.228
  193.112.195.243
  193.112.196.101
  193.112.197.250
  193.112.199.1
-193.112.202.61
  193.112.203.134
  193.112.207.65
  193.112.209.128
  193.112.210.74
  193.112.213.227
  193.112.213.248
-193.112.216.235
  193.112.218.253
  193.112.221.134
  193.112.23.105
-193.112.23.7
-193.112.244.218
-193.112.247.104
  193.112.247.98
  193.112.248.85
  193.112.249.29
-193.112.25.23
  193.112.250.77
  193.112.251.36
+193.112.30.127
+193.112.35.29
  193.112.39.179
  193.112.39.2
  193.112.4.12
-193.112.40.218
  193.112.42.13
  193.112.43.96
-193.112.44.102
+193.112.46.206
  193.112.47.20
-193.112.47.237
  193.112.48.79
  193.112.49.125
  193.112.5.66
-193.112.50.203
-193.112.50.234
-193.112.54.190
  193.112.60.122
  193.112.63.60
  193.112.66.187
@@ -79483,12 +74644,8 @@
  193.112.72.37
  193.112.73.244
  193.112.74.169
-193.112.74.180
  193.112.74.230
-193.112.77.212
-193.112.79.159
  193.112.79.20
-193.112.8.113
  193.112.82.160
  193.112.85.35
  193.112.86.231
@@ -79500,7 +74657,6 @@
  193.112.98.8
  193.112.99.188
  193.116.116.193
-193.116.84.26
  193.118.53.138
  193.118.53.139
  193.118.53.140
@@ -79526,22 +74682,16 @@
  193.118.55.148
  193.118.55.149
  193.118.55.150
-193.119.114.38
  193.119.60.81
  193.122.107.3
-193.122.129.167
  193.122.153.175
-193.122.162.49
  193.122.163.242
-193.122.167.164
  193.122.195.152
  193.124.183.187
-193.135.10.211
  193.135.134.206
  193.135.144.228
  193.135.153.242
  193.137.208.199
-193.137.7.196
  193.138.130.242
  193.138.204.251
  193.138.218.72
@@ -79553,20 +74703,13 @@
  193.142.146.53
  193.142.219.75
  193.142.30.161
-193.142.59.108
  193.142.59.135
-193.142.59.154
  193.142.59.169
-193.142.59.175
  193.142.59.18
-193.142.59.189
-193.142.59.198
  193.142.59.78
  193.147.114.10
  193.148.18.100
-193.148.69.157
  193.148.70.150
-193.148.70.253
  193.148.70.4
  193.148.71.10
  193.148.73.10
@@ -79575,6 +74718,7 @@
  193.150.105.193
  193.150.121.66
  193.150.153.32
+193.150.21.138
  193.150.233.115
  193.150.253.66
  193.150.53.157
@@ -79592,6 +74736,7 @@
  193.164.140.88
  193.164.216.238
  193.164.254.214
+193.165.237.47
  193.168.146.18
  193.168.146.25
  193.168.146.3
@@ -79616,13 +74761,13 @@
  193.169.245.78
  193.169.245.81
  193.169.245.87
-193.169.252.0
  193.169.252.205
  193.169.252.206
  193.169.252.208
  193.169.252.210
  193.169.252.31
  193.169.252.58
+193.169.252.69
  193.169.252.81
  193.169.252.82
  193.169.252.83
@@ -79633,19 +74778,15 @@
  193.169.253.136
  193.169.253.137
  193.169.253.139
-193.169.253.153
  193.169.253.172
  193.169.253.173
  193.169.253.175
  193.169.253.178
  193.169.253.206
-193.169.253.27
  193.169.253.32
  193.169.253.35
-193.169.253.48
-193.169.253.49
+193.169.253.41
  193.169.253.52
-193.169.253.56
  193.169.253.63
  193.169.253.66
  193.169.253.68
@@ -79658,10 +74799,10 @@
  193.169.5.14
  193.169.61.162
  193.174.89.19
+193.176.242.137
  193.176.251.232
  193.176.84.121
  193.176.84.122
-193.176.84.125
  193.176.84.126
  193.176.84.130
  193.176.84.131
@@ -79671,7 +74812,6 @@
  193.176.84.44
  193.176.84.47
  193.176.84.49
-193.176.84.50
  193.176.84.53
  193.176.84.81
  193.176.84.82
@@ -79689,8 +74829,6 @@
  193.176.85.110
  193.176.85.111
  193.176.85.113
-193.176.85.115
-193.176.85.116
  193.176.85.71
  193.176.85.73
  193.176.85.74
@@ -79712,16 +74850,16 @@
  193.178.118.12
  193.178.118.4
  193.178.118.5
-193.178.131.133
+193.178.146.236
+193.178.146.237
  193.178.146.238
+193.178.147.34
  193.178.169.252
  193.181.51.163
  193.183.246.194
-193.186.15.35
  193.187.101.114
  193.187.101.138
  193.187.103.47
-193.187.174.202
  193.187.92.224
  193.187.95.93
  193.188.254.67
@@ -79740,6 +74878,7 @@
  193.19.243.246
  193.19.96.130
  193.192.122.65
+193.192.179.56
  193.193.194.194
  193.193.240.34
  193.193.240.36
@@ -79777,12 +74916,12 @@
  193.202.80.12
  193.202.80.25
  193.202.81.178
+193.202.82.129
  193.202.82.169
  193.202.82.38
  193.202.82.69
  193.202.86.228
  193.203.11.254
-193.203.11.84
  193.203.232.51
  193.203.233.51
  193.203.9.192
@@ -79810,13 +74949,14 @@
  193.218.118.95
  193.219.38.56
  193.219.97.244
+193.22.152.252
  193.22.159.250
  193.222.130.14
  193.224.96.3
  193.225.126.2
  193.225.218.110
  193.225.218.114
-193.226.199.110
+193.226.238.119
  193.227.11.123
  193.227.11.126
  193.227.111.34
@@ -79827,8 +74967,6 @@
  193.227.49.81
  193.227.5.24
  193.228.108.122
-193.228.109.227
-193.228.162.185
  193.228.53.78
  193.228.57.193
  193.228.57.76
@@ -79845,6 +74983,7 @@
  193.228.59.130
  193.228.59.208
  193.228.59.239
+193.228.59.5
  193.228.60.220
  193.228.91.105
  193.228.91.109
@@ -79872,10 +75011,8 @@
  193.239.102.12
  193.239.127.25
  193.239.147.100
-193.239.147.102
  193.239.147.125
  193.239.147.130
-193.239.147.183
  193.239.147.201
  193.239.147.211
  193.239.147.229
@@ -79885,11 +75022,9 @@
  193.239.147.43
  193.239.147.5
  193.239.147.52
-193.239.147.63
  193.239.147.66
  193.239.186.138
  193.239.187.142
-193.239.212.81
  193.239.232.101
  193.239.232.102
  193.239.234.253
@@ -79916,7 +75051,6 @@
  193.248.180.212
  193.248.220.243
  193.248.235.20
-193.248.60.205
  193.25.197.129
  193.25.215.187
  193.25.253.84
@@ -79936,12 +75070,10 @@
  193.252.54.240
  193.252.8.76
  193.253.177.69
-193.254.135.252
  193.254.184.188
  193.254.245.10
  193.254.245.90
  193.254.245.98
-193.27.12.10
  193.27.13.180
  193.27.228.100
  193.27.228.130
@@ -79963,7 +75095,6 @@
  193.27.229.183
  193.27.229.184
  193.27.229.207
-193.27.229.214
  193.27.229.215
  193.27.229.216
  193.27.229.217
@@ -80266,6 +75397,7 @@
  193.31.127.14
  193.31.127.151
  193.31.127.163
+193.31.127.177
  193.31.127.185
  193.31.127.202
  193.31.127.228
@@ -80281,7 +75413,6 @@
  193.32.126.161
  193.32.13.128
  193.32.161.77
-193.32.163.108
  193.32.163.53
  193.32.188.177
  193.32.188.211
@@ -80309,14 +75440,14 @@
  193.32.8.5
  193.32.8.50
  193.32.8.51
-193.32.8.52
+193.32.8.53
  193.32.8.54
  193.32.8.59
  193.32.8.6
  193.32.8.60
+193.32.8.63
  193.32.8.7
  193.32.8.9
-193.33.111.97
  193.33.231.140
  193.33.240.91
  193.34.144.138
@@ -80329,12 +75460,10 @@
  193.34.55.242
  193.34.55.64
  193.34.60.211
-193.34.61.60
  193.34.62.53
  193.34.93.221
  193.36.119.115
  193.36.15.173
-193.36.224.45
  193.37.192.243
  193.37.212.20
  193.37.213.3
@@ -80350,7 +75479,6 @@
  193.39.220.13
  193.40.10.82
  193.40.224.154
-193.41.114.25
  193.41.114.34
  193.41.114.62
  193.41.115.103
@@ -80365,6 +75493,9 @@
  193.41.86.175
  193.41.86.177
  193.41.86.184
+193.41.87.139
+193.41.87.179
+193.41.87.189
  193.41.87.217
  193.41.87.223
  193.42.110.124
@@ -80372,15 +75503,7 @@
  193.42.136.88
  193.42.137.113
  193.42.137.116
-193.42.137.121
  193.42.137.127
-193.42.137.129
-193.42.137.130
-193.42.137.131
-193.42.137.132
-193.42.137.133
-193.42.137.134
-193.42.137.135
  193.42.96.108
  193.42.99.242
  193.43.252.210
@@ -80397,18 +75520,16 @@
  193.56.20.135
  193.56.20.152
  193.56.20.180
+193.56.20.190
+193.56.20.249
  193.56.20.92
  193.56.20.96
-193.56.240.140
  193.56.252.210
-193.56.252.250
-193.56.28.0
  193.56.28.102
  193.56.28.107
  193.56.28.118
  193.56.28.119
  193.56.28.122
-193.56.28.131
  193.56.28.145
  193.56.28.152
  193.56.28.158
@@ -80421,33 +75542,30 @@
  193.56.28.173
  193.56.28.177
  193.56.28.182
-193.56.28.185
+193.56.28.183
  193.56.28.201
  193.56.28.205
  193.56.28.213
  193.56.28.215
-193.56.28.232
  193.56.28.237
  193.56.28.241
  193.56.28.248
  193.56.28.30
-193.56.28.34
  193.56.28.55
  193.56.28.68
  193.56.28.72
  193.56.28.74
-193.56.28.77
  193.56.29.251
  193.56.64.102
  193.56.64.124
  193.56.64.142
+193.56.64.153
  193.56.64.155
  193.56.64.156
  193.56.64.16
  193.56.64.179
  193.56.64.190
  193.56.64.224
-193.56.64.24
  193.56.64.67
  193.56.72.117
  193.56.72.122
@@ -80458,6 +75576,7 @@
  193.56.72.212
  193.56.72.232
  193.56.72.68
+193.56.72.81
  193.56.72.90
  193.56.73.178
  193.57.139.192
@@ -80467,11 +75586,11 @@
  193.57.73.118
  193.58.168.177
  193.58.169.27
-193.58.196.146
  193.58.196.212
  193.59.26.243
  193.59.26.248
  193.59.26.46
+193.63.77.2
  193.66.10.46
  193.68.139.18
  193.68.19.34
@@ -80480,19 +75599,15 @@
  193.68.47.76
  193.68.74.42
  193.7.200.102
-193.70.0.173
  193.70.0.42
-193.70.112.6
  193.70.125.186
  193.70.21.159
  193.70.32.13
  193.70.33.51
  193.70.34.209
  193.70.38.187
-193.70.39.135
  193.70.39.203
  193.70.39.41
-193.70.42.33
  193.70.47.137
  193.70.72.249
  193.70.73.74
@@ -80501,11 +75616,9 @@
  193.70.84.113
  193.70.88.213
  193.70.89.118
-193.70.89.69
  193.70.91.148
  193.70.91.79
  193.71.141.104
-193.75.54.35
  193.77.113.37
  193.77.117.97
  193.77.155.50
@@ -80514,13 +75627,10 @@
  193.77.35.9
  193.77.51.6
  193.77.54.17
-193.77.65.237
  193.77.82.38
-193.8.215.14
-193.8.82.13
+193.8.231.17
  193.8.83.28
  193.83.122.144
-193.83.211.110
  193.84.116.22
  193.85.145.251
  193.85.175.164
@@ -80537,7 +75647,6 @@
  193.9.158.74
  193.9.158.97
  193.9.21.34
-193.9.46.50
  193.90.12.86
  193.90.12.87
  193.90.146.39
@@ -80565,6 +75674,7 @@
  193.93.193.242
  193.93.193.248
  193.93.194.17
+193.93.194.182
  193.93.195.22
  193.93.195.32
  193.93.195.36
@@ -80584,10 +75694,10 @@
  194.1.247.250
  194.1.249.27
  194.102.40.134
+194.104.11.69
  194.104.9.112
  194.104.9.138
  194.104.9.198
-194.104.9.244
  194.104.9.59
  194.104.9.68
  194.104.9.76
@@ -80616,10 +75726,8 @@
  194.124.213.78
  194.124.251.18
  194.126.110.134
-194.126.158.125
  194.126.183.171
  194.126.25.28
-194.127.178.130
  194.127.179.119
  194.127.179.57
  194.135.135.69
@@ -80645,17 +75753,17 @@
  194.141.2.21
  194.141.2.254
  194.141.86.251
-194.143.136.122
  194.143.137.124
  194.143.151.35
  194.143.151.96
  194.143.194.107
  194.143.228.226
  194.143.244.220
+194.143.248.165
  194.143.248.174
-194.143.248.84
  194.143.248.97
  194.143.249.140
+194.143.249.16
  194.143.249.165
  194.143.249.33
  194.143.249.54
@@ -80663,12 +75771,11 @@
  194.143.250.143
  194.143.250.173
  194.143.250.210
-194.143.250.242
  194.143.250.253
  194.143.250.41
-194.143.250.44
  194.143.250.69
  194.143.250.86
+194.143.251.114
  194.143.251.161
  194.143.251.190
  194.143.251.94
@@ -80677,8 +75784,8 @@
  194.146.110.228
  194.146.225.214
  194.147.115.46
+194.147.27.63
  194.147.32.111
-194.147.34.198
  194.147.34.64
  194.147.78.217
  194.15.231.56
@@ -80715,14 +75822,15 @@
  194.15.36.96
  194.15.36.97
  194.150.215.103
-194.150.215.134
+194.150.215.115
  194.150.215.149
-194.150.215.186
  194.150.215.38
+194.150.215.60
+194.150.215.92
+194.150.215.93
  194.150.253.204
  194.150.255.200
  194.152.206.103
-194.152.206.12
  194.152.206.17
  194.152.206.93
  194.152.214.213
@@ -80734,7 +75842,6 @@
  194.156.124.199
  194.156.124.248
  194.156.124.250
-194.156.124.88
  194.156.125.199
  194.156.125.94
  194.156.133.97
@@ -80747,8 +75854,6 @@
  194.156.184.28
  194.156.251.14
  194.156.97.147
-194.156.97.183
-194.156.97.221
  194.158.192.17
  194.158.200.150
  194.158.201.245
@@ -80790,13 +75895,11 @@
  194.181.194.246
  194.181.82.190
  194.182.160.70
-194.182.65.100
  194.182.72.214
  194.182.75.23
  194.182.86.11
  194.183.15.230
  194.183.244.147
-194.183.77.236
  194.184.168.131
  194.186.123.138
  194.186.168.50
@@ -80810,7 +75913,6 @@
  194.187.123.240
  194.187.133.160
  194.187.150.5
-194.187.151.237
  194.187.170.102
  194.187.170.106
  194.187.170.109
@@ -80840,7 +75942,6 @@
  194.187.249.56
  194.187.249.76
  194.190.143.48
-194.190.22.90
  194.190.49.103
  194.190.67.75
  194.190.82.42
@@ -80848,9 +75949,9 @@
  194.190.93.136
  194.190.96.114
  194.193.207.104
+194.193.215.164
  194.193.34.178
  194.193.58.138
-194.199.117.87
  194.201.253.190
  194.201.253.5
  194.204.123.123
@@ -80863,8 +75964,6 @@
  194.219.127.242
  194.219.220.50
  194.223.60.214
-194.224.115.11
-194.225.24.196
  194.226.61.18
  194.226.98.16
  194.228.129.189
@@ -80911,16 +76010,17 @@
  194.26.27.103
  194.26.27.104
  194.26.27.106
+194.26.27.107
  194.26.29.22
  194.26.29.23
  194.26.29.31
  194.26.29.32
+194.26.29.34
  194.26.29.44
  194.27.68.207
  194.28.112.12
  194.28.222.1
  194.28.223.242
-194.28.50.114
  194.28.89.30
  194.30.105.69
  194.31.141.131
@@ -80933,13 +76033,13 @@
  194.32.79.210
  194.33.45.136
  194.34.132.8
+194.34.132.89
  194.34.132.90
  194.34.132.91
  194.34.133.24
  194.35.113.73
  194.35.184.150
  194.35.248.23
-194.35.48.67
  194.36.174.154
  194.36.188.112
  194.36.188.12
@@ -80959,17 +76059,16 @@
  194.36.97.77
  194.36.97.89
  194.36.98.100
+194.36.98.224
  194.36.99.237
  194.38.0.163
  194.38.123.211
  194.38.146.73
  194.39.127.40
-194.39.196.27
  194.42.108.226
  194.42.139.129
  194.42.16.25
  194.44.110.114
-194.44.123.114
  194.44.146.181
  194.44.153.239
  194.44.160.246
@@ -80986,6 +76085,7 @@
  194.44.38.51
  194.44.41.0
  194.44.61.82
+194.44.78.22
  194.44.86.243
  194.44.94.103
  194.48.152.60
@@ -80993,11 +76093,9 @@
  194.49.127.30
  194.49.60.74
  194.5.159.197
-194.5.188.76
+194.5.188.193
  194.5.192.244
-194.5.193.141
  194.5.207.163
-194.5.207.189
  194.5.249.0
  194.5.249.125
  194.5.249.130
@@ -81013,7 +76111,6 @@
  194.51.80.237
  194.54.160.248
  194.54.66.150
-194.55.12.116
  194.58.111.244
  194.58.154.74
  194.58.154.78
@@ -81021,7 +76118,6 @@
  194.58.70.206
  194.58.70.221
  194.58.70.84
-194.58.79.69
  194.58.88.189
  194.59.172.20
  194.59.204.187
@@ -81030,7 +76126,7 @@
  194.59.244.93
  194.59.251.43
  194.6.231.122
-194.6.232.150
+194.60.238.56
  194.61.1.73
  194.61.24.102
  194.61.24.172
@@ -81052,7 +76148,6 @@
  194.63.129.36
  194.63.140.227
  194.63.143.79
-194.63.218.143
  194.63.235.156
  194.65.71.247
  194.67.108.46
@@ -81070,15 +76165,16 @@
  194.71.126.76
  194.72.112.130
  194.73.218.58
+194.73.218.62
  194.78.242.245
  194.79.157.171
+194.79.62.217
  194.8.136.62
  194.8.145.62
  194.8.146.167
  194.8.146.220
+194.8.147.18
  194.84.0.85
-194.87.110.166
-194.87.117.150
  194.87.138.0
  194.87.138.10
  194.87.138.102
@@ -81117,13 +76213,11 @@
  194.87.138.56
  194.87.138.78
  194.87.138.8
-194.87.138.80
  194.87.138.86
  194.87.139.108
  194.87.139.113
  194.87.139.136
  194.87.139.145
-194.87.139.166
  194.87.139.183
  194.87.139.207
  194.87.139.230
@@ -81131,7 +76225,6 @@
  194.87.139.47
  194.87.139.80
  194.87.139.87
-194.87.139.99
  194.87.147.137
  194.87.157.56
  194.87.18.147
@@ -81141,8 +76234,8 @@
  194.87.52.226
  194.88.107.222
  194.88.107.53
-194.88.143.38
-194.88.143.43
+194.88.143.32
+194.88.143.42
  194.88.143.66
  194.88.224.113
  194.9.177.10
@@ -81153,22 +76246,21 @@
  194.9.71.232
  194.90.160.133
  194.90.73.231
-194.96.118.230
  194.99.105.206
  194.99.20.29
-194.99.23.93
  194.99.25.245
  194.99.25.34
  194.99.25.51
  194.99.25.77
  194.99.25.88
+195.101.108.122
  195.103.51.22
  195.110.147.194
+195.110.34.91
  195.110.35.115
  195.110.58.205
  195.110.58.213
  195.112.197.19
-195.112.224.111
  195.112.227.180
  195.112.252.180
  195.112.64.53
@@ -81179,10 +76271,9 @@
  195.117.107.182
  195.117.107.190
  195.117.193.1
-195.117.218.190
-195.12.137.210
  195.12.49.210
  195.120.213.59
+195.122.213.190
  195.122.226.164
  195.122.3.246
  195.123.188.186
@@ -81198,8 +76289,10 @@
  195.123.233.21
  195.123.234.33
  195.123.237.110
+195.123.240.177
  195.123.240.236
  195.123.241.204
+195.123.241.22
  195.123.242.97
  195.123.245.175
  195.123.246.77
@@ -81208,33 +76301,29 @@
  195.128.118.44
  195.128.119.233
  195.128.119.244
+195.128.126.36
  195.128.174.132
  195.13.201.98
  195.130.152.71
  195.130.73.229
  195.132.109.135
  195.133.142.52
-195.133.201.208
  195.133.207.117
  195.133.220.18
  195.133.243.87
-195.133.32.98
-195.134.176.175
  195.135.194.8
  195.135.213.241
  195.135.51.246
  195.136.172.22
-195.136.205.8
  195.136.206.230
+195.136.27.229
  195.136.27.30
  195.136.56.191
  195.137.140.179
  195.137.74.2
  195.138.73.54
  195.138.74.25
-195.138.83.218
  195.138.85.161
-195.138.87.163
  195.138.88.19
  195.138.90.121
  195.138.92.152
@@ -81272,9 +76361,7 @@
  195.154.102.211
  195.154.104.6
  195.154.105.60
-195.154.108.118
  195.154.111.146
-195.154.112.227
  195.154.113.90
  195.154.114.117
  195.154.114.202
@@ -81282,6 +76369,7 @@
  195.154.134.100
  195.154.146.3
  195.154.150.150
+195.154.152.80
  195.154.156.215
  195.154.156.3
  195.154.162.174
@@ -81296,7 +76384,6 @@
  195.154.172.46
  195.154.173.105
  195.154.174.135
-195.154.176.103
  195.154.176.37
  195.154.177.139
  195.154.179.3
@@ -81317,7 +76404,6 @@
  195.154.194.111
  195.154.194.116
  195.154.194.179
-195.154.194.28
  195.154.199.101
  195.154.199.145
  195.154.199.185
@@ -81348,7 +76434,7 @@
  195.154.232.38
  195.154.232.63
  195.154.233.102
-195.154.237.111
+195.154.233.88
  195.154.237.156
  195.154.240.184
  195.154.241.213
@@ -81367,7 +76453,6 @@
  195.154.42.43
  195.154.43.1
  195.154.43.44
-195.154.46.27
  195.154.47.113
  195.154.48.129
  195.154.48.218
@@ -81375,6 +76460,7 @@
  195.154.54.229
  195.154.55.62
  195.154.56.105
+195.154.56.73
  195.154.56.86
  195.154.57.6
  195.154.60.148
@@ -81384,32 +76470,26 @@
  195.154.90.33
  195.155.232.36
  195.155.232.37
-195.158.100.201
  195.158.109.248
  195.158.14.206
  195.158.2.197
  195.158.20.94
-195.158.21.134
  195.158.22.251
  195.158.248.4
  195.158.26.238
  195.158.26.70
-195.158.28.62
  195.158.29.222
  195.158.6.55
  195.158.8.206
  195.158.8.210
  195.158.82.138
  195.159.180.19
-195.159.234.190
  195.159.28.229
  195.159.28.66
-195.16.128.49
  195.160.194.140
  195.161.114.23
  195.161.162.250
  195.161.162.254
-195.161.162.46
  195.161.2.66
  195.161.38.150
  195.162.81.91
@@ -81426,11 +76506,12 @@
  195.176.3.24
  195.178.106.145
  195.178.201.105
+195.178.203.178
  195.178.39.98
  195.18.224.6
  195.18.23.85
  195.18.33.130
-195.181.161.3
+195.181.113.176
  195.181.170.225
  195.181.170.91
  195.181.172.70
@@ -81439,8 +76520,8 @@
  195.181.215.65
  195.181.37.44
  195.181.39.219
+195.181.74.140
  195.182.131.101
-195.182.152.238
  195.182.157.150
  195.182.22.223
  195.184.117.11
@@ -81449,7 +76530,6 @@
  195.186.64.163
  195.186.81.204
  195.188.234.8
-195.189.123.84
  195.189.141.50
  195.189.227.16
  195.189.47.247
@@ -81477,6 +76557,7 @@
  195.20.133.161
  195.200.224.74
  195.200.244.73
+195.200.245.78
  195.201.11.58
  195.201.113.108
  195.201.113.152
@@ -81491,17 +76572,12 @@
  195.201.171.162
  195.201.2.24
  195.201.202.225
-195.201.232.57
-195.201.234.32
-195.201.235.127
-195.201.235.128
-195.201.235.135
-195.201.235.139
  195.201.24.22
  195.201.240.107
  195.201.33.0
  195.201.33.106
  195.201.33.65
+195.201.56.56
  195.201.56.70
  195.201.6.112
  195.201.61.135
@@ -81515,12 +76591,10 @@
  195.202.169.149
  195.204.16.82
  195.204.173.39
-195.204.7.6
  195.205.173.1
  195.205.175.110
-195.205.179.48
  195.206.105.217
-195.206.105.27
+195.206.105.22
  195.206.105.42
  195.206.106.156
  195.206.106.73
@@ -81548,7 +76622,6 @@
  195.211.160.88
  195.211.161.124
  195.211.163.22
-195.211.173.143
  195.211.219.47
  195.211.252.197
  195.211.253.86
@@ -81561,19 +76634,16 @@
  195.214.157.34
  195.214.196.234
  195.214.214.253
-195.214.223.84
  195.214.252.110
  195.214.253.108
  195.216.160.149
  195.218.174.50
-195.218.26.230
  195.22.101.58
  195.22.117.1
  195.22.148.53
  195.22.148.9
  195.22.153.170
  195.22.153.197
-195.22.153.199
  195.22.153.202
  195.22.153.204
  195.22.239.150
@@ -81595,6 +76665,8 @@
  195.224.116.20
  195.224.138.61
  195.225.118.37
+195.225.118.38
+195.225.118.41
  195.225.118.54
  195.225.168.186
  195.225.48.113
@@ -81606,7 +76678,6 @@
  195.225.49.136
  195.226.227.73
  195.226.254.7
-195.228.148.10
  195.228.231.218
  195.228.45.47
  195.228.65.108
@@ -81617,17 +76688,13 @@
  195.228.8.8
  195.228.80.166
  195.23.181.218
-195.230.103.217
  195.230.141.2
  195.230.141.68
  195.230.154.2
  195.230.158.1
  195.230.158.20
  195.230.158.9
-195.231.1.153
-195.231.4.203
  195.231.8.43
-195.231.81.43
  195.231.82.44
  195.231.83.147
  195.234.171.80
@@ -81661,7 +76728,6 @@
  195.24.61.7
  195.241.146.206
  195.242.103.120
-195.242.213.148
  195.244.209.70
  195.245.112.235
  195.246.120.141
@@ -81688,7 +76754,6 @@
  195.250.253.134
  195.251.143.108
  195.251.200.71
-195.251.251.52
  195.252.88.109
  195.253.6.106
  195.253.6.133
@@ -81721,15 +76786,19 @@
  195.3.195.8
  195.32.106.250
  195.32.14.2
+195.32.14.24
  195.32.14.7
  195.32.44.245
  195.32.47.161
+195.32.73.173
+195.32.74.216
  195.32.74.79
-195.32.75.135
  195.32.75.23
+195.32.75.246
+195.32.79.16
+195.33.206.179
  195.33.246.1
  195.34.242.131
-195.34.243.122
  195.34.73.90
  195.34.78.110
  195.35.245.30
@@ -81744,7 +76813,6 @@
  195.40.181.55
  195.43.7.203
  195.46.105.233
-195.46.109.249
  195.46.110.66
  195.46.20.146
  195.47.243.254
@@ -81753,14 +76821,15 @@
  195.49.41.143
  195.49.41.231
  195.49.41.232
+195.5.12.90
  195.5.163.212
  195.5.246.162
  195.52.66.218
  195.53.165.150
  195.53.237.122
  195.54.160.155
-195.54.160.183
  195.54.160.20
+195.54.160.223
  195.54.160.228
  195.54.160.85
  195.54.161.104
@@ -81782,9 +76851,7 @@
  195.54.167.127
  195.54.167.89
  195.54.167.91
-195.54.42.199
  195.56.165.14
-195.56.187.26
  195.56.55.217
  195.56.63.10
  195.56.63.4
@@ -81805,12 +76872,7 @@
  195.58.39.154
  195.58.39.155
  195.58.39.159
-195.58.39.216
  195.58.39.223
-195.58.39.234
-195.58.39.249
-195.58.39.66
-195.58.39.70
  195.60.174.112
  195.60.174.123
  195.60.175.143
@@ -81825,7 +76887,6 @@
  195.62.32.227
  195.62.46.156
  195.62.46.94
-195.62.46.96
  195.62.46.98
  195.66.179.90
  195.66.216.134
@@ -81836,8 +76897,6 @@
  195.69.140.33
  195.69.187.6
  195.69.221.198
-195.69.222.71
-195.69.228.134
  195.69.76.159
  195.7.8.10
  195.7.9.141
@@ -81863,6 +76922,7 @@
  195.81.64.102
  195.81.66.65
  195.82.116.230
+195.82.69.150
  195.86.221.36
  195.86.221.37
  195.86.221.42
@@ -81884,18 +76944,18 @@
  195.9.33.186
  195.9.49.26
  195.9.61.22
+195.9.68.154
  195.9.80.22
  195.9.89.66
  195.9.89.68
  195.9.89.70
-195.91.182.76
  195.91.186.78
  195.91.239.8
  195.91.48.34
-195.93.168.1
-195.93.168.3
  195.93.248.49
+195.94.189.12
  195.94.189.78
+195.94.189.81
  195.95.131.211
  195.95.131.214
  195.95.131.215
@@ -81903,29 +76963,25 @@
  195.95.215.157
  195.95.228.30
  195.95.229.230
-195.96.231.204
  195.97.19.2
  195.97.75.174
  195.97.83.206
  195.98.176.62
  19536.psdzy.com
  195479-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-196.0.109.254
  196.0.111.186
  196.0.111.194
  196.0.113.10
-196.0.113.170
  196.0.115.130
  196.0.117.146
-196.0.122.126
  196.0.122.146
  196.0.122.94
  196.0.27.230
  196.0.32.94
-196.0.34.106
  196.0.34.142
  196.0.40.130
  196.0.49.198
+196.0.86.122
  196.0.86.242
  196.0.87.10
  196.0.87.198
@@ -81935,12 +76991,10 @@
  196.1.253.28
  196.1.97.206
  196.1.97.216
-196.11.231.36
  196.11.62.85
  196.11.80.154
  196.112.81.120
  196.12.186.34
-196.13.111.127
  196.132.4.126
  196.14.130.164
  196.15.133.177
@@ -81955,16 +77009,15 @@
  196.16.223.6
  196.16.223.72
  196.16.241.53
-196.16.243.2
-196.17.162.110
+196.17.162.196
  196.17.162.212
  196.17.232.48
  196.17.240.15
-196.178.21.53
  196.179.244.65
  196.179.246.213
  196.18.175.189
  196.18.187.154
+196.18.225.127
  196.180.54.59
  196.181.184.191
  196.183.230.199
@@ -81979,14 +77032,13 @@
  196.188.49.255
  196.188.51.243
  196.188.51.250
-196.189.91.138
+196.188.72.61
  196.189.91.162
-196.189.91.166
  196.189.91.196
  196.190.7.64
  196.192.185.189
  196.195.163.68
-196.196.112.225
+196.196.112.38
  196.196.147.17
  196.196.147.55
  196.196.148.185
@@ -81997,11 +77049,11 @@
  196.196.160.196
  196.196.160.223
  196.196.160.88
-196.196.194.217
+196.196.194.198
  196.196.194.226
-196.196.194.227
  196.196.194.83
-196.196.198.136
+196.196.195.199
+196.196.198.97
  196.196.220.136
  196.196.220.76
  196.196.222.221
@@ -82009,7 +77061,6 @@
  196.196.222.50
  196.196.222.68
  196.196.224.127
-196.196.224.135
  196.196.224.171
  196.196.224.18
  196.196.224.229
@@ -82020,18 +77071,18 @@
  196.196.246.24
  196.196.246.51
  196.196.247.113
+196.196.253.90
  196.196.254.231
  196.196.34.11
  196.196.34.136
-196.196.34.20
  196.196.34.215
  196.196.37.171
  196.196.47.108
-196.196.47.239
  196.196.47.29
  196.196.50.159
  196.196.50.237
  196.196.50.25
+196.196.68.149
  196.196.8.53
  196.196.85.199
  196.196.85.245
@@ -82064,6 +77115,7 @@
  196.202.168.130
  196.202.174.62
  196.202.202.197
+196.202.209.83
  196.202.220.95
  196.202.24.113
  196.202.255.12
@@ -82073,8 +77125,6 @@
  196.202.71.90
  196.203.182.166
  196.203.219.138
-196.203.31.154
-196.203.72.103
  196.204.25.90
  196.204.25.92
  196.204.28.100
@@ -82084,18 +77134,15 @@
  196.206.227.153
  196.206.228.220
  196.206.228.246
-196.206.254.240
  196.206.83.31
  196.206.87.210
-196.207.177.85
  196.207.184.14
  196.211.152.198
  196.213.65.166
  196.215.192.62
  196.216.220.196
  196.216.220.204
-196.216.228.34
-196.216.73.90
+196.216.93.62
  196.217.240.243
  196.217.241.174
  196.218.112.123
@@ -82108,7 +77155,6 @@
  196.218.58.210
  196.218.89.46
  196.219.135.42
-196.219.143.49
  196.219.163.197
  196.219.190.203
  196.219.85.159
@@ -82132,6 +77178,7 @@
  196.221.165.17
  196.221.165.32
  196.221.167.186
+196.221.39.2
  196.223.121.157
  196.223.157.7
  196.223.162.130
@@ -82143,25 +77190,25 @@
  196.240.104.181
  196.240.104.22
  196.240.105.112
+196.240.105.119
  196.240.105.136
-196.240.105.151
  196.240.105.44
  196.240.109.121
  196.240.109.127
  196.240.109.149
  196.240.109.15
-196.240.109.154
  196.240.109.157
+196.240.109.16
  196.240.109.169
-196.240.109.179
-196.240.109.187
  196.240.109.189
  196.240.109.203
  196.240.109.212
  196.240.109.224
  196.240.109.235
  196.240.109.237
+196.240.109.242
  196.240.109.243
+196.240.109.29
  196.240.109.3
  196.240.109.38
  196.240.109.56
@@ -82170,23 +77217,22 @@
  196.240.143.186
  196.240.143.217
  196.240.143.218
-196.240.143.231
  196.240.143.242
-196.240.143.8
  196.240.173.126
  196.240.173.157
  196.240.173.178
  196.240.173.187
  196.240.173.192
  196.240.173.206
-196.240.173.241
  196.240.237.116
  196.240.237.191
  196.240.237.207
  196.240.237.36
  196.240.250.117
  196.240.250.13
+196.240.250.198
  196.240.250.232
+196.240.250.33
  196.240.250.37
  196.240.250.39
  196.240.250.49
@@ -82200,7 +77246,7 @@
  196.240.58.245
  196.240.58.65
  196.242.114.92
-196.242.178.129
+196.242.178.17
  196.242.178.229
  196.242.178.37
  196.242.178.43
@@ -82216,26 +77262,21 @@
  196.242.20.78
  196.242.20.80
  196.242.21.151
-196.242.244.229
  196.242.3.164
  196.242.3.170
  196.242.47.118
  196.242.47.5
  196.244.192.56
  196.244.4.116
-196.244.4.167
  196.245.148.101
  196.245.148.106
  196.245.148.151
-196.245.148.183
  196.245.148.187
-196.245.148.191
  196.245.148.37
-196.245.149.209
  196.245.149.211
  196.245.149.226
  196.245.149.228
-196.245.154.35
+196.245.149.245
  196.245.159.245
  196.245.159.35
  196.245.159.37
@@ -82243,9 +77284,6 @@
  196.245.160.172
  196.245.163.59
  196.245.163.69
-196.245.164.100
-196.245.164.139
-196.245.164.43
  196.245.184.144
  196.245.184.225
  196.245.185.222
@@ -82254,9 +77292,7 @@
  196.245.186.224
  196.245.186.6
  196.245.187.144
-196.245.217.126
  196.245.217.145
-196.245.217.156
  196.245.217.202
  196.245.217.225
  196.245.217.227
@@ -82266,6 +77302,7 @@
  196.245.219.161
  196.245.219.201
  196.245.232.139
+196.245.236.85
  196.245.237.169
  196.245.237.190
  196.245.237.228
@@ -82290,7 +77327,6 @@
  196.245.250.215
  196.245.250.222
  196.245.250.227
-196.245.251.182
  196.245.254.103
  196.245.254.138
  196.245.254.197
@@ -82314,9 +77350,9 @@
  196.247.162.10
  196.247.162.104
  196.247.162.110
-196.247.162.128
  196.247.162.139
  196.247.162.50
+196.247.162.57
  196.247.162.64
  196.247.163.195
  196.247.163.23
@@ -82336,7 +77372,6 @@
  196.247.5.242
  196.25.230.69
  196.25.237.218
-196.25.35.242
  196.25.94.134
  196.250.150.244
  196.250.176.17
@@ -82349,9 +77384,7 @@
  196.27.106.112
  196.27.107.173
  196.27.107.231
-196.27.115.50
  196.27.127.170
-196.27.127.61
  196.27.73.219
  196.28.101.116
  196.28.101.117
@@ -82369,13 +77402,9 @@
  196.3.97.70
  196.3.99.197
  196.3.99.210
-196.32.146.98
  196.33.226.72
  196.34.217.228
  196.35.193.107
-196.35.41.109
-196.36.1.107
-196.36.1.108
  196.36.152.50
  196.37.111.104
  196.37.111.106
@@ -82387,25 +77416,25 @@
  196.41.102.130
  196.41.122.94
  196.41.130.159
+196.41.17.62
  196.41.2.166
  196.41.48.84
  196.41.51.22
  196.42.30.51
  196.43.171.28
  196.43.196.30
-196.43.231.123
  196.44.10.207
  196.44.176.155
  196.44.176.43
+196.44.176.55
  196.44.202.122
  196.44.236.202
  196.45.141.38
-196.46.202.224
+196.46.202.80
  196.46.39.53
  196.46.55.2
  196.50.13.218
  196.50.196.82
-196.50.247.254
  196.52.10.12
  196.52.10.29
  196.52.10.7
@@ -82496,17 +77525,15 @@
  196.53.224.150
  196.6.112.70
  196.6.232.32
-196.61.32.43
  196.64.12.43
-196.64.47.233
  196.64.56.184
  196.65.210.179
  196.66.194.166
-196.68.192.123
  196.68.238.98
  196.69.155.161
-196.70.252.2
+196.74.111.243
  196.75.164.124
+196.89.156.149
  196.92.4.155
  196.92.5.68
  19618-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -82514,15 +77541,13 @@
  197.1.142.52
  197.1.6.184
  197.1.94.79
-197.115.148.158
-197.115.7.100
+197.114.98.25
  197.13.2.215
  197.132.16.228
  197.132.9.19
  197.135.225.135
  197.135.241.60
  197.136.142.5
-197.136.235.10
  197.14.199.24
  197.14.216.207
  197.14.82.93
@@ -82531,8 +77556,7 @@
  197.149.148.110
  197.149.39.245
  197.149.86.194
-197.153.102.218
-197.153.95.121
+197.153.102.4
  197.155.193.115
  197.155.6.43
  197.156.130.22
@@ -82541,8 +77565,6 @@
  197.156.190.206
  197.156.234.164
  197.156.65.138
-197.156.66.178
-197.156.78.190
  197.157.17.86
  197.157.194.254
  197.157.195.1
@@ -82575,36 +77597,30 @@
  197.157.254.162
  197.157.254.34
  197.157.255.38
-197.158.22.23
  197.159.0.214
  197.159.12.167
-197.159.167.116
  197.159.197.92
  197.159.218.209
  197.159.23.174
  197.159.3.35
-197.159.68.8
  197.159.9.29
  197.164.238.54
  197.164.97.71
+197.165.204.252
  197.166.74.216
  197.185.108.1
-197.185.109.15
+197.185.98.107
  197.185.98.173
  197.185.98.210
-197.188.147.163
-197.188.149.10
  197.188.149.125
-197.188.150.23
-197.188.150.236
  197.188.151.28
  197.188.163.103
-197.188.163.18
  197.188.165.212
  197.188.223.132
  197.2.143.125
  197.2.148.6
  197.206.139.101
+197.207.145.210
  197.210.109.44
  197.210.114.50
  197.210.114.58
@@ -82622,7 +77638,6 @@
  197.210.215.76
  197.210.217.66
  197.210.246.30
-197.210.255.114
  197.210.71.49
  197.211.1.234
  197.211.209.236
@@ -82636,17 +77651,20 @@
  197.211.57.62
  197.211.62.202
  197.214.114.90
+197.214.32.90
  197.219.200.20
  197.220.163.230
  197.220.169.143
  197.220.68.74
  197.221.132.2
  197.221.158.186
+197.221.226.178
  197.221.254.237
  197.221.28.59
  197.221.90.54
  197.230.17.94
  197.230.26.130
+197.230.63.190
  197.231.186.148
  197.231.198.172
  197.231.202.106
@@ -82663,25 +77681,26 @@
  197.232.76.135
  197.232.88.167
  197.232.98.232
+197.233.75.245
  197.234.13.12
  197.234.13.16
  197.234.13.18
+197.234.13.2
  197.234.13.20
  197.234.13.24
+197.234.13.27
  197.234.13.28
-197.234.13.3
  197.234.13.30
  197.234.13.32
-197.234.13.35
-197.234.13.36
+197.234.13.4
  197.234.13.40
-197.234.13.42
  197.234.13.45
  197.234.13.46
  197.234.13.49
  197.234.13.51
  197.234.13.52
  197.234.13.56
+197.234.13.60
  197.234.13.64
  197.234.13.66
  197.234.13.69
@@ -82692,31 +77711,27 @@
  197.234.13.78
  197.234.13.8
  197.234.13.81
-197.234.13.82
  197.234.13.84
  197.234.13.88
+197.234.13.92
+197.234.13.94
  197.234.13.96
  197.234.179.102
-197.234.193.46
-197.234.219.30
  197.234.221.150
-197.234.221.161
-197.234.221.87
+197.234.221.195
  197.234.35.82
  197.234.48.242
  197.234.83.186
  197.235.10.121
-197.237.137.196
-197.237.137.20
-197.237.174.104
+197.237.151.65
+197.237.161.55
  197.237.174.214
-197.237.246.186
+197.237.243.68
+197.237.246.172
  197.237.246.42
  197.237.90.67
  197.240.209.56
  197.240.76.29
-197.242.114.124
-197.242.114.79
  197.242.145.163
  197.242.147.47
  197.242.148.218
@@ -82729,29 +77744,29 @@
  197.243.19.199
  197.243.20.92
  197.243.22.27
+197.243.232.221
  197.243.48.18
+197.245.190.234
  197.245.230.122
  197.245.29.52
  197.245.94.184
-197.248.0.222
  197.248.114.226
  197.248.136.250
  197.248.16.118
  197.248.190.170
  197.248.2.229
-197.248.204.143
  197.248.230.67
  197.248.231.230
-197.248.24.69
+197.248.38.126
  197.249.11.20
  197.249.20.247
  197.250.8.162
  197.251.184.233
  197.251.224.215
  197.251.25.200
-197.253.124.133
  197.253.124.204
-197.253.230.64
+197.253.147.70
+197.253.208.197
  197.253.9.50
  197.254.115.162
  197.254.118.122
@@ -82765,7 +77780,6 @@
  197.254.7.86
  197.254.84.170
  197.255.0.98
-197.255.160.225
  197.255.160.226
  197.255.162.162
  197.255.176.29
@@ -82773,7 +77787,6 @@
  197.255.253.210
  197.255.255.101
  197.255.255.113
-197.27.17.85
  197.3.158.39
  197.3.210.213
  197.3.7.102
@@ -82790,13 +77803,14 @@
  197.39.43.222
  197.40.158.14
  197.40.196.212
+197.42.173.64
  197.43.138.183
  197.44.120.167
-197.44.124.205
  197.44.135.142
  197.44.14.250
  197.44.146.27
  197.44.153.250
+197.44.162.211
  197.44.164.51
  197.44.165.139
  197.44.170.243
@@ -82830,7 +77844,6 @@
  197.5.145.88
  197.5.145.93
  197.50.114.6
-197.50.15.245
  197.50.17.54
  197.50.176.238
  197.50.179.254
@@ -82855,7 +77868,6 @@
  197.51.23.157
  197.51.236.161
  197.51.236.207
-197.51.239.102
  197.51.243.118
  197.51.28.173
  197.51.38.82
@@ -82864,19 +77876,21 @@
  197.53.218.213
  197.59.77.120
  197.61.160.124
+197.61.174.250
  197.61.85.63
  197.62.111.87
  197.62.119.112
  197.83.226.80
  197.85.185.156
+197.86.217.241
+197.87.143.173
  197.87.178.11
  197.88.32.60
  197.89.103.103
  197.89.145.60
-197.89.51.7
-197.89.57.4
+197.89.51.207
  197.89.61.253
-197.89.70.26
+197.89.70.80
  197.89.73.15
  197.89.73.204
  197.89.73.80
@@ -82886,6 +77900,7 @@
  197.94.221.17
  197.95.143.44
  197.95.149.190
+197.97.240.89
  197.98.180.170
  197.98.180.70
  19725.psdzy.com
@@ -82902,14 +77917,11 @@
  198.100.146.132
  198.100.146.191
  198.100.146.22
-198.100.146.65
  198.100.146.67
  198.100.146.76
  198.100.147.36
  198.100.148.81
-198.100.148.99
  198.100.149.153
-198.100.155.215
  198.100.155.37
  198.100.157.197
  198.100.158.202
@@ -82917,8 +77929,7 @@
  198.100.159.86
  198.106.189.76
  198.11.177.170
-198.12.101.168
-198.12.108.114
+198.12.108.115
  198.12.110.89
  198.12.116.232
  198.12.121.184
@@ -82926,16 +77937,15 @@
  198.12.123.145
  198.12.123.154
  198.12.125.228
-198.12.125.245
  198.12.154.178
  198.12.157.28
-198.12.229.101
  198.12.248.100
  198.12.249.249
  198.12.250.116
  198.12.253.103
+198.12.254.161
  198.12.39.75
-198.12.64.120
+198.12.64.113
  198.12.66.106
  198.12.66.107
  198.12.66.108
@@ -82943,13 +77953,10 @@
  198.12.66.110
  198.12.68.57
  198.12.80.132
-198.12.80.147
  198.12.80.148
  198.12.80.155
  198.12.80.157
-198.12.80.164
  198.12.80.175
-198.12.80.190
  198.12.83.181
  198.12.83.225
  198.12.84.221
@@ -82995,14 +78002,13 @@
  198.144.120.30
  198.144.121.93
  198.144.145.16
+198.144.149.100
  198.144.149.253
  198.144.149.254
-198.144.154.163
  198.144.158.120
  198.144.176.137
  198.144.176.147
  198.144.176.85
-198.144.181.243
  198.144.190.101
  198.144.190.116
  198.144.190.164
@@ -83020,31 +78026,27 @@
  198.154.113.151
  198.154.60.143
  198.154.63.131
-198.154.82.181
-198.154.85.215
  198.154.85.251
  198.154.92.252
-198.154.99.175
  198.16.58.241
  198.16.59.186
  198.166.243.209
+198.166.43.68
  198.167.136.150
  198.167.138.147
  198.167.140.237
  198.17.119.229
  198.175.126.119
  198.178.120.5
-198.181.38.53
  198.181.43.204
-198.181.45.215
  198.187.28.137
  198.187.28.79
  198.187.30.116
-198.187.30.57
  198.187.31.67
  198.188.60.247
  198.188.61.254
  198.199.100.215
+198.199.103.145
  198.199.105.147
  198.199.105.174
  198.199.106.251
@@ -83061,12 +78063,9 @@
  198.199.117.246
  198.199.119.104
  198.199.120.16
-198.199.121.195
  198.199.122.245
-198.199.122.40
  198.199.122.67
  198.199.123.206
-198.199.124.109
  198.199.125.32
  198.199.125.87
  198.199.126.199
@@ -83092,12 +78091,9 @@
  198.199.80.244
  198.199.81.146
  198.199.81.198
-198.199.81.65
  198.199.82.190
-198.199.83.174
  198.199.83.58
  198.199.85.178
-198.199.88.23
  198.199.88.9
  198.199.89.152
  198.199.89.155
@@ -83135,13 +78131,13 @@
  198.20.164.43
  198.20.168.242
  198.20.168.88
-198.20.168.95
-198.20.172.65
+198.20.174.131
  198.20.174.164
  198.20.174.173
+198.20.174.91
  198.20.175.146
  198.20.176.190
-198.20.176.231
+198.20.180.153
  198.20.231.157
  198.20.235.1
  198.20.70.114
@@ -83183,9 +78179,7 @@
  198.211.105.59
  198.211.107.194
  198.211.107.224
-198.211.109.72
  198.211.110.116
-198.211.110.218
  198.211.110.89
  198.211.112.235
  198.211.113.207
@@ -83196,19 +78190,15 @@
  198.211.116.135
  198.211.116.68
  198.211.116.75
-198.211.116.79
-198.211.117.96
  198.211.120.41
  198.211.120.8
  198.211.120.93
-198.211.120.99
  198.211.121.126
  198.211.122.221
  198.211.123.28
  198.211.125.152
  198.211.125.219
  198.211.125.92
-198.211.126.138
  198.211.127.119
  198.211.15.61
  198.211.33.205
@@ -83216,7 +78206,6 @@
  198.211.49.176
  198.211.60.243
  198.211.98.165
-198.211.98.90
  198.211.99.153
  198.211.99.227
  198.211.99.79
@@ -83229,16 +78218,16 @@
  198.23.145.200
  198.23.145.82
  198.23.148.137
-198.23.149.123
+198.23.149.110
  198.23.154.185
  198.23.172.149
  198.23.172.169
  198.23.172.170
  198.23.172.190
+198.23.172.248
  198.23.173.157
  198.23.173.250
  198.23.174.135
-198.23.174.137
  198.23.174.151
  198.23.174.152
  198.23.174.185
@@ -83251,7 +78240,7 @@
  198.23.197.23
  198.23.200.241
  198.23.201.187
-198.23.206.134
+198.23.206.131
  198.23.206.135
  198.23.209.207
  198.23.212.121
@@ -83261,7 +78250,6 @@
  198.23.217.205
  198.23.217.64
  198.23.217.84
-198.23.217.91
  198.23.221.151
  198.23.226.150
  198.23.226.254
@@ -83273,26 +78261,18 @@
  198.23.239.144
  198.23.242.210
  198.23.247.188
-198.23.251.238
  198.23.57.226
-198.23.58.158
-198.23.59.188
-198.23.59.208
  198.23.60.180
-198.23.62.123
  198.23.71.113
  198.23.71.118
  198.24.131.83
  198.24.149.162
-198.24.243.196
  198.240.212.205
  198.245.49.14
  198.245.49.186
  198.245.49.215
  198.245.49.22
-198.245.49.37
  198.245.50.81
-198.245.51.185
  198.245.51.20
  198.245.53.163
  198.245.53.244
@@ -83301,16 +78281,13 @@
  198.245.61.119
  198.245.62.147
  198.245.62.228
-198.245.67.155
  198.245.67.49
  198.245.68.121
  198.245.72.143
-198.245.72.28
  198.245.75.75
  198.245.75.77
  198.245.76.247
  198.251.117.82
-198.251.68.96
  198.251.80.252
  198.251.82.109
  198.251.83.193
@@ -83327,11 +78304,9 @@
  198.27.107.128
  198.27.108.198
  198.27.108.202
-198.27.122.201
  198.27.123.127
  198.27.180.209
  198.27.64.100
-198.27.64.212
  198.27.66.144
  198.27.66.37
  198.27.67.87
@@ -83342,24 +78317,21 @@
  198.27.79.180
  198.27.80.123
  198.27.80.144
+198.27.80.148
  198.27.81.24
  198.27.81.30
  198.27.81.94
  198.27.82.155
  198.27.82.181
-198.27.82.21
  198.27.83.13
  198.27.83.210
  198.27.83.216
-198.27.87.203
  198.27.89.7
  198.27.90.106
  198.27.99.30
  198.35.47.13
-198.37.146.176
  198.38.82.127
  198.38.85.88
-198.38.86.161
  198.38.92.65
  198.38.94.199
  198.40.56.50
@@ -83375,18 +78347,15 @@
  198.46.138.98
  198.46.140.184
  198.46.149.165
-198.46.152.196
  198.46.158.43
  198.46.159.248
  198.46.166.35
  198.46.168.25
  198.46.173.12
+198.46.173.13
  198.46.178.107
  198.46.178.119
  198.46.178.88
-198.46.188.145
-198.46.189.106
-198.46.192.61
  198.46.194.140
  198.46.198.115
  198.46.199.105
@@ -83404,15 +78373,13 @@
  198.46.222.215
  198.46.222.235
  198.46.222.29
-198.46.223.105
  198.46.223.119
  198.46.223.23
-198.46.226.115
-198.46.227.134
+198.46.226.121
+198.46.226.91
+198.46.226.98
  198.46.232.249
-198.46.233.148
  198.46.240.154
-198.46.242.223
  198.46.249.206
  198.46.81.12
  198.46.81.154
@@ -83428,7 +78395,6 @@
  198.49.73.50
  198.50.128.237
  198.50.132.54
-198.50.136.143
  198.50.145.28
  198.50.150.245
  198.50.152.30
@@ -83443,7 +78409,6 @@
  198.50.17.68
  198.50.176.147
  198.50.176.72
-198.50.177.42
  198.50.177.44
  198.50.179.97
  198.50.180.172
@@ -83469,6 +78434,7 @@
  198.50.234.111
  198.50.240.58
  198.50.251.198
+198.50.252.26
  198.50.252.31
  198.52.100.36
  198.52.119.103
@@ -83486,14 +78452,12 @@
  198.54.128.108
  198.54.128.76
  198.54.128.78
-198.55.103.107
  198.55.107.164
  198.55.109.115
  198.55.109.130
  198.55.109.72
  198.55.109.96
  198.57.168.206
-198.57.179.233
  198.57.182.165
  198.57.203.63
  198.57.209.229
@@ -83502,7 +78466,6 @@
  198.57.56.46
  198.58.10.150
  198.58.10.247
-198.58.10.31
  198.58.102.43
  198.58.107.53
  198.58.11.148
@@ -83518,7 +78481,6 @@
  198.58.96.240
  198.58.98.67
  198.61.227.6
-198.7.62.204
  198.7.62.217
  198.71.224.92
  198.71.225.141
@@ -83556,10 +78518,8 @@
  198.71.240.42
  198.71.241.14
  198.71.241.40
-198.71.49.8
  198.71.56.205
  198.71.58.92
-198.71.61.38
  198.71.63.95
  198.74.121.153
  198.74.125.219
@@ -83575,22 +78535,18 @@
  198.8.94.170
  198.8.94.174
  198.84.147.50
-198.84.205.100
  198.89.97.193
  198.89.97.196
  198.91.178.108
  198.91.188.76
-198.91.198.181
-198.91.199.202
-198.91.86.83
  198.96.155.3
  198.96.95.65
+198.98.183.38
  198.98.48.7
  198.98.49.153
  198.98.49.180
  198.98.49.198
  198.98.50.112
-198.98.51.109
  198.98.51.196
  198.98.51.197
  198.98.51.240
@@ -83605,7 +78561,6 @@
  198.98.54.14
  198.98.54.170
  198.98.54.241
-198.98.54.28
  198.98.54.48
  198.98.55.164
  198.98.55.168
@@ -83635,8 +78590,6 @@
  198.98.61.236
  198.98.61.32
  198.98.61.36
-198.98.61.68
-198.98.62.142
  198.98.62.35
  1984-medicinal.com
  19840209.com
@@ -83648,8 +78601,6 @@
  199.115.101.178
  199.115.117.118
  199.115.117.70
-199.115.161.180
-199.115.195.41
  199.115.195.98
  199.115.202.1
  199.115.203.1
@@ -83657,9 +78608,11 @@
  199.115.228.202
  199.116.113.206
  199.116.118.133
+199.116.118.139
+199.116.118.140
+199.116.118.145
  199.116.118.148
  199.116.118.166
-199.116.118.169
  199.119.139.4
  199.119.74.245
  199.126.168.230
@@ -83678,8 +78631,10 @@
  199.15.250.210
  199.16.223.153
  199.16.223.156
+199.16.243.144
  199.16.243.235
  199.16.243.38
+199.16.243.93
  199.167.138.22
  199.168.100.74
  199.168.102.13
@@ -83687,7 +78642,6 @@
  199.168.143.102
  199.168.143.58
  199.168.99.114
-199.172.255.185
  199.175.49.21
  199.180.115.46
  199.180.115.7
@@ -83712,7 +78666,6 @@
  199.187.28.54
  199.187.28.58
  199.187.29.1
-199.188.200.178
  199.188.204.174
  199.188.204.25
  199.188.204.4
@@ -83726,6 +78679,7 @@
  199.188.93.252
  199.19.104.10
  199.19.104.163
+199.19.106.77
  199.19.213.228
  199.19.224.236
  199.19.224.46
@@ -83739,7 +78693,6 @@
  199.19.226.253
  199.19.226.83
  199.192.156.212
-199.192.156.86
  199.192.161.145
  199.192.18.162
  199.192.20.201
@@ -83781,7 +78734,6 @@
  199.204.249.212
  199.204.45.193
  199.204.45.6
-199.21.113.251
  199.21.199.158
  199.21.220.69
  199.21.66.105
@@ -83801,18 +78753,15 @@
  199.217.117.211
  199.217.119.221
  199.223.236.90
-199.227.138.238
  199.229.221.65
  199.229.238.69
  199.229.250.50
  199.229.250.94
+199.230.124.28
  199.231.166.210
-199.231.185.120
-199.231.188.213
  199.231.189.251
  199.231.189.99
  199.231.233.20
-199.231.233.23
  199.231.240.25
  199.231.85.194
  199.233.237.42
@@ -83945,7 +78894,6 @@
  199.30.185.127
  199.33.123.170
  199.34.16.230
-199.34.241.56
  199.34.78.183
  199.34.78.210
  199.38.243.111
@@ -83953,7 +78901,6 @@
  199.47.55.213
  199.48.147.141
  199.48.92.184
-199.5.189.62
  199.58.86.206
  199.58.86.209
  199.58.86.211
@@ -83963,6 +78910,7 @@
  199.76.38.123
  199.79.62.115
  199.79.62.144
+199.79.63.167
  199.83.200.208
  199.83.202.240
  199.83.203.104
@@ -84029,6 +78977,7 @@
  1amazon3.top
  1amazoncustomer.x24hr.com
  1anewsnet.shaxiaasian.top
+1apotheke.xyz
  1arab.net
  1artemisbet.blogspot.com
  1b14cfad-0956-4209-a1fa-5667e582d652.htmlcomponentservice.com
@@ -84059,6 +79008,7 @@
  1claimdiamond.000webhostapp.com
  1clbc-set1acc.com
  1clogin9capital.one
+1clogin9capitalone.com
  1cov-19aid.com
  1covid9-cerb.com
  1cr-cerbrelief.org
@@ -84141,6 +79091,7 @@
  1obuortfa1o.bankofamericaslpemr.com
  1oginmanagesecure1nc.com
  1oneand1one.jetestjerecomande.net
+1onlinemall.com
  1pbuofa1p.bankofamericaslpemr.com
  1pbuortfa1p.bankofamericaslpemr.com
  1pisoflight.com
@@ -84213,8 +79164,6 @@
  2.101.177.182
  2.104.14.161
  2.112.240.141
-2.114.202.124
-2.119.3.137
  2.123.156.227
  2.132.102.224
  2.132.172.133
@@ -84226,10 +79175,10 @@
  2.132.241.171
  2.132.249.34
  2.132.28.142
-2.132.79.63
  2.132.91.60
  2.132.94.157
  2.133.11.221
+2.133.183.224
  2.133.248.129
  2.133.33.153
  2.133.42.218
@@ -84246,7 +79195,6 @@
  2.136.127.178
  2.136.179.77
  2.136.182.204
-2.136.198.12
  2.136.236.100
  2.136.78.138
  2.136.93.27
@@ -84264,7 +79212,6 @@
  2.139.14.78
  2.139.155.90
  2.139.162.80
-2.139.174.205
  2.139.189.242
  2.139.237.110
  2.139.252.47
@@ -84272,24 +79219,23 @@
  2.144.242.146
  2.144.242.210
  2.144.243.102
-2.15.197.164
  2.152.45.133
  2.176.26.211
  2.178.255.157
  2.178.55.112
  2.179.64.63
  2.180.11.55
+2.180.27.11
  2.180.3.39
  2.180.31.88
-2.181.0.158
+2.181.100.9
  2.181.179.55
-2.181.229.44
  2.181.233.207
+2.181.250.96
  2.182.112.250
  2.182.97.65
  2.182.99.72
  2.184.4.3
-2.184.52.194
  2.184.52.204
  2.185.144.60
  2.185.149.129
@@ -84297,11 +79243,11 @@
  2.187.100.151
  2.187.18.70
  2.187.19.248
-2.187.233.241
+2.187.222.16
  2.187.251.247
  2.190.160.225
  2.190.38.10
-2.192.198.0
+2.190.87.162
  2.192.225.155
  2.192.98.207
  2.193.18.122
@@ -84314,6 +79260,7 @@
  2.194.19.114
  2.194.27.149
  2.194.28.240
+2.194.33.250
  2.194.37.160
  2.194.50.192
  2.194.50.208
@@ -84328,22 +79275,20 @@
  2.195.228.107
  2.195.234.4
  2.196.0.210
-2.201.149.16
-2.201.149.48
  2.201.16.4
  2.203.118.180
+2.203.180.79
  2.205.157.66
-2.205.82.227
+2.205.23.88
+2.205.85.177
  2.217.44.77
  2.217.45.18
  2.218.193.131
  2.223.175.7
-2.224.168.43
  2.225.249.9
  2.226.135.239
  2.226.156.242
  2.226.179.79
-2.227.254.144
  2.228.87.194
  2.228.87.82
  2.229.123.30
@@ -84351,13 +79296,11 @@
  2.229.19.58
  2.229.239.77
  2.229.249.153
-2.229.4.181
  2.229.41.205
  2.229.89.119
  2.229.92.42
  2.230.178.184
  2.230.19.211
-2.231.22.220
  2.232.248.6
  2.232.248.99
  2.232.250.91
@@ -84373,11 +79316,10 @@
  2.235.239.186
  2.235.38.149
  2.236.105.150
+2.236.106.73
  2.236.140.22
-2.236.188.179
  2.236.242.77
  2.236.251.49
-2.237.116.238
  2.237.19.137
  2.237.29.22
  2.237.76.249
@@ -84388,37 +79330,32 @@
  2.238.18.160
  2.238.77.60
  2.24.199.59
-2.243.118.246
+2.244.179.12
  2.247.250.1
-2.247.250.106
+2.247.250.190
  2.247.250.39
  2.249.168.27
  2.249.177.101
  2.25.62.239
  2.26.232.27
  2.28.108.207
+2.28.112.49
  2.29.59.251
  2.30.17.61
  2.31.165.149
  2.32.23.239
  2.32.31.178
-2.32.82.50
  2.34.1.72
  2.35.150.233
-2.35.184.83
-2.35.192.209
  2.35.2.40
  2.35.240.145
  2.35.28.35
-2.36.136.146
  2.36.241.92
  2.36.64.136
  2.37.111.40
  2.37.252.107
-2.37.61.226
  2.38.152.84
  2.38.174.67
-2.38.181.39
  2.38.2.58
  2.38.99.79
  2.39.173.126
@@ -84427,29 +79364,28 @@
  2.42.168.69
  2.42.173.240
  2.42.196.30
-2.43.13.230
  2.44.166.148
  2.44.189.221
  2.45.100.120
  2.45.100.251
  2.45.105.247
  2.45.179.5
+2.45.185.2
  2.45.203.238
  2.45.4.24
  2.47.108.232
-2.47.108.34
  2.47.117.96
  2.47.127.229
  2.47.198.217
  2.47.3.119
  2.47.3.45
  2.47.8.126
-2.48.3.18
  2.4buyuklergazete.com
  2.50.128.50
  2.50.14.248
  2.50.145.116
  2.50.145.167
+2.50.147.242
  2.50.152.172
  2.50.159.186
  2.50.170.143
@@ -84459,7 +79395,6 @@
  2.50.42.28
  2.50.52.187
  2.50.56.10
-2.50.73.80
  2.50.8.199
  2.51.172.174
  2.51.26.64
@@ -84471,12 +79406,10 @@
  2.55.90.80
  2.55.92.184
  2.56.101.149
-2.56.116.18
  2.56.121.154
  2.56.168.201
  2.56.168.213
  2.56.176.10
-2.56.242.171
  2.56.254.22
  2.56.8.123
  2.56.8.13
@@ -84517,31 +79450,39 @@
  2.57.204.59
  2.57.207.136
  2.57.207.43
-2.57.87.220
  2.57.91.98
-2.58.12.122
+2.58.12.115
+2.58.12.127
+2.58.12.158
  2.58.12.188
  2.58.12.194
+2.58.12.200
+2.58.12.235
  2.58.12.242
+2.58.12.247
+2.58.12.26
  2.58.12.31
+2.58.12.37
+2.58.12.49
+2.58.12.68
+2.58.12.97
+2.58.13.9
  2.58.136.143
  2.58.16.86
  2.58.16.89
  2.58.228.117
  2.58.230.234
-2.59.115.185
  2.59.117.190
  2.59.117.65
  2.59.119.37
  2.59.119.42
-2.59.119.43
+2.59.21.247
  2.59.235.224
  2.6.185.246
+2.61.101.58
  2.64.252.95
  2.7.197.27
  2.7.248.51
-2.8.3.21
-2.80.168.28
  2.80.19.193
  2.81.147.94
  2.81.219.150
@@ -84551,6 +79492,8 @@
  2.82.78.4
  2.82.84.167
  2.82.90.211
+2.83.152.16
+2.83.17.157
  2.83.21.114
  2.83.222.129
  2.84.12.98
@@ -84561,6 +79504,7 @@
  2.85.135.133
  2.85.37.102
  2.85.7.130
+2.85.83.224
  2.86.136.140
  2.86.161.32
  2.86.163.168
@@ -84569,21 +79513,24 @@
  2.87.156.101
  2.87.178.10
  2.87.225.195
+2.87.23.7
+2.87.238.75
+2.87.83.249
  2.88.105.174
  2.88.118.68
  2.88.54.14
  2.88.67.92
  2.88.97.94
-2.89.18.250
-2.89.224.108
  2.89.227.137
  2.89.31.178
+2.89.37.0
  2.89.41.93
  2.89.82.192
  2.90.126.153
+2.91.123.236
  2.91.13.189
  2.92.39.39
-2.92.51.124
+2.93.22.224
  2.93.92.197
  2.95.129.33
  2.96.36.182
@@ -84603,11 +79550,8 @@
  20.184.15.116
  20.185.224.77
  20.185.225.23
-20.185.231.189
  20.185.247.149
  20.185.39.51
-20.185.47.152
-20.185.64.192
  20.185.66.89
  20.185.90.51
  20.186.110.157
@@ -84617,7 +79561,7 @@
  20.187.38.67
  20.188.107.54
  20.188.108.164
-20.188.111.183
+20.188.250.110
  20.188.56.110
  20.188.60.188
  20.188.61.54
@@ -84641,31 +79585,28 @@
  20.39.42.134
  20.39.49.74
  20.39.53.23
-20.40.0.152
  20.40.146.61
  20.42.108.200
  20.43.32.121
  20.43.33.55
  20.43.35.45
+20.43.39.228
  20.43.39.32
-20.43.56.138
  20.43.59.45
  20.43.60.99
  20.46.114.59
  20.46.224.110
  20.46.41.35
-20.48.147.123
  20.49.178.149
  20.49.178.57
  20.49.186.22
-20.49.197.78
  20.49.207.213
+20.49.57.120
  20.4buyuklergazete.com
  20.50.114.95
  20.51.120.172
+20.51.120.61
  20.51.211.19
-20.51.214.254
-20.51.221.172
  20.52.137.129
  20.52.145.235
  20.52.153.108
@@ -84673,35 +79614,31 @@
  20.52.42.61
  20.52.51.81
  20.52.53.112
+20.52.54.88
  20.52.56.44
  20.52.57.16
-20.54.100.179
-20.54.100.180
-20.54.100.184
-20.54.100.187
-20.54.100.188
-20.54.100.190
  20.55.101.47
  20.55.107.59
  20.55.16.175
  20.55.203.249
  20.55.243.78
  20.55.26.138
+20.55.40.176
  20.55.96.58
  20.56.112.79
  20.56.14.13
-20.57.33.82
+20.57.25.74
  20.57.34.108
+20.58.0.53
  20.62.41.3
  20.62.94.40
-20.67.116.174
  20.68.160.100
+20.71.28.227
  20.71.88.210
  200-365.net
  200.0.118.29
  200.0.144.252
  200.0.226.122
-200.0.236.210
  200.0.40.166
  200.0.46.50
  200.0.48.39
@@ -84716,7 +79653,6 @@
  200.100.222.42
  200.103.112.53
  200.103.16.43
-200.105.144.202
  200.105.157.218
  200.105.174.182
  200.105.174.20
@@ -84732,6 +79668,7 @@
  200.105.74.140
  200.106.147.35
  200.106.20.247
+200.107.118.137
  200.107.12.194
  200.107.253.130
  200.107.253.138
@@ -84739,6 +79676,7 @@
  200.108.131.234
  200.108.139.242
  200.108.143.6
+200.108.183.2
  200.108.196.108
  200.108.196.110
  200.108.197.199
@@ -84748,7 +79686,6 @@
  200.109.58.183
  200.109.66.110
  200.11.136.198
-200.11.215.186
  200.11.240.237
  200.11.241.44
  200.110.176.121
@@ -84788,13 +79725,11 @@
  200.116.198.177
  200.116.206.10
  200.116.226.210
-200.116.3.133
  200.116.47.247
  200.117.137.162
  200.117.144.248
  200.117.185.116
  200.118.57.190
-200.118.57.238
  200.118.62.3
  200.119.125.194
  200.119.204.19
@@ -84802,6 +79737,7 @@
  200.119.45.66
  200.12.221.38
  200.120.85.24
+200.121.128.64
  200.121.135.49
  200.121.169.156
  200.122.128.162
@@ -84815,27 +79751,30 @@
  200.123.150.89
  200.123.2.171
  200.123.208.29
+200.123.232.122
  200.123.232.185bin.sh
  200.123.232.199
+200.123.232.204
  200.123.232.215
  200.123.232.219
  200.123.232.219bin.sh
  200.123.232.223
-200.123.232.239
-200.123.232.252
  200.123.232.255
  200.123.232.93
  200.123.232.96
  200.123.233.10
+200.123.233.10bin.sh
  200.123.233.127
+200.123.233.131
  200.123.233.141
  200.123.233.168
-200.123.233.20
+200.123.233.176
+200.123.233.21
  200.123.233.33
  200.123.233.33bin.sh
+200.123.233.37
  200.123.26.2
  200.124.243.62
-200.125.170.18
  200.125.181.94
  200.125.182.21
  200.125.182.230
@@ -84852,11 +79791,6 @@
  200.13.160.125
  200.13.253.154
  200.130.99.116
-200.132.121.1
-200.133.125.244
-200.133.133.220
-200.133.39.24
-200.133.39.71
  200.133.39.84
  200.135.228.230
  200.137.5.195
@@ -84865,14 +79799,11 @@
  200.140.127.110
  200.140.80.189
  200.141.100.54
-200.141.166.170
  200.141.248.186
  200.142.120.234
  200.142.120.90
  200.143.186.21
  200.145.250.11
-200.146.196.194
-200.146.215.26
  200.146.227.146
  200.146.229.129
  200.146.236.217
@@ -84881,13 +79812,13 @@
  200.146.46.198
  200.146.75.58
  200.147.153.131
+200.147.32.143
  200.148.232.218
  200.148.25.132
  200.148.25.60
  200.148.38.40
  200.149.1.106
  200.149.214.6
-200.149.231.50
  200.149.232.242
  200.149.244.202
  200.150.114.227
@@ -84900,12 +79831,10 @@
  200.150.82.106
  200.150.86.130
  200.150.86.138
-200.151.138.230
  200.152.101.194
  200.152.70.103
  200.152.70.192
  200.152.78.48
-200.153.167.99
  200.155.188.173
  200.155.56.170
  200.155.57.213
@@ -84915,10 +79844,8 @@
  200.159.105.20
  200.159.131.50
  200.159.161.147
-200.159.173.115
  200.159.173.153
  200.159.173.74
-200.159.173.77
  200.159.224.122
  200.159.250.2
  200.161.143.194
@@ -84932,23 +79859,17 @@
  200.167.191.101
  200.169.218.172
  200.169.3.75
-200.17.114.136
-200.17.114.215
  200.17.13.3
  200.17.172.35
-200.170.125.183
  200.170.126.105
  200.170.155.204
  200.170.182.45
  200.174.156.62
  200.174.158.26
-200.175.104.103
  200.175.172.189
-200.175.185.54
  200.175.239.226
  200.178.119.18
  200.178.251.146
-200.180.159.138
  200.181.173.134
  200.182.18.82
  200.186.127.210
@@ -84956,7 +79877,7 @@
  200.187.127.8
  200.187.164.94
  200.187.169.150
-200.188.152.7
+200.187.170.216
  200.188.154.9
  200.188.19.30
  200.188.19.31
@@ -84969,9 +79890,8 @@
  200.193.101.106
  200.193.152.216
  200.194.198.74
+200.194.23.28
  200.194.35.136
-200.194.4.24
-200.195.135.3
  200.195.136.12
  200.195.148.18
  200.195.156.242
@@ -84996,29 +79916,25 @@
  200.2.197.2
  200.20.186.254
  200.201.180.130
-200.201.199.39
-200.201.199.61
  200.201.200.52
  200.201.217.251
-200.202.235.161
  200.203.104.18
  200.203.123.32
  200.203.123.34
  200.203.125.170
  200.203.126.15
  200.204.150.216
-200.204.166.143
  200.204.174.163
  200.204.216.165
  200.205.134.107
  200.205.174.66
-200.205.188.74
  200.206.50.66
  200.206.63.34
  200.206.81.154
  200.207.169.7
  200.207.200.126
  200.208.101.228
+200.208.101.230
  200.208.228.50
  200.21.51.38
  200.212.2.125
@@ -85038,7 +79954,6 @@
  200.220.202.1
  200.220.202.41
  200.222.11.22
-200.222.137.202
  200.223.233.42
  200.223.87.11
  200.225.120.69
@@ -85051,7 +79966,6 @@
  200.228.35.10
  200.228.86.78
  200.229.147.1
-200.229.193.149
  200.229.194.158
  200.229.218.9
  200.229.227.201
@@ -85061,11 +79975,9 @@
  200.233.151.209
  200.233.163.65
  200.233.186.57
-200.233.204.70
  200.233.224.140
  200.233.248.46
  200.233.252.170
-200.233.61.185
  200.236.221.242
  200.238.102.225
  200.238.216.228
@@ -85093,7 +80005,6 @@
  200.24.84.78
  200.240.244.7
  200.240.250.92
-200.241.37.18
  200.241.39.37
  200.243.153.66
  200.248.72.99
@@ -85118,7 +80029,6 @@
  200.29.105.12
  200.29.109.112
  200.29.109.193
-200.29.111.182
  200.29.115.162
  200.29.132.211
  200.29.139.11
@@ -85129,7 +80039,6 @@
  200.29.254.1
  200.29.90.110
  200.3.172.76
-200.3.208.107
  200.3.252.242
  200.30.245.24
  200.30.73.141
@@ -85144,7 +80053,6 @@
  200.34.165.78
  200.34.227.204
  200.35.145.133
-200.35.2.171
  200.35.43.57
  200.35.49.50
  200.35.49.57
@@ -85152,10 +80060,10 @@
  200.35.56.161
  200.35.56.81
  200.35.92.188
+200.35.93.181
  200.35.97.136
  200.37.108.195
  200.37.176.156
-200.37.197.132
  200.37.200.178
  200.37.202.19
  200.37.251.195
@@ -85163,18 +80071,15 @@
  200.38.79.134
  200.39.241.64
  200.40.42.54
-200.40.45.82
  200.40.86.142
  200.41.121.69
-200.41.168.237
  200.41.182.243
-200.41.199.250
-200.41.231.4
+200.41.186.100
  200.41.86.59
  200.42.153.216
  200.42.174.109
  200.42.61.141
-200.43.231.1
+200.43.113.2
  200.44.158.226
  200.44.50.155
  200.44.79.120
@@ -85186,7 +80091,6 @@
  200.46.235.146
  200.46.45.114
  200.48.108.211
-200.48.123.101
  200.48.129.124
  200.48.210.5
  200.48.37.66
@@ -85196,8 +80100,7 @@
  200.5.251.5
  200.5.251.6
  200.5.32.217
-200.5.74.90
-200.50.67.105
+200.51.40.219
  200.51.94.251
  200.52.140.145
  200.52.140.148
@@ -85216,7 +80119,6 @@
  200.54.183.234
  200.54.218.188
  200.54.221.202
-200.54.242.46
  200.54.247.98
  200.54.51.124
  200.54.56.107
@@ -85227,20 +80129,16 @@
  200.54.78.178
  200.54.78.218
  200.55.140.181
-200.55.196.142
  200.55.208.196
  200.55.243.138
  200.56.17.5
-200.56.43.65
  200.56.60.157
  200.56.96.167
  200.57.102.71
  200.57.199.51
-200.57.230.67
  200.57.8.74
  200.58.160.242
  200.58.171.51
-200.58.179.160
  200.58.77.48
  200.58.77.62
  200.58.79.183
@@ -85250,7 +80148,6 @@
  200.59.6.174
  200.59.82.251
  200.6.122.228
-200.6.136.235
  200.6.167.101
  200.6.168.68
  200.6.168.70
@@ -85283,15 +80180,12 @@
  200.66.112.9
  200.66.114.96
  200.66.116.135
-200.66.116.227
  200.66.117.93
  200.66.118.224
  200.66.72.243
  200.66.74.167
  200.66.77.178
-200.66.82.250
  200.68.13.26
-200.68.138.20
  200.68.2.10
  200.68.230.193
  200.68.230.197
@@ -85307,11 +80201,10 @@
  200.69.102.223
  200.69.141.210
  200.69.224.73
-200.69.234.168
-200.69.236.165
  200.69.236.172
  200.69.39.6
  200.69.62.70
+200.69.77.12
  200.69.81.10
  200.69.81.198
  200.69.83.54
@@ -85319,6 +80212,8 @@
  200.7.102.76
  200.7.114.115
  200.7.118.10
+200.7.120.212
+200.7.122.41
  200.7.149.112
  200.7.197.65
  200.7.198.66
@@ -85329,6 +80224,7 @@
  200.70.56.204
  200.71.120.82
  200.71.122.54
+200.71.186.58
  200.71.237.250
  200.71.72.14
  200.71.72.194
@@ -85365,26 +80261,23 @@
  200.73.129.6
  200.73.130.156
  200.73.130.160
-200.73.130.179
  200.73.130.241
+200.73.130.38
+200.73.130.62
  200.73.131.100
  200.73.131.156
  200.73.131.186
  200.73.131.239
-200.73.131.7
  200.73.131.94
  200.73.132.115
  200.73.132.67
-200.73.240.238
  200.73.35.195
  200.74.243.12
  200.74.89.85
-200.75.10.86
  200.75.104.206
  200.75.133.60
  200.75.18.139
  200.75.233.144
-200.75.241.206
  200.75.248.134
  200.75.249.38
  200.75.45.67
@@ -85393,14 +80286,15 @@
  200.77.160.107
  200.77.186.161
  200.77.186.170
-200.77.186.174
  200.77.186.177
  200.77.186.181
  200.77.186.182
  200.77.186.195
  200.77.186.198
+200.77.186.199
  200.77.186.205
  200.77.186.206
+200.77.186.207
  200.77.186.208
  200.77.186.209
  200.77.186.211
@@ -85427,11 +80321,10 @@
  200.82.170.231
  200.83.133.77
  200.83.166.136
-200.83.178.229
  200.83.202.237
-200.83.231.100
  200.83.70.102
  200.84.52.116
+200.84.9.201
  200.84.94.120
  200.85.137.36
  200.85.137.38
@@ -85443,7 +80336,6 @@
  200.85.169.18
  200.85.95.234
  200.86.52.5
-200.87.112.54
  200.87.116.14
  200.87.116.213
  200.87.178.137
@@ -85452,10 +80344,9 @@
  200.87.239.22
  200.87.28.114
  200.87.43.178
+200.87.92.245
  200.88.120.107
-200.88.161.8
  200.88.48.99
-200.88.52.122
  200.89.114.58
  200.89.125.254
  200.89.125.94
@@ -85463,7 +80354,6 @@
  200.89.159.178
  200.89.159.190
  200.89.159.240
-200.89.159.52
  200.89.174.105
  200.89.174.209
  200.89.174.243
@@ -85474,11 +80364,7 @@
  200.89.178.208
  200.89.178.212
  200.89.178.217
-200.89.178.253
-200.89.178.79
-200.89.79.133
  200.89.99.226
-200.9.154.228
  200.9.154.55
  200.9.155.53
  200.90.147.117
@@ -85492,7 +80378,6 @@
  200.93.148.14
  200.93.162.51
  200.93.248.10
-200.93.30.42
  200.93.44.14
  200.94.140.50
  200.95.184.2
@@ -85519,20 +80404,17 @@
  2009-ford-f150.xyz
  2009941992.z13.web.core.windows.net
  2009sanchezsupplicate.com
-201.0.25.235
-201.1.126.173
  201.1.66.66
-201.10.98.229
  201.102.56.105
  201.102.89.43
  201.103.107.139
  201.103.50.210
  201.103.74.18
  201.103.85.230
-201.103.88.173
  201.105.90.168
  201.106.32.171
  201.106.52.125
+201.106.68.179
  201.106.95.131
  201.108.118.5
  201.108.2.179
@@ -85544,7 +80426,6 @@
  201.110.34.191
  201.110.49.42
  201.111.15.213
-201.114.239.184
  201.116.101.130
  201.116.184.243
  201.116.194.210
@@ -85555,7 +80436,6 @@
  201.117.138.69
  201.122.102.21
  201.122.180.91
-201.122.212.15
  201.123.134.168
  201.123.180.9
  201.123.35.234
@@ -85572,8 +80452,6 @@
  201.131.244.44
  201.131.32.4
  201.131.38.208
-201.132.119.2
-201.132.213.4
  201.134.205.138
  201.137.119.75
  201.137.142.196
@@ -85583,26 +80461,24 @@
  201.137.183.188
  201.137.25.157
  201.137.49.221
-201.138.157.220
  201.138.160.52
-201.138.217.25
  201.138.34.175
  201.138.36.52
-201.138.43.41
  201.138.62.49
+201.139.187.193
  201.139.75.6
-201.139.88.230
  201.139.88.58
-201.139.89.111
  201.139.90.42
  201.140.103.33
  201.140.105.182
  201.140.108.146
  201.140.110.78
+201.140.145.26
  201.140.166.165
  201.140.176.114
  201.140.209.18
  201.140.211.137
+201.140.244.70
  201.140.245.152
  201.141.53.87
  201.142.182.168
@@ -85618,20 +80494,19 @@
  201.144.234.22
  201.144.235.120
  201.144.235.49
-201.144.235.61
  201.144.48.73
+201.145.104.138
  201.145.105.106
  201.145.138.159
  201.145.144.192
  201.145.169.101
  201.145.171.86
-201.145.201.161
  201.145.230.57
-201.145.99.23
  201.147.144.89
  201.148.126.38
  201.148.157.226
-201.148.246.249
+201.148.246.109
+201.148.247.203
  201.148.252.22
  201.148.71.65
  201.149.119.133
@@ -85639,7 +80514,6 @@
  201.149.20.161
  201.149.21.180
  201.149.26.51
-201.149.3.102
  201.149.34.177
  201.149.44.237
  201.149.49.146
@@ -85649,12 +80523,10 @@
  201.149.83.179
  201.15.121.73
  201.15.76.160
-201.150.175.55
  201.150.34.28
  201.150.37.178
  201.150.52.32
  201.150.52.33
-201.151.216.252
  201.151.236.149
  201.151.40.30
  201.152.149.29
@@ -85679,11 +80551,9 @@
  201.159.95.125
  201.159.95.193
  201.159.95.94
-201.16.150.113
  201.16.228.170
  201.161.223.150
  201.161.37.93
-201.161.9.227
  201.162.105.43
  201.163.162.179
  201.163.180.183
@@ -85742,28 +80612,25 @@
  201.174.47.66
  201.174.53.130
  201.174.75.250
-201.174.9.98
  201.175.113.237
  201.175.17.129
  201.175.73.218
-201.176.30.32
  201.178.199.188
  201.178.228.120
  201.179.17.197
-201.179.219.120
  201.179.52.230
+201.179.58.218
  201.179.66.170
-201.179.69.42
  201.18.237.254
  201.18.88.150
  201.182.120.230
  201.182.180.28
-201.182.180.31
  201.182.214.183
  201.182.214.184
+201.182.214.190
  201.182.33.124
+201.182.42.101
  201.182.44.110
-201.182.72.250
  201.182.88.10
  201.182.88.13
  201.182.88.2
@@ -85781,10 +80648,7 @@
  201.184.151.58
  201.184.152.138
  201.184.162.58
-201.184.169.106
-201.184.175.210
  201.184.175.90
-201.184.183.26
  201.184.188.122
  201.184.241.243
  201.184.244.186
@@ -85807,7 +80671,6 @@
  201.192.136.240
  201.192.138.219
  201.192.141.95
-201.192.152.202
  201.192.239.118
  201.193.180.14
  201.193.60.210
@@ -85836,14 +80699,12 @@
  201.205.54.211
  201.205.54.230
  201.206.124.156
-201.206.232.54
  201.206.66.171
  201.208.142.86
  201.209.226.34
  201.21.221.80
  201.21.87.173
  201.21.87.86
-201.210.207.188
  201.210.62.200
  201.211.255.148
  201.211.31.45
@@ -85851,6 +80712,7 @@
  201.212.120.187
  201.212.129.128
  201.212.141.4
+201.212.171.36
  201.212.209.109
  201.212.216.79
  201.212.223.115
@@ -85867,10 +80729,11 @@
  201.215.1.99
  201.215.191.57
  201.215.208.78
-201.215.250.147
  201.216.110.186
  201.216.222.155
  201.217.128.154
+201.217.220.26
+201.217.237.35
  201.217.245.229
  201.217.4.101
  201.217.51.9
@@ -85878,8 +80741,8 @@
  201.217.64.18
  201.217.71.122
  201.218.120.143
+201.218.120.154
  201.218.125.150
-201.218.138.144
  201.218.202.198
  201.218.207.58
  201.218.215.106
@@ -85890,7 +80753,6 @@
  201.219.197.138
  201.219.197.50
  201.219.208.42
-201.219.213.74
  201.219.216.132
  201.219.217.70
  201.219.220.205
@@ -85901,7 +80763,6 @@
  201.22.208.69
  201.22.228.240
  201.22.229.5
-201.22.252.38
  201.22.82.202
  201.22.95.49
  201.22.95.52
@@ -85910,7 +80771,6 @@
  201.220.140.6
  201.220.146.177
  201.220.146.53
-201.220.147.203
  201.220.23.153
  201.221.105.220
  201.221.112.14
@@ -85919,8 +80779,8 @@
  201.221.206.19
  201.222.118.62
  201.222.28.113
-201.222.31.15
  201.222.48.42
+201.222.49.238
  201.222.55.238
  201.222.55.93
  201.222.57.21
@@ -85936,6 +80796,7 @@
  201.231.111.53
  201.231.47.58
  201.231.84.107
+201.231.94.130
  201.232.54.48
  201.234.119.228
  201.234.119.98
@@ -85963,13 +80824,14 @@
  201.238.235.11
  201.238.239.51
  201.239.137.220
-201.24.139.87
  201.24.199.23
  201.240.213.183
  201.241.127.190
+201.242.217.129
  201.242.89.88
  201.243.65.148
  201.243.65.150
+201.243.66.155
  201.244.0.47
  201.244.0.78
  201.244.117.218
@@ -85992,14 +80854,15 @@
  201.249.61.60
  201.249.75.13
  201.249.88.38
+201.250.43.116
  201.251.100.133
  201.251.63.208
  201.252.85.48
  201.254.163.16
+201.255.11.214
  201.26.174.39
  201.26.179.96
  201.27.107.115
-201.27.231.79
  201.27.27.225
  201.27.31.184
  201.27.37.224
@@ -86021,7 +80884,6 @@
  201.35.67.18
  201.36.173.93
  201.4.206.200
-201.40.244.146
  201.40.41.12
  201.41.73.136
  201.41.81.130
@@ -86033,10 +80895,8 @@
  201.46.28.100
  201.46.28.222
  201.46.29.184
-201.46.31.239
  201.46.65.125
  201.47.227.125
-201.48.115.235
  201.48.182.242
  201.48.184.157
  201.48.192.60
@@ -86050,23 +80910,15 @@
  201.49.115.117
  201.49.239.200
  201.49.82.234
-201.49.86.136
  201.49.86.224
  201.49.89.221
  201.49.95.226
  201.50.38.189
-201.51.102.185
  201.52.57.124
  201.55.103.34
-201.55.140.0
-201.55.140.40
-201.55.142.20
  201.55.149.107
  201.55.150.242
  201.55.158.186
-201.55.159.211
-201.55.159.254
-201.55.159.63
  201.55.198.107
  201.55.201.246
  201.55.91.6
@@ -86122,15 +80974,14 @@
  201.80.54.151
  201.80.89.57
  201.82.233.8
-201.82.233.96
  201.82.245.220
  201.86.99.130
  201.87.154.127
  201.87.233.60
+201.87.239.243
  201.87.243.22
  201.87.243.24
  201.88.74.2
-201.9.126.108
  201.90.101.165
  201.90.148.195
  201.90.255.226
@@ -86139,9 +80990,6 @@
  201.91.210.130
  201.91.82.155
  201.91.86.28
-201.92.183.196
-201.92.185.99
-201.92.243.192
  201.92.52.101
  201.92.52.226
  201.92.54.139
@@ -86155,7 +81003,6 @@
  201.95.72.49
  201.95.72.61
  201.97.101.226
-201.97.106.44
  201.97.157.100
  201.97.166.127
  201.97.196.72
@@ -86178,10 +81025,10 @@
  20191021t124955-dot-we-secure-file-sh4455.appspot.com
  20191027t231510-dot-wetransfer-auth-file-343.appspot.com
  20191113t071621-dot-wetransfer-auth-file334.appspot.com
+202.0.103.51
  202.1.114.202
  202.10.33.98
  202.10.79.168
-202.100.168.150
  202.100.168.67
  202.100.185.138
  202.100.188.108
@@ -86196,12 +81043,13 @@
  202.102.144.121
  202.102.144.123
  202.102.249.26
+202.102.67.181
+202.102.67.184
  202.102.90.21
  202.103.176.67
  202.103.222.10
  202.103.238.138
-202.103.241.234
-202.103.37.40
+202.103.241.233
  202.104.101.27
  202.104.112.217
  202.104.113.226
@@ -86211,7 +81059,6 @@
  202.105.190.225
  202.105.238.100
  202.105.247.62
-202.105.96.131
  202.105.98.210
  202.106.54.122
  202.107.15.42
@@ -86239,7 +81086,6 @@
  202.110.83.126
  202.111.13.98
  202.111.131.236
-202.111.131.93
  202.111.173.153
  202.111.173.59
  202.111.174.150
@@ -86248,12 +81094,6 @@
  202.112.51.45
  202.113.65.13
  202.113.80.58
-202.114.176.192
-202.114.176.200
-202.114.176.203
-202.114.176.205
-202.114.176.212
-202.114.176.246
  202.114.176.247
  202.114.96.199
  202.115.30.5
@@ -86267,8 +81107,8 @@
  202.118.8.54
  202.118.8.61
  202.119.114.64
-202.119.81.138
  202.12.74.243
+202.12.80.74
  202.120.10.27
  202.120.13.51
  202.120.164.98
@@ -86279,7 +81119,6 @@
  202.121.138.74
  202.121.174.4
  202.121.174.96
-202.121.181.130
  202.124.193.13
  202.124.204.22
  202.124.204.5
@@ -86323,11 +81162,10 @@
  202.133.4.49
  202.133.4.53
  202.133.4.57
-202.133.56.235
  202.133.63.9
  202.134.0.9
-202.134.118.30
  202.134.180.50
+202.134.31.82
  202.134.4.211
  202.134.4.216
  202.134.61.41
@@ -86341,6 +81179,7 @@
  202.137.10.182
  202.137.116.125
  202.137.116.7
+202.137.134.139
  202.137.134.190
  202.137.141.11
  202.137.142.159
@@ -86349,23 +81188,23 @@
  202.137.154.138
  202.137.154.154
  202.137.154.62
-202.137.155.142
-202.137.155.168
+202.137.155.148
  202.137.155.171
+202.137.155.181
+202.137.155.212
  202.137.155.22
+202.137.155.228
  202.137.155.234
  202.137.155.34
-202.137.155.68
+202.137.155.78
  202.137.155.95
  202.137.159.132
  202.137.172.76
-202.137.20.58
  202.137.26.10
  202.137.26.12
  202.137.26.4
  202.137.26.6
  202.137.26.8
-202.137.28.92
  202.137.5.98
  202.137.7.58
  202.138.233.162
@@ -86383,12 +81222,10 @@
  202.139.199.74
  202.139.199.85
  202.14.5.188
-202.14.6.189
  202.141.225.174
  202.141.226.124
  202.141.226.125
  202.141.233.166
-202.141.236.26
  202.141.242.3
  202.141.243.254
  202.141.245.66
@@ -86403,7 +81240,6 @@
  202.142.158.114
  202.142.159.204
  202.142.159.26
-202.142.162.186
  202.142.172.10
  202.142.178.114
  202.142.185.4
@@ -86416,7 +81252,6 @@
  202.143.127.163
  202.143.97.30
  202.143.97.57
-202.144.157.70
  202.144.201.129
  202.144.201.130
  202.144.201.132
@@ -86431,18 +81266,15 @@
  202.147.192.134
  202.147.192.242
  202.147.198.115
-202.147.198.154
  202.147.199.130
  202.147.206.210
  202.147.207.253
  202.148.12.90
  202.148.2.254
  202.148.28.18
-202.148.28.83
  202.148.31.171
  202.148.31.172
  202.148.31.174
-202.149.85.226
  202.150.139.46
  202.150.148.218
  202.150.149.30
@@ -86452,10 +81284,9 @@
  202.150.176.100
  202.150.177.105
  202.150.177.2
+202.150.180.225
  202.150.181.58
-202.150.182.142
  202.150.182.28
-202.150.182.62
  202.150.216.211
  202.151.163.10
  202.151.27.177
@@ -86480,19 +81311,16 @@
  202.154.180.51
  202.154.180.53
  202.154.182.234
-202.154.184.148
  202.154.186.25
  202.154.189.149
  202.154.191.106
  202.154.191.58
  202.155.208.243
  202.155.211.226
-202.155.217.150
  202.155.228.207
  202.155.248.196
-202.157.177.60
  202.158.11.92
-202.158.123.42
+202.158.244.34
  202.158.49.138
  202.158.49.140
  202.158.49.141
@@ -86509,7 +81337,6 @@
  202.159.121.225
  202.159.123.22
  202.159.19.213
-202.159.24.35
  202.159.30.1
  202.159.30.129
  202.159.30.153
@@ -86534,7 +81361,6 @@
  202.159.35.57
  202.159.35.65
  202.159.35.73
-202.159.35.81
  202.159.35.86
  202.159.35.97
  202.159.37.14
@@ -86549,7 +81375,6 @@
  202.160.166.193
  202.160.170.225
  202.160.173.9
-202.160.38.159
  202.160.39.194
  202.162.188.147
  202.162.203.210
@@ -86565,9 +81390,9 @@
  202.162.79.202
  202.163.101.11
  202.163.101.69
-202.163.126.134
  202.163.76.169
  202.164.131.249
+202.164.136.109
  202.164.138.17
  202.164.138.212
  202.164.138.225
@@ -86575,6 +81400,7 @@
  202.164.138.51
  202.164.139.105
  202.164.139.170
+202.164.139.177
  202.164.139.197
  202.164.139.207
  202.164.139.8
@@ -86586,17 +81412,14 @@
  202.164.49.212
  202.165.22.108
  202.165.22.112
+202.165.22.116
  202.165.22.135
-202.165.22.158
  202.165.22.161
  202.165.22.174
-202.165.22.201
  202.165.22.221
-202.165.22.245
  202.165.22.3
  202.165.22.33
  202.165.22.52
-202.165.22.81
  202.165.22.88
  202.165.228.161
  202.165.228.225
@@ -86642,11 +81465,8 @@
  202.168.165.43
  202.168.186.98
  202.168.189.90
-202.168.205.181
  202.168.225.141
-202.168.71.146
  202.169.240.54
-202.169.244.178
  202.169.32.138
  202.169.35.210
  202.169.35.90
@@ -86668,7 +81488,6 @@
  202.175.105.186
  202.175.187.74
  202.175.22.151
-202.175.250.218
  202.175.46.170
  202.176.4.231
  202.176.5.136
@@ -86682,7 +81501,7 @@
  202.179.72.250
  202.179.73.60
  202.179.76.187
-202.179.78.231
+202.180.119.182
  202.181.101.135
  202.181.209.102
  202.181.233.245
@@ -86690,6 +81509,7 @@
  202.181.237.142
  202.182.100.165
  202.182.101.14
+202.182.106.230
  202.182.109.112
  202.182.112.26
  202.182.117.2
@@ -86717,13 +81537,12 @@
  202.186.174.191
  202.186.200.146
  202.186.200.27
-202.186.38.188
-202.187.163.54
+202.187.159.109
  202.187.186.87
  202.187.20.237
+202.187.24.124
  202.187.252.250
  202.187.29.21
-202.187.31.20
  202.187.45.64
  202.187.87.219
  202.188.101.106
@@ -86733,7 +81552,6 @@
  202.188.20.126
  202.188.216.46
  202.189.3.253
-202.190.12.255
  202.190.16.129
  202.191.120.12
  202.191.121.12
@@ -86743,13 +81561,11 @@
  202.191.127.121
  202.191.132.211
  202.191.15.253
-202.191.200.227
  202.191.56.154
  202.192.34.106
  202.195.100.158
  202.195.237.213
  202.197.208.89
-202.200.142.251
  202.200.144.150
  202.201.0.144
  202.201.12.119
@@ -86762,19 +81578,16 @@
  202.207.7.33
  202.208.223.251
  202.21.104.102
-202.21.115.70
  202.21.115.94
  202.21.120.250
  202.21.123.124
  202.21.123.185
  202.21.123.194
  202.21.124.226
-202.21.127.189
  202.21.32.158
  202.210.150.70
  202.213.241.239
  202.215.74.126
-202.218.35.168
  202.22.199.145
  202.22.228.246
  202.228.204.204
@@ -86791,21 +81604,17 @@
  202.28.35.23
  202.28.35.24
  202.28.35.25
-202.28.68.211
  202.28.77.46
  202.29.105.30
  202.29.14.121
-202.29.176.21
  202.29.18.25
  202.29.210.132
  202.29.212.59
  202.29.212.60
  202.29.213.219
-202.29.214.13
  202.29.215.114
  202.29.215.147
  202.29.216.171
-202.29.220.114
  202.29.220.182
  202.29.220.202
  202.29.226.134
@@ -86820,8 +81629,6 @@
  202.29.245.46
  202.29.33.111
  202.29.39.234
-202.29.4.97
-202.29.51.61
  202.29.57.22
  202.29.80.133
  202.29.86.7
@@ -86831,7 +81638,6 @@
  202.30.130.199
  202.30.198.28
  202.32.40.50
-202.38.153.233
  202.38.181.171
  202.38.224.23
  202.39.134.198
@@ -86860,9 +81666,7 @@
  202.43.113.5
  202.43.113.78
  202.43.117.134
-202.43.146.107
  202.43.160.142
-202.43.167.234
  202.43.183.158
  202.43.183.98
  202.43.190.11
@@ -86876,12 +81680,9 @@
  202.44.240.6
  202.44.240.88
  202.44.249.211
-202.44.251.110
  202.44.40.193
  202.44.52.78
  202.44.9.1
-202.45.144.9
-202.45.145.181
  202.46.1.74
  202.46.3.22
  202.46.3.26
@@ -86891,8 +81692,8 @@
  202.47.224.33
  202.47.32.251
  202.49.183.168
+202.5.147.55
  202.5.17.28
-202.5.23.73
  202.5.36.215
  202.5.37.241
  202.5.38.27
@@ -86918,26 +81719,22 @@
  202.51.118.34
  202.51.118.42
  202.51.120.22
-202.51.126.4
  202.51.178.126
  202.51.188.170
  202.51.189.122
  202.51.189.134
  202.51.190.36
-202.51.255.3
-202.51.71.194
-202.51.74.23
-202.51.74.92
  202.51.86.198
  202.51.87.227
  202.51.96.49
-202.51.98.226
  202.52.146.71
  202.52.234.236
+202.52.240.17
  202.52.244.0
  202.52.244.150
  202.52.244.27
  202.52.248.254
+202.52.253.88
  202.52.4.151
  202.52.58.37
  202.53.137.47
@@ -86947,12 +81744,12 @@
  202.53.8.82
  202.53.95.156
  202.55.167.171
+202.55.167.228
  202.55.168.251
  202.55.168.252
  202.55.168.91
  202.55.171.91
  202.55.174.67
-202.55.175.236
  202.55.176.12
  202.55.64.62
  202.55.72.10
@@ -86964,12 +81761,14 @@
  202.57.132.78
  202.57.162.79
  202.57.2.19
-202.57.28.70
  202.57.33.134
+202.57.36.110
  202.57.37.197
  202.57.39.2
  202.57.40.227
+202.57.40.228
  202.57.43.26
+202.57.46.97
  202.57.49.250
  202.57.52.18
  202.57.8.211
@@ -86987,6 +81786,7 @@
  202.58.108.77
  202.58.108.81
  202.58.108.86
+202.58.204.150
  202.59.166.146
  202.59.173.204
  202.59.78.182
@@ -87006,12 +81806,10 @@
  202.62.10.250
  202.62.107.135
  202.62.11.106
-202.62.120.5
  202.62.13.72
  202.62.224.118
  202.62.224.24
  202.62.224.32
-202.62.224.61
  202.62.226.26
  202.62.227.132
  202.62.227.168
@@ -87025,9 +81823,9 @@
  202.62.45.53
  202.62.50.51
  202.62.50.81
+202.62.51.42
  202.62.59.113
  202.62.63.102
-202.62.63.23
  202.62.65.42
  202.62.78.46
  202.62.84.210
@@ -87050,6 +81848,7 @@
  202.67.153.114
  202.67.98.53
  202.67.98.72
+202.68.86.174
  202.69.105.18
  202.69.171.51
  202.69.171.52
@@ -87065,7 +81864,6 @@
  202.70.44.195
  202.70.72.217
  202.70.72.233
-202.70.80.27
  202.70.80.73
  202.70.84.201
  202.71.108.26
@@ -87078,9 +81876,10 @@
  202.72.225.17
  202.72.233.18
  202.72.242.242
-202.72.243.198
+202.73.14.68
  202.73.51.102
  202.73.58.54
+202.73.58.56
  202.74.243.112
  202.74.243.38
  202.75.211.206
@@ -87089,21 +81888,19 @@
  202.75.223.184
  202.75.53.115
  202.75.97.82
-202.76.10.70
  202.76.231.130
-202.77.105.100
  202.77.105.110
  202.77.105.50
  202.77.105.51
  202.77.105.98
  202.77.120.38
  202.77.120.42
+202.77.28.18
  202.77.31.138
  202.77.61.103
  202.77.61.112
  202.78.200.205
  202.78.201.165
-202.78.201.41
  202.78.202.37
  202.78.232.138
  202.78.94.70
@@ -87116,7 +81913,6 @@
  202.79.34.167
  202.79.34.178
  202.79.34.242
-202.79.34.76
  202.79.35.30
  202.79.37.14
  202.79.40.97
@@ -87124,16 +81920,14 @@
  202.79.58.89
  202.79.60.121
  202.8.75.90
-202.80.112.81
  202.80.118.90
  202.80.213.188
  202.80.216.126
  202.82.177.33
  202.82.218.169
  202.82.59.237
+202.82.86.129
  202.83.120.211
-202.83.161.117
-202.83.161.119
  202.83.168.97
  202.83.172.218
  202.83.172.245
@@ -87145,14 +81939,15 @@
  202.83.36.32
  202.83.37.125
  202.83.37.131
+202.83.37.224
  202.83.38.136
  202.83.38.190
  202.83.39.66
  202.83.54.167
  202.83.55.19
  202.83.56.236
+202.83.58.2
  202.83.58.46
-202.83.59.201
  202.83.59.234
  202.84.32.140
  202.84.42.69
@@ -87185,26 +81980,20 @@
  202.87.248.134
  202.87.248.50
  202.87.249.45
-202.88.154.70
  202.88.174.4
  202.88.216.242
  202.88.223.70
-202.88.234.140
-202.88.237.15
  202.88.239.11
  202.88.241.107
  202.88.241.118
  202.88.243.254
-202.88.246.161
  202.88.251.98
  202.89.117.171
-202.89.138.225
  202.9.38.20
  202.9.39.139
-202.90.199.116
  202.90.199.158
-202.90.199.208
-202.90.89.69
+202.90.240.33
+202.91.15.13
  202.91.232.39
  202.91.238.45
  202.91.240.83
@@ -87237,7 +82026,6 @@
  202.94.175.126
  202.94.175.158
  202.94.175.251
-202.94.175.55
  202.95.11.253
  202.95.11.5
  202.95.11.52
@@ -87505,9 +82293,7 @@
  203.101.174.175
  203.101.178.179
  203.101.178.68
-203.106.116.163
  203.106.136.250
-203.106.139.251
  203.106.164.74
  203.106.200.142
  203.106.70.217
@@ -87519,7 +82305,6 @@
  203.109.113.155
  203.11.71.1
  203.110.164.139
-203.110.166.51
  203.110.179.26
  203.110.86.69
  203.110.86.71
@@ -87532,14 +82317,12 @@
  203.110.95.94
  203.111.208.99
  203.111.254.243
-203.112.143.110
  203.112.209.102
  203.112.212.114
  203.112.212.66
  203.112.218.83
-203.112.73.169
+203.112.76.193
  203.113.10.153
-203.113.102.178
  203.113.135.199
  203.113.174.47
  203.114.108.46
@@ -87567,8 +82350,8 @@
  203.124.32.202
  203.125.16.18
  203.125.73.70
-203.127.92.151
  203.128.170.18
+203.128.19.68
  203.128.242.166
  203.128.28.60
  203.128.67.114
@@ -87586,12 +82369,10 @@
  203.129.207.98
  203.129.220.182
  203.129.225.66
-203.129.226.99
  203.130.0.69
  203.130.1.162
  203.130.1.58
  203.130.130.40
-203.130.180.30
  203.130.2.13
  203.130.215.147
  203.130.22.203
@@ -87604,6 +82385,7 @@
  203.130.41.12
  203.131.229.187
  203.131.252.210
+203.132.92.216
  203.132.95.10
  203.134.194.240
  203.134.212.9
@@ -87617,12 +82399,8 @@
  203.142.69.242
  203.142.70.222
  203.142.76.171
-203.143.119.196
-203.143.12.26
-203.143.20.162
-203.143.20.230
-203.143.20.89
  203.144.133.5
+203.145.233.251
  203.146.100.227
  203.146.127.133
  203.146.129.235
@@ -87630,15 +82408,11 @@
  203.146.21.244
  203.146.21.248
  203.147.62.92
-203.147.76.2
-203.147.78.171
-203.147.79.174
  203.147.90.120
  203.147.90.125
  203.147.90.25
  203.147.90.49
  203.148.20.162
-203.148.20.254
  203.148.250.144
  203.148.87.154
  203.15.176.1
@@ -87699,7 +82473,6 @@
  203.150.176.107
  203.150.225.2
  203.150.230.101
-203.150.242.25
  203.150.36.29
  203.150.36.61
  203.150.49.97
@@ -87725,7 +82498,6 @@
  203.153.109.150
  203.153.113.226
  203.153.119.242
-203.153.20.64
  203.153.216.178
  203.153.216.189
  203.153.25.126
@@ -87734,12 +82506,9 @@
  203.153.99.174
  203.154.232.182
  203.156.178.43
-203.156.197.22
  203.156.198.210
  203.156.205.125
  203.156.205.55
-203.156.205.59
-203.156.216.99
  203.158.136.31
  203.158.140.7
  203.158.168.22
@@ -87748,7 +82517,6 @@
  203.159.249.215
  203.160.1.76
  203.160.252.254
-203.160.55.106
  203.160.55.126
  203.160.57.193
  203.160.57.39
@@ -87778,16 +82546,13 @@
  203.160.63.49
  203.160.63.81
  203.162.123.109
-203.162.123.151
  203.162.130.73
  203.162.230.150
-203.162.54.247
  203.162.76.32
  203.163.196.129
  203.163.211.46
  203.163.232.15
  203.163.234.219
-203.163.243.133
  203.163.245.14
  203.165.231.135
  203.166.160.156
@@ -87801,18 +82566,18 @@
  203.169.225.68
  203.170.100.108
  203.170.112.16
-203.170.121.107
+203.170.112.3
+203.170.123.159
  203.170.203.66
  203.170.58.241
-203.170.59.244
  203.170.66.1
  203.170.66.129
+203.170.66.161
  203.170.66.173
  203.170.66.185
  203.170.66.209
  203.170.66.217
  203.170.66.225
-203.170.66.41
  203.170.66.57
  203.170.67.109
  203.170.67.125
@@ -87833,6 +82598,7 @@
  203.170.68.137
  203.170.68.145
  203.170.68.185
+203.170.68.205
  203.170.68.21
  203.170.68.249
  203.170.68.33
@@ -87842,11 +82608,10 @@
  203.170.98.199
  203.171.224.185
  203.171.239.10
-203.171.25.30
+203.171.28.17
  203.171.29.142
  203.171.31.156
  203.172.162.163
-203.172.66.227
  203.172.76.4
  203.173.31.172
  203.173.92.229
@@ -87872,7 +82637,6 @@
  203.177.135.133
  203.177.156.133
  203.177.237.46
-203.177.39.211
  203.177.71.203
  203.177.76.173
  203.177.83.179
@@ -87882,8 +82646,7 @@
  203.184.132.191
  203.184.55.57
  203.185.129.36
-203.185.61.137
-203.186.187.169
+203.186.128.148
  203.186.54.237
  203.187.186.204
  203.188.242.222
@@ -87893,7 +82656,6 @@
  203.188.255.179
  203.188.255.74
  203.189.116.72
-203.189.119.36
  203.189.135.7
  203.189.141.214
  203.189.141.56
@@ -87902,7 +82664,6 @@
  203.189.146.230
  203.189.153.225
  203.189.154.243
-203.189.198.215
  203.189.200.118
  203.189.235.205
  203.189.253.172
@@ -87938,12 +82699,10 @@
  203.194.21.241
  203.195.130.233
  203.195.132.128
-203.195.133.14
  203.195.134.30
  203.195.138.190
  203.195.141.18
  203.195.144.114
-203.195.144.192
  203.195.148.210
  203.195.150.131
  203.195.152.113
@@ -87958,18 +82717,16 @@
  203.195.204.122
  203.195.204.47
  203.195.205.202
-203.195.211.173
-203.195.218.203
  203.195.220.71
  203.195.224.229
  203.195.229.168
-203.195.235.135
  203.195.241.39
  203.195.245.241
  203.195.255.63
  203.197.227.98
  203.197.88.53
  203.198.142.142
+203.198.149.96
  203.198.162.142
  203.198.94.228
  203.199.238.249
@@ -87993,6 +82750,7 @@
  203.205.137.72
  203.205.21.159
  203.205.21.36
+203.205.21.54
  203.205.35.201
  203.205.37.233
  203.205.41.172
@@ -88016,8 +82774,9 @@
  203.212.243.165
  203.212.244.141
  203.212.98.24
+203.213.119.246
+203.213.120.164
  203.213.249.66
-203.213.66.170
  203.214.39.130
  203.215.181.218
  203.215.181.220
@@ -88036,13 +82795,14 @@
  203.217.176.60
  203.217.56.212
  203.217.56.33
-203.217.92.178
  203.218.127.193
  203.218.132.12
  203.218.14.244
  203.218.155.21
+203.218.156.243
  203.218.170.206
  203.218.206.114
+203.218.32.105
  203.218.4.186
  203.218.44.219
  203.218.51.29
@@ -88064,6 +82824,7 @@
  203.222.26.26
  203.223.171.129
  203.223.171.161
+203.223.171.185
  203.223.191.66
  203.223.41.34
  203.223.44.102
@@ -88080,11 +82841,11 @@
  203.228.59.54
  203.228.84.199
  203.228.97.38
-203.229.183.243
  203.230.220.19
  203.230.6.175
  203.232.119.245
  203.232.58.153
+203.232.63.9
  203.234.103.49
  203.234.129.183
  203.234.135.222
@@ -88094,15 +82855,13 @@
  203.234.248.190
  203.234.62.129
  203.236.100.30
-203.236.190.155
  203.236.190.2
  203.236.190.28
-203.236.51.35
  203.237.203.241
-203.237.211.234
  203.237.238.234
  203.238.181.224
  203.238.191.9
+203.238.63.44
  203.238.63.5
  203.238.86.152
  203.24.188.242
@@ -88129,6 +82888,8 @@
  203.243.148.62
  203.243.148.95
  203.243.181.16
+203.243.189.152
+203.243.190.82
  203.243.221.104
  203.243.221.84
  203.243.223.5
@@ -88141,7 +82902,6 @@
  203.245.30.35
  203.245.41.96
  203.246.79.115
-203.247.143.20
  203.248.175.71
  203.248.175.72
  203.25.159.3
@@ -88159,7 +82919,6 @@
  203.3.84.204
  203.30.90.82
  203.30.95.15
-203.38.115.103
  203.41.236.130
  203.43.95.165
  203.45.112.244
@@ -88167,24 +82926,18 @@
  203.45.171.181
  203.45.25.21
  203.46.223.176
-203.49.234.122
  203.51.27.108
  203.55.117.211
  203.56.191.129
-203.56.232.33
  203.56.24.180
  203.56.4.47
  203.57.200.58
-203.57.227.58
  203.57.229.254
-203.57.237.52
  203.58.26.70
  203.59.72.40
  203.6.149.115
-203.6.149.195
-203.6.237.234
+203.6.230.96
  203.62.185.131
-203.63.75.248
  203.63.88.191
  203.64.20.2
  203.64.230.117
@@ -88203,11 +82956,9 @@
  203.72.188.105
  203.73.150.177
  203.73.168.4
-203.73.62.97
  203.74.190.196
  203.75.169.31
  203.75.169.6
-203.75.29.110
  203.76.109.178
  203.76.110.163
  203.76.110.164
@@ -88221,7 +82972,6 @@
  203.76.240.104
  203.76.240.114
  203.76.240.77
-203.76.248.14
  203.77.210.161
  203.77.214.49
  203.77.215.250
@@ -88253,23 +83003,20 @@
  203.82.204.154
  203.82.54.38
  203.82.59.86
+203.82.59.98
  203.83.162.242
  203.83.182.138
  203.83.182.86
  203.83.184.54
  203.83.189.126
  203.83.234.158
-203.86.239.251
  203.86.7.110
  203.87.133.216
-203.88.129.66
  203.88.202.26
  203.89.104.12
  203.89.96.134
-203.90.233.7
  203.90.236.199
  203.90.61.133
-203.90.80.58
  203.91.113.39
  203.91.118.71
  203.91.121.70
@@ -88278,10 +83025,10 @@
  203.92.91.194
  203.93.19.36
  203.93.209.7
-203.93.97.101
  203.94.24.114
  203.94.243.59
  203.95.193.100
+203.95.212.41
  203.95.220.33
  203.95.7.164
  203.97.30.12
@@ -88304,6 +83051,7 @@
  20394884884.z13.web.core.windows.net
  204.10.8.90
  204.10.89.190
+204.10.89.39
  204.101.161.19
  204.101.4.42
  204.101.61.82
@@ -88343,7 +83091,6 @@
  204.15.230.189
  204.152.199.34
  204.152.203.98
-204.152.210.167
  204.152.211.100
  204.152.218.49
  204.152.255.35
@@ -88359,7 +83106,6 @@
  204.155.30.121
  204.155.30.77
  204.155.31.153
-204.156.180.113
  204.16.0.32
  204.16.247.19
  204.16.247.28
@@ -88397,11 +83143,9 @@
  204.44.87.4
  204.44.92.154
  204.44.98.116
-204.48.19.178
  204.48.21.36
  204.48.23.126
  204.48.23.96
-204.48.25.171
  204.48.25.6
  204.48.26.63
  204.48.29.122
@@ -88433,9 +83177,8 @@
  204.9.243.81
  204.93.113.108
  204.93.154.197
-204.93.154.212
+204.93.154.208
  204.93.160.85
-204.93.174.103
  204.93.180.3
  204.93.197.85
  204.98.164.243
@@ -88448,7 +83191,6 @@
  205.134.172.6
  205.134.182.106
  205.134.255.225
-205.151.253.85
  205.157.156.10
  205.157.65.201
  205.164.3.143
@@ -88463,7 +83205,6 @@
  205.185.114.133
  205.185.114.215
  205.185.114.231
-205.185.114.247
  205.185.114.47
  205.185.114.70
  205.185.115.100
@@ -88511,25 +83252,28 @@
  205.185.127.168
  205.185.127.217
  205.185.127.30
-205.185.127.36
  205.185.127.69
+205.185.209.209
  205.185.209.216
  205.185.209.227
-205.185.209.228
+205.185.209.240
  205.185.214.107
-205.185.214.113
+205.185.214.120
  205.185.214.130
+205.185.214.138
  205.185.214.21
  205.185.214.96
-205.185.214.98
-205.185.222.25
-205.185.222.78
-205.185.223.135
+205.185.222.128
+205.185.222.66
+205.185.223.129
+205.185.223.136
+205.185.223.172
+205.185.223.177
  205.185.223.19
-205.185.223.31
+205.185.223.25
  205.185.223.43
-205.185.223.67
-205.185.223.90
+205.185.223.61
+205.185.223.73
  205.185.223.98
  205.186.131.199
  205.186.132.245
@@ -88543,13 +83287,11 @@
  205.205.150.21
  205.205.150.26
  205.205.150.28
-205.205.150.3
  205.205.150.4
  205.205.150.45
  205.205.150.5
  205.205.150.57
  205.205.150.59
-205.206.50.222
  205.206.74.99
  205.206.81.86
  205.209.159.201
@@ -88607,8 +83349,6 @@
  206.132.57.240
  206.166.251.181
  206.166.251.69
-206.167.33.43
-206.167.46.10
  206.173.219.10
  206.174.214.90
  206.174.236.147
@@ -88622,7 +83362,6 @@
  206.188.207.19
  206.189.1.246
  206.189.101.68
-206.189.108.32
  206.189.109.149
  206.189.110.64
  206.189.110.77
@@ -88634,6 +83373,7 @@
  206.189.117.97
  206.189.118.168
  206.189.121.234
+206.189.121.29
  206.189.124.122
  206.189.124.254
  206.189.125.33
@@ -88644,7 +83384,6 @@
  206.189.128.215
  206.189.129.144
  206.189.130.218
-206.189.130.255
  206.189.132.108
  206.189.132.204
  206.189.132.8
@@ -88657,24 +83396,16 @@
  206.189.136.239
  206.189.136.246
  206.189.138.144
-206.189.138.219
  206.189.138.3
  206.189.138.99
-206.189.139.179
  206.189.139.211
  206.189.140.132
  206.189.140.139
  206.189.140.97
  206.189.141.214
-206.189.142.222
  206.189.143.91
  206.189.144.129
  206.189.145.21
-206.189.145.251
-206.189.146.241
-206.189.146.48
-206.189.147.131
-206.189.147.137
  206.189.147.45
  206.189.147.87
  206.189.148.47
@@ -88683,21 +83414,20 @@
  206.189.151.16
  206.189.151.254
  206.189.151.26
+206.189.152.63
  206.189.153.222
  206.189.154.139
  206.189.154.19
-206.189.155.195
  206.189.155.250
-206.189.156.18
  206.189.157.224
  206.189.157.46
-206.189.158.227
+206.189.158.108
  206.189.158.28
  206.189.159.30
  206.189.16.138
  206.189.16.199
  206.189.160.192
-206.189.161.240
+206.189.160.81
  206.189.162.136
  206.189.162.99
  206.189.163.103
@@ -88711,7 +83441,6 @@
  206.189.165.171
  206.189.165.54
  206.189.165.77
-206.189.165.94
  206.189.166.172
  206.189.166.192
  206.189.166.210
@@ -88755,6 +83484,7 @@
  206.189.183.152
  206.189.183.229
  206.189.183.71
+206.189.184.16
  206.189.185.73
  206.189.188.196
  206.189.188.218
@@ -88777,17 +83507,14 @@
  206.189.202.2
  206.189.204.111
  206.189.204.165
-206.189.204.63
  206.189.205.248
  206.189.207.227
-206.189.207.28
  206.189.207.90
  206.189.208.103
  206.189.208.7
  206.189.208.80
  206.189.209.253
  206.189.210.235
-206.189.212.33
  206.189.213.113
  206.189.213.126
  206.189.213.201
@@ -88803,7 +83530,6 @@
  206.189.221.52
  206.189.221.73
  206.189.222.161
-206.189.222.181
  206.189.223.159
  206.189.223.163
  206.189.223.181
@@ -88826,14 +83552,10 @@
  206.189.232.30
  206.189.232.31
  206.189.232.51
-206.189.235.233
  206.189.236.228
  206.189.238.171
-206.189.238.240
-206.189.239.103
-206.189.24.40
-206.189.24.87
-206.189.26.171
+206.189.239.86
+206.189.24.200
  206.189.26.195
  206.189.26.219
  206.189.27.201
@@ -88846,8 +83568,6 @@
  206.189.33.44
  206.189.35.67
  206.189.36.133
-206.189.36.240
-206.189.36.40
  206.189.38.237
  206.189.41.132
  206.189.43.143
@@ -88856,7 +83576,6 @@
  206.189.44.118
  206.189.45.118
  206.189.45.137
-206.189.45.234
  206.189.45.96
  206.189.46.222
  206.189.46.252
@@ -88864,7 +83583,6 @@
  206.189.46.85
  206.189.47.166
  206.189.47.179
-206.189.47.215
  206.189.47.222
  206.189.53.11
  206.189.53.119
@@ -88904,7 +83622,6 @@
  206.189.74.10
  206.189.75.101
  206.189.76.220
-206.189.76.244
  206.189.77.79
  206.189.80.131
  206.189.80.84
@@ -88918,11 +83635,9 @@
  206.189.84.63
  206.189.85.218
  206.189.85.88
-206.189.85.90
  206.189.86.128
  206.189.87.108
  206.189.88.253
-206.189.88.27
  206.189.88.61
  206.189.88.91
  206.189.90.232
@@ -88931,14 +83646,12 @@
  206.189.91.211
  206.189.91.219
  206.189.91.52
-206.189.92.162
  206.189.92.4
  206.189.92.74
  206.189.93.69
  206.189.95.193
  206.189.97.110
  206.189.98.152
-206.189.98.225
  206.192.226.90
  206.196.108.34
  206.196.145.143
@@ -88948,18 +83661,17 @@
  206.214.143.126
  206.214.217.188
  206.214.244.218
+206.217.128.106
  206.217.128.130
-206.217.128.212
+206.217.128.134
  206.217.129.244
  206.217.129.84
-206.217.129.85
  206.217.130.149
  206.217.135.166
  206.217.135.66
  206.217.136.218
  206.217.137.205
  206.217.137.208
-206.217.138.204
  206.217.138.205
  206.217.138.221
  206.219.100.100
@@ -88983,11 +83695,8 @@
  206.248.184.127
  206.248.97.116
  206.251.210.89
-206.252.210.42
-206.253.166.69
+206.251.220.29
  206.253.167.10
-206.253.167.205
-206.253.167.213
  206.253.224.74
  206.253.226.7
  206.29.180.76
@@ -88996,6 +83705,7 @@
  206.41.168.167
  206.41.168.24
  206.41.172.62
+206.41.173.181
  206.41.174.188
  206.41.174.236
  206.41.174.41
@@ -89014,6 +83724,7 @@
  206.41.187.155
  206.41.187.177
  206.41.187.208
+206.41.187.8
  206.47.38.14
  206.47.83.27
  206.54.165.103
@@ -89021,23 +83732,19 @@
  206.71.228.129
  206.71.228.193
  206.72.195.16
-206.72.198.20
  206.72.206.4
  206.72.66.209
+206.74.101.70
  206.80.42.35
  206.81.1.137
  206.81.1.200
-206.81.10.104
  206.81.10.215
  206.81.11.129
  206.81.11.149
  206.81.12.141
-206.81.12.209
  206.81.13.189
-206.81.14.48
  206.81.16.252
  206.81.16.88
-206.81.17.148
  206.81.17.185
  206.81.17.191
  206.81.17.223
@@ -89045,17 +83752,15 @@
  206.81.18.76
  206.81.19.60
  206.81.2.133
-206.81.2.75
  206.81.23.81
+206.81.26.78
  206.81.27.163
  206.81.27.235
  206.81.28.167
  206.81.29.88
-206.81.3.76
  206.81.31.58
  206.81.6.142
  206.81.8.136
-206.81.8.155
  2063696-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  206betasus.com
  207-365.net
@@ -89102,7 +83807,6 @@
  207.148.119.18
  207.148.12.47
  207.148.120.174
-207.148.120.5
  207.148.121.50
  207.148.122.150
  207.148.124.20
@@ -89120,13 +83824,11 @@
  207.148.83.56
  207.148.84.26
  207.148.87.120
-207.148.93.175
  207.148.94.159
  207.148.97.0
  207.148.98.111
  207.150.188.54
  207.153.17.155
-207.153.3.14
  207.154.193.6
  207.154.194.180
  207.154.195.134
@@ -89139,17 +83841,14 @@
  207.154.205.200
  207.154.205.86
  207.154.205.92
-207.154.206.212
  207.154.207.214
  207.154.208.77
  207.154.214.40
-207.154.215.119
  207.154.215.142
  207.154.215.3
  207.154.215.52
  207.154.216.143
  207.154.216.235
-207.154.218.129
  207.154.219.42
  207.154.220.110
  207.154.220.234
@@ -89164,7 +83863,6 @@
  207.154.232.106
  207.154.232.99
  207.154.233.150
-207.154.235.23
  207.154.235.230
  207.154.235.64
  207.154.236.130
@@ -89177,7 +83875,6 @@
  207.154.247.141
  207.154.251.236
  207.154.253.168
-207.154.253.66
  207.154.254.214
  207.154.254.218
  207.154.254.63
@@ -89187,6 +83884,7 @@
  207.166.131.238
  207.166.131.243
  207.166.136.252
+207.174.202.9
  207.174.213.181
  207.180.192.52
  207.180.195.154
@@ -89218,7 +83916,6 @@
  207.180.244.165
  207.180.247.20
  207.180.250.228
-207.180.250.24
  207.180.251.11
  207.182.137.218
  207.182.154.178
@@ -89226,21 +83923,20 @@
  207.188.41.2
  207.188.69.59
  207.188.75.25
-207.191.137.179
  207.191.161.206
  207.191.161.218
  207.191.161.235
-207.191.161.62
+207.191.161.91
  207.191.163.249
  207.191.171.254
  207.191.186.10
+207.191.240.214
  207.191.249.43
  207.191.254.174
  207.191.26.202
  207.191.38.230
  207.194.255.18
  207.194.255.74
-207.194.35.197
  207.199.250.108
  207.199.250.82
  207.199.250.84
@@ -89280,20 +83976,19 @@
  207.244.109.182
  207.244.117.154
  207.244.117.173
+207.244.117.201
  207.244.117.205
  207.244.117.223
  207.244.117.228
  207.244.117.233
  207.244.117.51
  207.244.117.55
-207.244.117.69
  207.244.117.87
  207.244.118.111
-207.244.118.12
  207.244.118.126
  207.244.118.196
  207.244.118.200
-207.244.127.27
+207.244.119.191
  207.244.149.106
  207.244.149.107
  207.244.149.108
@@ -89303,10 +83998,8 @@
  207.244.149.75
  207.244.157.138
  207.244.157.139
-207.244.157.37
  207.244.181.91
  207.244.229.60
-207.244.232.105
  207.244.234.226
  207.244.240.135
  207.244.242.80
@@ -89317,11 +84010,13 @@
  207.244.243.20
  207.244.248.194
  207.244.248.81
+207.244.249.66
  207.244.250.133
  207.244.253.64
  207.244.68.199
  207.244.70.35
  207.244.78.3
+207.244.89.162
  207.246.104.203
  207.246.104.231
  207.246.106.74
@@ -89349,18 +84044,14 @@
  207.246.95.21
  207.246.95.32
  207.248.245.235
-207.248.62.98
  207.249.133.182
  207.253.131.100
  207.253.170.156
  207.253.227.226
-207.253.29.91
-207.254.245.18
  207.255.32.121
  207.30.28.244
  207.30.28.246
  207.38.90.177
-207.40.144.9
  207.44.62.36
  207.46.13.0
  207.46.13.103
@@ -89477,7 +84168,6 @@
  207.70.150.246
  207.74.82.103
  207.81.125.200
-207.81.2.12
  207.81.251.119
  207.87.244.218
  207.87.67.86
@@ -89495,7 +84185,6 @@
  208.100.170.91
  208.100.26.228
  208.100.26.229
-208.100.26.235
  208.100.26.236
  208.100.26.237
  208.100.26.241
@@ -89534,12 +84223,11 @@
  208.110.93.52
  208.110.99.105
  208.112.122.108
-208.113.129.120
  208.113.130.13
  208.113.130.87
  208.113.131.116
  208.113.131.75
-208.113.132.60
+208.113.132.249
  208.113.133.131
  208.113.133.232
  208.113.133.35
@@ -89553,7 +84241,6 @@
  208.113.164.202
  208.113.181.161
  208.113.182.208
-208.113.184.219
  208.113.223.186
  208.113.249.139
  208.114.153.106
@@ -89567,6 +84254,7 @@
  208.117.222.107
  208.117.222.108
  208.117.222.15
+208.117.222.154
  208.117.222.155
  208.117.222.158
  208.117.222.183
@@ -89587,6 +84275,7 @@
  208.125.16.254
  208.125.188.74
  208.126.16.110
+208.138.18.174
  208.163.39.218
  208.167.242.170
  208.167.245.245
@@ -89598,7 +84287,6 @@
  208.180.16.38
  208.180.181.185
  208.180.202.147
-208.180.220.104
  208.180.33.94
  208.181.243.6
  208.191.153.193
@@ -89629,7 +84317,6 @@
  208.64.68.228
  208.65.181.179
  208.66.193.76
-208.66.208.153
  208.67.1.113
  208.67.1.194
  208.67.23.106
@@ -89641,7 +84328,6 @@
  208.68.37.37
  208.68.38.182
  208.68.38.22
-208.68.39.124
  208.68.39.180
  208.68.39.220
  208.68.4.129
@@ -89653,7 +84339,6 @@
  208.71.173.74
  208.72.57.200
  208.73.21.13
-208.74.182.221
  208.74.205.40
  208.74.77.246
  208.75.208.252
@@ -89661,12 +84346,12 @@
  208.77.130.238
  208.78.245.218
  208.79.50.48
-208.80.151.71
  208.80.28.208
  208.81.1.105
  208.81.126.169
  208.82.115.230
  208.82.160.172
+208.82.160.72
  208.82.160.99
  208.83.1.168
  208.83.204.215
@@ -89674,10 +84359,10 @@
  208.84.155.69
  208.84.155.70
  208.85.1.82
+208.85.12.236
  208.85.3.130
  208.85.3.210
  208.86.10.183
-208.86.120.136
  208.86.184.38
  208.87.237.201
  208.87.241.91
@@ -89714,22 +84399,14 @@
  209.10.246.158
  209.103.178.1
  209.103.178.10
+209.103.178.100
+209.103.178.102
  209.103.178.104
  209.103.178.106
  209.103.178.108
-209.103.178.111
  209.103.178.112
  209.103.178.12
-209.103.178.120
-209.103.178.125
-209.103.178.126
  209.103.178.128
-209.103.178.132
-209.103.178.135
-209.103.178.136
-209.103.178.140
-209.103.178.143
-209.103.178.144
  209.103.178.16
  209.103.178.160
  209.103.178.168
@@ -89742,22 +84419,24 @@
  209.103.178.189
  209.103.178.190
  209.103.178.192
-209.103.178.194
-209.103.178.196
  209.103.178.2
-209.103.178.200
  209.103.178.208
  209.103.178.21
  209.103.178.212
  209.103.178.214
-209.103.178.217
-209.103.178.218
+209.103.178.216
+209.103.178.219
  209.103.178.22
  209.103.178.220
  209.103.178.222
  209.103.178.224
+209.103.178.232
+209.103.178.236
+209.103.178.239
  209.103.178.24
  209.103.178.240
+209.103.178.242
+209.103.178.244
  209.103.178.249
  209.103.178.250
  209.103.178.252
@@ -89766,10 +84445,10 @@
  209.103.178.30
  209.103.178.32
  209.103.178.4
+209.103.178.40
+209.103.178.45
+209.103.178.46
  209.103.178.48
-209.103.178.50
-209.103.178.52
-209.103.178.56
  209.103.178.64
  209.103.178.68
  209.103.178.71
@@ -89782,53 +84461,66 @@
  209.105.243.145
  209.105.243.164
  209.107.196.130
-209.107.196.141
+209.107.196.148
  209.107.196.159
-209.107.196.177
-209.107.196.189
-209.107.196.27
+209.107.196.195
+209.107.196.207
+209.107.196.213
+209.107.196.219
+209.107.196.225
+209.107.196.39
  209.107.204.103
-209.107.204.112
+209.107.204.110
+209.107.204.134
  209.107.204.47
-209.107.204.54
+209.107.204.49
  209.107.204.55
-209.107.204.64
-209.107.204.70
+209.107.204.62
+209.107.204.78
  209.107.204.86
-209.107.210.104
-209.107.210.111
+209.107.204.94
+209.107.204.96
  209.107.210.120
+209.107.210.140
+209.107.210.146
  209.107.210.155
-209.107.210.156
+209.107.210.162
+209.107.210.172
+209.107.210.180
  209.107.210.186
  209.107.210.187
+209.107.210.189
+209.107.210.196
  209.107.210.212
  209.107.210.213
-209.107.210.227
-209.107.210.243
-209.107.210.71
+209.107.210.218
+209.107.210.47
+209.107.210.65
+209.107.210.79
+209.107.210.81
+209.107.210.95
  209.107.214.195
  209.107.216.105
+209.107.216.110
+209.107.216.47
  209.107.216.65
-209.107.216.80
+209.107.216.70
+209.107.216.72
  209.107.216.86
  209.108.206.229
  209.11.246.11
  209.112.238.196
  209.118.108.196
-209.122.211.18
  209.123.237.137
  209.124.55.40
  209.124.88.144
  209.124.90.241
  209.126.10.81
  209.126.101.179
-209.126.104.67
  209.126.11.4
  209.126.110.113
  209.126.114.72
  209.126.116.205
-209.126.119.148
  209.126.127.49
  209.126.13.106
  209.126.13.138
@@ -89840,15 +84532,15 @@
  209.126.71.160
  209.126.74.118
  209.126.76.205
+209.126.79.16
  209.126.79.43
+209.126.8.58
  209.126.8.83
  209.126.9.161
  209.127.120.125
-209.127.167.243
  209.127.18.148
  209.127.20.10
  209.127.20.106
-209.127.43.122
  209.128.84.141
  209.13.96.163
  209.13.96.164
@@ -89869,6 +84561,7 @@
  209.141.35.155
  209.141.35.68
  209.141.36.139
+209.141.36.191
  209.141.36.236
  209.141.36.67
  209.141.36.72
@@ -89879,8 +84572,8 @@
  209.141.38.148
  209.141.38.163
  209.141.38.34
+209.141.38.35
  209.141.40.203
-209.141.40.237
  209.141.40.252
  209.141.40.4
  209.141.40.46
@@ -89892,7 +84585,6 @@
  209.141.42.182
  209.141.43.187
  209.141.43.226
-209.141.43.35
  209.141.43.66
  209.141.44.136
  209.141.45.183
@@ -89912,7 +84604,6 @@
  209.141.50.157
  209.141.50.178
  209.141.50.238
-209.141.50.78
  209.141.51.147
  209.141.51.154
  209.141.51.59
@@ -89963,13 +84654,13 @@
  209.150.146.112
  209.150.150.66
  209.150.152.198
+209.150.252.43
  209.150.60.107
  209.151.135.13
  209.151.224.239
  209.151.224.247
  209.151.235.177
  209.151.70.1
-209.159.150.53
  209.159.158.234
  209.16.78.27
  209.160.113.213
@@ -89977,9 +84668,9 @@
  209.160.40.13
  209.160.54.26
  209.160.64.61
+209.163.116.127
  209.163.160.253
  209.164.189.107
-209.169.145.14
  209.169.160.7
  209.169.161.146
  209.169.166.148
@@ -90038,15 +84729,14 @@
  209.172.57.205
  209.173.28.144
  209.177.86.18
+209.177.86.21
  209.177.86.22
  209.177.95.34
  209.180.103.52
  209.181.137.169
-209.181.233.7
  209.182.202.96
  209.182.219.176
  209.182.219.37
-209.182.237.202
  209.182.243.113
  209.188.18.220
  209.188.18.44
@@ -90064,12 +84754,12 @@
  209.192.78.54
  209.194.163.115
  209.194.236.25
-209.195.124.216
  209.197.16.155
  209.197.16.167
-209.197.16.175
-209.197.26.81
+209.197.16.168
+209.197.26.117
  209.197.26.93
+209.197.26.98
  209.198.180.142
  209.20.64.41
  209.200.15.168
@@ -90081,7 +84771,6 @@
  209.200.44.215
  209.200.5.4
  209.203.22.217
-209.203.50.162
  209.205.112.34
  209.205.200.13
  209.208.72.217
@@ -90091,7 +84780,6 @@
  209.212.208.255
  209.212.214.188
  209.212.214.89
-209.212.218.161
  209.212.219.211
  209.212.219.39
  209.212.221.103
@@ -90124,6 +84812,7 @@
  209.222.101.234
  209.222.101.251
  209.222.117.37
+209.222.186.64
  209.222.21.41
  209.222.97.105
  209.23.122.132
@@ -90139,8 +84828,6 @@
  209.236.75.4
  209.237.87.177
  209.239.112.201
-209.239.119.149
-209.239.119.152
  209.239.119.219
  209.240.35.141
  209.242.216.125
@@ -90177,13 +84864,13 @@
  209.250.253.49
  209.250.255.60
  209.31.182.178
-209.33.242.162
  209.41.180.93
  209.41.67.169
  209.42.78.11
  209.44.101.82
  209.44.113.34
  209.44.99.194
+209.45.111.194
  209.45.48.28
  209.45.53.53
  209.45.61.108
@@ -90202,16 +84889,15 @@
  209.54.34.249
  209.54.60.159
  209.54.66.106
+209.58.129.98
  209.58.135.108
  209.58.135.79
  209.58.140.13
  209.58.149.116
  209.58.149.66
  209.58.151.147
-209.58.151.180
  209.58.151.246
  209.58.151.88
-209.58.157.228
  209.58.157.94
  209.58.180.10
  209.58.183.70
@@ -90219,6 +84905,7 @@
  209.59.110.48
  209.59.137.142
  209.59.138.182
+209.59.140.210
  209.59.141.149
  209.59.154.141
  209.59.166.114
@@ -90235,9 +84922,7 @@
  209.62.56.194
  209.65.66.239
  209.65.67.201
-209.65.68.190
  209.65.71.28
-209.65.71.3
  209.66.119.150
  209.66.128.10
  209.66.203.43
@@ -90263,7 +84948,7 @@
  209.90.77.24
  209.90.77.43
  209.91.100.241
-209.91.167.14
+209.91.140.182
  209.92.156.53
  209.92.176.24
  209.92.176.48
@@ -90277,10 +84962,7 @@
  209.97.132.186
  209.97.132.66
  209.97.133.56
-209.97.134.58
-209.97.134.82
  209.97.137.55
-209.97.138.167
  209.97.138.179
  209.97.138.189
  209.97.138.97
@@ -90299,20 +84981,16 @@
  209.97.151.195
  209.97.158.250
  209.97.159.10
-209.97.160.105
-209.97.160.145
  209.97.161.222
  209.97.162.178
  209.97.165.196
  209.97.165.231
-209.97.168.205
  209.97.168.52
  209.97.169.116
  209.97.172.220
  209.97.173.189
  209.97.174.166
  209.97.174.218
-209.97.174.90
  209.97.175.191
  209.97.175.25
  209.97.175.93
@@ -90322,20 +85000,18 @@
  209.97.177.59
  209.97.179.111
  209.97.179.21
+209.97.180.47
  209.97.182.201
  209.97.182.80
  209.97.183.120
  209.97.183.188
  209.97.186.179
  209.97.186.48
-209.97.187.236
  209.97.188.51
-209.97.189.106
  209.97.189.249
  209.97.189.48
  209.97.189.98
  209.97.190.32
-209.97.191.128
  209.97.191.190
  209.97.199.149
  209.97.212.185
@@ -90366,6 +85042,7 @@
  209.99.134.33
  209.99.134.99
  209.99.135.117
+209.99.135.126
  209.99.135.149
  209.99.135.178
  209.99.135.183
@@ -90378,29 +85055,29 @@
  209.99.15.2
  209.99.16.16
  209.99.164.140
-209.99.165.116
+209.99.165.19
  209.99.165.237
  209.99.165.69
-209.99.165.83
-209.99.168.101
-209.99.168.103
-209.99.168.112
  209.99.168.118
+209.99.168.139
  209.99.168.18
  209.99.168.185
  209.99.168.19
  209.99.168.196
  209.99.168.217
-209.99.168.228
  209.99.168.234
  209.99.168.40
-209.99.168.57
+209.99.168.41
+209.99.168.47
+209.99.168.85
+209.99.168.9
  209.99.168.91
-209.99.173.173
-209.99.173.215
  209.99.173.239
+209.99.174.163
+209.99.174.217
  209.99.175.207
  209.99.175.248
+209.99.175.95
  2091465280215.org
  2095169429.jclecardinal.com
  2095371-dot-oaao-274308.uc.r.appspot.com
@@ -90434,7 +85111,7 @@
  210.10.208.238
  210.10.220.54
  210.100.149.193
-210.100.200.167
+210.100.179.91
  210.100.210.241
  210.100.232.15
  210.100.235.112
@@ -90454,13 +85131,13 @@
  210.108.102.112
  210.109.108.186
  210.11.178.95
-210.110.1.27
-210.111.171.188
  210.112.121.14
  210.112.121.225
  210.112.232.6
+210.112.29.186
+210.112.50.207
+210.112.95.223
  210.113.121.41
-210.113.7.61
  210.114.1.172
  210.114.10.31
  210.114.17.198
@@ -90495,12 +85172,13 @@
  210.121.236.84
  210.121.5.40
  210.122.88.38
+210.123.110.152
  210.123.50.203
  210.124.127.73
+210.124.131.41
  210.124.149.19
  210.126.110.182
  210.126.15.26
-210.126.5.91
  210.127.208.43
  210.127.209.27
  210.127.209.30
@@ -90510,12 +85188,10 @@
  210.127.86.247
  210.13.110.60
  210.13.110.61
-210.13.111.26
  210.13.210.59
  210.13.53.203
  210.13.93.59
  210.14.130.9
-210.14.131.168
  210.14.132.24
  210.14.138.182
  210.14.142.85
@@ -90525,7 +85201,6 @@
  210.14.69.246
  210.14.69.69
  210.14.69.76
-210.14.77.102
  210.14.77.39
  210.14.77.48
  210.140.10.24
@@ -90545,22 +85220,21 @@
  210.153.27.14
  210.16.100.8
  210.16.101.36
+210.16.102.187
  210.16.102.68
-210.16.113.99
  210.16.115.250
  210.16.187.206
  210.16.187.29
-210.16.188.124
  210.16.189.181
  210.16.189.19
-210.16.189.248
+210.16.189.4
  210.16.84.102
  210.16.84.182
  210.16.85.134
  210.16.85.142
  210.16.85.98
+210.16.88.139
  210.166.214.192
-210.166.230.64
  210.171.150.205
  210.172.87.226
  210.177.164.45
@@ -90584,14 +85258,12 @@
  210.18.181.64
  210.182.101.144
  210.182.148.126
-210.182.148.85
  210.182.189.215
+210.183.102.85
  210.183.193.126
  210.183.21.48
-210.183.46.232
+210.183.22.225
  210.183.94.137
-210.185.104.158
-210.185.105.215
  210.186.105.71
  210.186.12.177
  210.186.143.23
@@ -90637,7 +85309,6 @@
  210.201.2.54
  210.204.127.20
  210.204.171.204
-210.205.31.93
  210.205.6.107
  210.205.6.171
  210.205.6.233
@@ -90657,25 +85328,21 @@
  210.209.244.76
  210.209.68.200
  210.209.72.232
-210.209.81.228
  210.209.89.74
  210.209.93.90
  210.21.221.156
  210.21.226.2
  210.210.110.124
+210.210.117.90
  210.210.130.139
  210.210.136.147
-210.210.137.34
-210.210.158.82
-210.210.168.98
-210.210.255.7
  210.211.101.194
  210.211.107.3
  210.211.111.85
  210.211.116.204
  210.211.116.29
  210.211.116.80
-210.211.119.10
+210.211.117.135
  210.211.126.19
  210.211.67.80
  210.211.68.196
@@ -90695,8 +85362,8 @@
  210.213.127.206
  210.213.146.195
  210.213.244.54
+210.216.152.122
  210.216.153.142
-210.216.21.144
  210.216.21.205
  210.216.21.96
  210.216.21.99
@@ -90704,32 +85371,28 @@
  210.219.173.21
  210.22.5.117
  210.22.77.70
-210.22.78.74
-210.22.94.42
  210.220.150.170
  210.221.154.117
  210.222.174.17
  210.222.183.192
  210.222.197.211
+210.222.200.72
  210.222.86.19
  210.223.141.74
  210.223.173.201
  210.223.186.182
-210.223.191.72
  210.228.105.129
-210.235.58.128
  210.240.163.95
  210.242.250.37
  210.242.28.15
  210.242.28.21
-210.242.67.223
  210.243.27.42
  210.243.27.43
  210.244.127.110
+210.245.12.98
  210.245.121.118
  210.245.32.137
  210.245.32.158
-210.245.34.243
  210.245.36.90
  210.245.48.88
  210.245.51.1
@@ -90758,6 +85421,7 @@
  210.246.240.42
  210.246.243.70
  210.246.45.212
+210.246.53.237
  210.251.213.165
  210.251.214.133
  210.255.240.125
@@ -90773,7 +85437,9 @@
  210.3.244.34
  210.36.46.225
  210.4.114.122
+210.4.152.139
  210.4.66.139
+210.4.95.242
  210.4.96.73
  210.4.97.107
  210.43.47.18
@@ -90791,7 +85457,6 @@
  210.45.172.3
  210.45.172.5
  210.45.172.51
-210.45.172.7
  210.45.174.3
  210.45.174.4
  210.45.175.7
@@ -90808,6 +85473,7 @@
  210.5.116.182
  210.5.151.232
  210.5.155.130
+210.5.155.142
  210.5.172.6
  210.5.85.150
  210.50.8.102
@@ -90847,7 +85513,6 @@
  210.59.209.174
  210.59.98.106
  210.6.140.155
-210.6.148.211
  210.6.150.234
  210.6.176.82
  210.6.29.177
@@ -90855,10 +85520,12 @@
  210.61.156.128
  210.61.176.145
  210.61.216.66
+210.61.47.79
  210.61.49.84
  210.62.186.212
  210.64.103.139
  210.64.214.91
+210.65.47.133
  210.66.100.173
  210.66.115.238
  210.66.135.132
@@ -90878,7 +85545,6 @@
  210.75.240.13
  210.76.64.46
  210.76.9.1
-210.77.127.169
  210.86.239.186
  210.89.176.166
  210.9.47.154
@@ -90888,24 +85554,19 @@
  210.91.206.200
  210.91.221.98
  210.91.36.163
-210.91.49.223
  210.92.18.118
  210.92.18.165
  210.92.18.167
-210.92.18.170
+210.92.18.172
  210.92.18.25
  210.94.133.243
  210.94.99.137
  210.96.4.50
  210.97.100.175
  210.97.192.120
-210.97.40.36
-210.97.40.44
-210.97.76.156
  210.97.95.43
  210.99.116.249
  210.99.127.118
-210.99.216.205
  210.99.220.2
  210.99.220.214
  210.99.220.247
@@ -90923,6 +85584,8 @@
  210.99.242.233
  210.99.242.69
  210.99.242.72
+210.99.29.169
+210.99.89.25
  210676-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  2109f.com
  210sadivorce.com
@@ -90934,21 +85597,17 @@
  211.103.11.132
  211.103.110.137
  211.103.121.185
-211.103.138.99
  211.103.158.189
  211.103.172.114
-211.103.183.3
  211.103.208.76
  211.103.212.50
  211.103.213.45
-211.103.222.147
  211.103.222.34
  211.103.237.82
  211.103.4.100
  211.103.4.5
  211.104.146.238
  211.104.160.202
-211.104.171.239
  211.104.217.42
  211.104.217.84
  211.104.242.52
@@ -90965,10 +85624,10 @@
  211.105.40.71
  211.106.11.193
  211.106.241.42
-211.107.12.63
  211.107.138.212
  211.107.14.12
  211.107.151.26
+211.107.175.215
  211.107.3.84
  211.107.4.221
  211.108.168.106
@@ -90976,7 +85635,6 @@
  211.108.69.103
  211.109.11.227
  211.110.125.62
-211.110.126.92
  211.110.211.6
  211.110.229.161
  211.110.66.179
@@ -90985,7 +85643,6 @@
  211.112.103.38
  211.112.103.52
  211.112.104.51
-211.112.125.12
  211.112.18.37
  211.112.187.197
  211.112.205.57
@@ -90995,11 +85652,11 @@
  211.114.185.90
  211.114.199.7
  211.114.48.139
+211.114.69.96
  211.115.110.64
  211.115.212.166
  211.115.213.103
  211.115.213.42
-211.115.254.51
  211.115.32.22
  211.115.89.97
  211.116.110.239
@@ -91014,8 +85671,6 @@
  211.116.220.43
  211.116.220.68
  211.116.220.77
-211.116.234.149
-211.117.142.155
  211.117.167.178
  211.117.60.11
  211.118.226.133
@@ -91023,7 +85678,6 @@
  211.121.191.53
  211.129.201.111
  211.136.100.154
-211.136.217.120
  211.137.225.102
  211.137.225.116
  211.137.225.120
@@ -91065,7 +85719,6 @@
  211.140.94.23
  211.140.94.26
  211.140.94.27
-211.141.113.12
  211.141.200.175
  211.141.234.16
  211.141.41.210
@@ -91096,11 +85749,8 @@
  211.144.68.30
  211.144.69.249
  211.144.96.41
-211.145.38.73
  211.145.47.192
-211.145.49.253
  211.147.133.66
-211.147.216.19
  211.147.230.9
  211.147.251.157
  211.147.74.231
@@ -91109,7 +85759,6 @@
  211.149.202.94
  211.150.95.155
  211.151.130.24
-211.151.95.139
  211.152.33.24
  211.152.47.90
  211.152.51.106
@@ -91126,7 +85775,6 @@
  211.157.153.194
  211.157.159.106
  211.157.164.14
-211.157.164.162
  211.157.166.195
  211.157.175.118
  211.157.179.168
@@ -91134,26 +85782,19 @@
  211.157.183.78
  211.157.186.110
  211.157.189.59
-211.157.2.92
-211.159.147.188
  211.159.148.181
  211.159.149.29
-211.159.150.41
  211.159.153.62
  211.159.160.173
-211.159.163.112
  211.159.165.137
  211.159.166.233
  211.159.170.194
  211.159.171.238
  211.159.171.28
-211.159.173.25
  211.159.174.88
-211.159.177.227
  211.159.183.117
  211.159.183.238
  211.159.186.152
-211.159.217.106
  211.159.218.251
  211.160.244.77
  211.161.60.21
@@ -91174,7 +85815,6 @@
  211.171.42.5
  211.172.100.207
  211.172.225.50
-211.172.246.64
  211.173.58.253
  211.174.49.229
  211.174.59.120
@@ -91183,7 +85823,6 @@
  211.178.244.95
  211.179.43.109
  211.180.175.198
-211.180.62.113
  211.183.226.177
  211.184.129.183
  211.184.131.136
@@ -91211,16 +85850,16 @@
  211.192.64.222
  211.193.184.102
  211.193.31.52
-211.193.58.225
  211.193.60.137
  211.193.90.51
  211.194.183.51
  211.194.24.64
-211.194.25.103
  211.194.254.122
  211.195.112.92
  211.195.135.231
  211.195.159.19
+211.195.162.174
+211.195.187.17
  211.195.201.61
  211.195.213.101
  211.195.221.105
@@ -91234,9 +85873,11 @@
  211.197.238.7
  211.197.242.100
  211.197.89.81
+211.198.177.18
  211.198.180.137
  211.198.184.230
  211.198.205.74
+211.198.209.51
  211.198.212.193
  211.198.212.196
  211.198.212.227
@@ -91244,31 +85885,33 @@
  211.198.215.123
  211.198.240.52
  211.198.247.122
+211.198.255.186
  211.198.35.138
  211.198.90.77bin.sh
+211.198.92.207
+211.199.131.225
  211.199.147.75
  211.199.153.194
+211.199.166.171
  211.199.233.146
  211.199.65.180
-211.199.98.210
  211.2.186.40
  211.20.1.233
  211.20.102.253
  211.20.123.130
  211.20.145.202
  211.20.145.204
-211.20.146.148
  211.20.151.172
  211.20.176.82
  211.20.181.113
  211.20.203.119
  211.20.222.157
  211.20.238.33
+211.20.253.201
  211.20.254.167
  211.20.26.61
  211.20.90.138
  211.200.160.239
-211.202.147.26
  211.202.2.220
  211.202.225.83
  211.202.48.120
@@ -91281,35 +85924,28 @@
  211.205.237.53
  211.206.120.187
  211.206.124.179
-211.206.180.106
  211.206.189.122
  211.206.189.69
  211.206.214.86
-211.208.225.110
  211.21.104.173
  211.21.120.163
-211.21.133.2
-211.21.148.137
  211.21.182.18
  211.21.19.83
  211.21.193.185
-211.21.23.46
  211.21.23.8
  211.21.65.13
  211.21.92.211
  211.21.93.238
  211.210.15.240
-211.210.154.3
  211.210.161.162
-211.210.161.169
  211.210.219.71
  211.210.3.214
  211.210.66.179
-211.211.184.191
  211.212.128.53
  211.212.204.200
  211.212.237.221
  211.214.161.205
+211.216.126.54
  211.216.154.133
  211.217.33.236
  211.218.105.101
@@ -91323,10 +85959,12 @@
  211.218.212.96
  211.218.245.66
  211.218.253.101
+211.218.254.25
  211.219.18.186
  211.219.224.88
  211.219.233.94
  211.219.246.119
+211.219.253.89
  211.219.92.201
  211.22.107.150
  211.22.131.61
@@ -91341,13 +85979,15 @@
  211.22.236.44
  211.220.195.71
  211.220.27.191
+211.220.36.187
  211.220.53.68
  211.220.63.148
  211.220.80.50
  211.220.81.199
+211.220.88.10
  211.221.1.29
+211.221.18.194
  211.221.191.244
-211.221.32.118
  211.221.39.182
  211.222.143.220
  211.222.216.220
@@ -91364,6 +86004,7 @@
  211.223.205.250
  211.223.27.47
  211.223.52.202
+211.223.72.126
  211.223.95.214
  211.224.10.169
  211.224.127.134
@@ -91389,12 +86030,15 @@
  211.227.146.17
  211.227.153.64
  211.227.167.59
+211.227.214.44
  211.227.66.183
+211.228.194.78
  211.228.195.135
  211.228.218.88
  211.228.83.184
  211.229.0.217
  211.229.107.60
+211.229.139.87
  211.229.146.245
  211.229.165.149
  211.229.19.45
@@ -91402,12 +86046,11 @@
  211.229.221.69
  211.229.226.177
  211.229.236.149
+211.229.238.31
  211.229.30.62
  211.229.59.98
  211.229.9.230
-211.23.119.241
  211.23.125.55
-211.23.125.95
  211.23.139.126
  211.23.142.13
  211.23.149.7
@@ -91418,6 +86061,7 @@
  211.23.164.89
  211.23.248.23
  211.23.31.85
+211.23.45.39
  211.23.45.46
  211.23.57.32
  211.23.78.33
@@ -91427,14 +86071,18 @@
  211.230.112.207
  211.230.112.213
  211.230.112.217
+211.230.143.174
  211.230.156.161
  211.230.164.89
+211.230.193.30
  211.230.204.193
  211.230.209.13
  211.230.212.15
+211.230.37.102
  211.230.55.213
  211.230.71.151
  211.231.72.94
+211.231.75.58
  211.232.235.250
  211.233.11.27
  211.233.38.165
@@ -91450,16 +86098,15 @@
  211.235.51.43
  211.235.59.43
  211.235.62.22
-211.235.62.229
  211.236.157.57
  211.236.43.200
  211.237.114.96
  211.237.120.13
  211.237.165.174
-211.237.245.64
  211.237.246.125
  211.237.246.137
  211.237.246.214
+211.237.249.27
  211.237.27.5
  211.238.11.7
  211.238.147.196
@@ -91476,17 +86123,12 @@
  211.238.86.151
  211.238.95.26
  211.239.124.233
-211.239.124.243
-211.239.124.246
-211.239.170.96
-211.24.100.128
  211.24.105.19
  211.24.114.199
  211.24.114.56
  211.24.241.242
  211.24.28.202
  211.24.67.155
-211.24.68.170
  211.24.73.223
  211.24.8.49
  211.24.85.234
@@ -91497,9 +86139,9 @@
  211.244.168.32
  211.245.106.41
  211.245.120.122
+211.246.191.224
  211.246.253.30
  211.247.23.29
-211.247.42.51
  211.247.55.227
  211.248.146.209
  211.248.17.76
@@ -91508,33 +86150,31 @@
  211.248.241.236
  211.248.84.40
  211.25.101.131
-211.25.119.131
  211.250.159.99
  211.250.198.109
  211.250.233.150
-211.250.243.131
+211.250.239.87
  211.250.25.55
+211.250.42.101
  211.250.72.142
  211.250.9.142
  211.251.235.65
-211.251.246.185
  211.251.250.7
  211.252.161.41
  211.252.166.168
  211.252.168.35
  211.252.87.42
-211.252.87.90
-211.252.87.97
  211.252.93.220
  211.253.10.96
+211.253.124.37
  211.253.124.69
  211.253.129.225
  211.253.133.48
-211.253.24.102
  211.253.24.250
  211.253.26.117
  211.253.27.146
  211.253.9.160
+211.254.123.17
  211.254.215.197
  211.255.23.1
  211.255.32.134
@@ -91567,7 +86207,6 @@
  211.34.168.15
  211.34.168.152
  211.34.168.240
-211.34.168.26
  211.34.168.62
  211.34.177.116
  211.34.177.192
@@ -91579,6 +86218,7 @@
  211.34.178.182
  211.34.178.34
  211.34.37.86
+211.35.168.40
  211.35.227.204
  211.35.66.57
  211.35.66.61
@@ -91590,15 +86230,14 @@
  211.35.73.190
  211.35.73.254
  211.35.73.30
-211.35.76.241
  211.35.77.126
  211.35.77.62
  211.35.78.206
  211.37.0.247
  211.38.132.36
-211.38.132.37
  211.38.17.227
  211.38.193.69
+211.38.200.161
  211.38.210.213
  211.38.99.12
  211.39.130.176
@@ -91608,16 +86247,16 @@
  211.40.48.105
  211.40.53.149
  211.40.68.132
-211.41.100.89
+211.41.128.107
  211.41.199.134
  211.41.201.212
  211.41.201.57
  211.41.202.2
  211.41.212.37
-211.43.13.243
  211.43.170.108
  211.43.170.3
  211.43.174.129
+211.43.174.19
  211.43.196.32
  211.43.206.220
  211.43.8.168
@@ -91632,15 +86271,16 @@
  211.47.118.102
  211.47.237.17
  211.47.69.153
-211.47.96.62
  211.47.97.64
  211.47.99.123
  211.47.99.228
  211.48.121.149
  211.48.139.39
  211.48.140.245
+211.48.197.80
  211.48.20.244
  211.48.215.219
+211.48.49.135
  211.48.90.28
  211.48.90.28bin.sh
  211.49.225.146
@@ -91659,6 +86299,7 @@
  211.54.182.231
  211.54.200.62
  211.54.255.75
+211.54.43.96
  211.54.54.119
  211.54.66.79
  211.55.111.172
@@ -91675,22 +86316,16 @@
  211.57.28.108
  211.57.31.133
  211.57.93.49
-211.58.123.59
-211.58.123.62
  211.60.189.111
  211.63.170.102
  211.63.170.219
-211.63.170.28
  211.63.252.34
  211.63.60.50
  211.63.71.72
  211.65.107.179
  211.67.55.116
-211.68.122.120
-211.68.68.5
  211.70.159.30
  211.72.111.91
-211.72.117.101
  211.72.117.33
  211.72.126.199
  211.72.136.110
@@ -91711,12 +86346,10 @@
  211.75.132.61
  211.75.14.26
  211.75.157.61
-211.75.163.219
  211.75.177.197
  211.75.195.61
  211.75.217.242
  211.75.220.240
-211.75.236.230
  211.75.55.8
  211.75.76.138
  211.76.33.100
@@ -91724,9 +86357,6 @@
  211.76.37.3
  211.76.72.123
  211.76.91.227
-211.78.92.47
-211.80.102.185
-211.80.102.186
  211.80.102.187
  211.80.102.189
  211.84.226.2
@@ -91736,7 +86366,6 @@
  211.87.126.178
  211.87.4.207
  211.90.246.115
-211.90.39.118
  211.90.93.204
  211.91.180.70
  211.91.56.176
@@ -91752,7 +86381,6 @@
  211740640418593-dot-wetransfer-auth-file-341.appspot.com
  212.0.149.70
  212.0.149.75
-212.1.123.62
  212.1.210.170
  212.1.71.129
  212.1.71.130
@@ -91760,12 +86388,11 @@
  212.1.97.254
  212.100.253.201
  212.102.118.90
-212.102.33.44
  212.102.35.101
-212.102.35.103
  212.102.35.104
  212.102.35.40
  212.102.36.166
+212.102.37.192
  212.102.49.251
  212.102.53.129
  212.102.57.17
@@ -91781,9 +86408,6 @@
  212.103.61.78
  212.103.61.80
  212.103.61.84
-212.103.61.99
-212.106.42.182
-212.107.144.216
  212.107.200.222
  212.107.237.28
  212.107.238.101
@@ -91799,13 +86423,11 @@
  212.109.213.12
  212.109.223.6
  212.109.39.180
-212.110.128.210
  212.110.20.141
  212.111.201.81
  212.111.40.56
  212.111.43.36
  212.112.113.235
-212.112.115.234
  212.112.124.123
  212.112.97.27
  212.113.233.0
@@ -91814,11 +86436,11 @@
  212.114.52.21
  212.114.52.233
  212.114.98.66
+212.115.108.153
  212.115.108.181
  212.115.232.79
  212.115.49.229
  212.115.49.239
-212.115.51.179
  212.115.51.203
  212.115.51.210
  212.115.51.217
@@ -91831,15 +86453,14 @@
  212.117.19.215
  212.118.24.10
  212.118.30.2
+212.118.5.38
  212.119.190.162
  212.119.226.86
  212.119.241.46
  212.119.40.11
-212.119.40.128
  212.119.40.129
  212.119.40.134
  212.119.40.158
-212.119.40.204
  212.119.40.243
  212.119.40.251
  212.119.40.36
@@ -91847,9 +86468,9 @@
  212.119.40.73
  212.119.41.111
  212.119.41.116
+212.119.41.126
  212.119.41.131
  212.119.41.133
-212.119.41.144
  212.119.41.16
  212.119.41.172
  212.119.41.188
@@ -91860,7 +86481,10 @@
  212.119.41.58
  212.119.41.76
  212.119.41.84
+212.119.44.46
  212.119.44.80
+212.119.44.99
+212.119.45.157
  212.119.45.245
  212.119.46.113
  212.119.46.120
@@ -91872,11 +86496,8 @@
  212.12.61.69
  212.122.184.247
  212.122.187.209
-212.122.48.173
  212.122.86.105
-212.123.21.34
  212.123.238.12
-212.123.95.131
  212.124.114.242
  212.124.160.4
  212.124.182.144
@@ -91892,9 +86513,7 @@
  212.124.6.181
  212.124.6.184
  212.124.6.189
-212.124.6.19
  212.124.6.198
-212.124.6.240
  212.124.6.249
  212.124.6.253
  212.124.6.5
@@ -91930,22 +86549,16 @@
  212.129.1.25
  212.129.13.135
  212.129.13.172
-212.129.142.120
  212.129.144.231
-212.129.149.80
  212.129.152.148
  212.129.152.27
  212.129.16.22
-212.129.16.53
  212.129.2.210
  212.129.21.59
-212.129.23.78
  212.129.24.79
  212.129.242.171
-212.129.245.105
  212.129.245.90
  212.129.246.52
-212.129.25.14
  212.129.25.23
  212.129.252.65
  212.129.255.21
@@ -91955,17 +86568,14 @@
  212.129.29.208
  212.129.29.229
  212.129.34.117
-212.129.35.183
  212.129.35.213
  212.129.35.47
  212.129.35.67
  212.129.36.238
  212.129.37.201
-212.129.38.177
  212.129.41.207
  212.129.41.9
  212.129.42.163
-212.129.45.220
  212.129.47.122
  212.129.47.208
  212.129.48.175
@@ -91973,11 +86583,8 @@
  212.129.52.198
  212.129.53.247
  212.129.55.0
-212.129.57.201
  212.129.59.123
  212.129.59.7
-212.129.60.144
-212.129.60.77
  212.129.7.101
  212.129.7.17
  212.129.7.177
@@ -91985,7 +86592,6 @@
  212.129.9.187
  212.129.9.233
  212.13.112.117
-212.13.131.220
  212.13.49.186
  212.130.102.221
  212.133.197.126
@@ -92045,19 +86651,15 @@
  212.158.160.217
  212.158.163.67
  212.158.167.98
-212.159.100.58
  212.159.128.72
  212.159.52.244
  212.159.61.155
  212.16.104.33
  212.16.142.92
  212.16.70.196
-212.16.77.201
  212.160.90.34
  212.162.14.222
  212.162.151.144
-212.164.219.146
-212.164.38.154
  212.164.39.98
  212.166.68.146
  212.17.102.75
@@ -92100,10 +86702,10 @@
  212.19.21.24
  212.19.23.204
  212.197.150.175
-212.198.188.217
  212.199.182.20
  212.199.61.51
  212.2.5.120
+212.20.56.138
  212.20.73.70
  212.200.118.98
  212.200.146.50
@@ -92125,6 +86727,7 @@
  212.21.136.181
  212.21.136.93
  212.21.66.6
+212.217.113.11
  212.217.118.100
  212.217.118.99
  212.22.70.65
@@ -92152,10 +86755,11 @@
  212.231.185.82
  212.231.188.46
  212.231.216.2
-212.232.53.35
+212.233.109.70
  212.233.130.198
  212.233.132.178
  212.233.132.33
+212.233.153.22
  212.233.164.252
  212.233.175.118
  212.233.200.143
@@ -92168,7 +86772,6 @@
  212.235.114.85
  212.235.5.188
  212.235.53.129
-212.237.0.10
  212.237.0.244
  212.237.10.57
  212.237.100.181
@@ -92187,17 +86790,12 @@
  212.237.34.224
  212.237.36.191
  212.237.36.83
-212.237.37.205
  212.237.38.148
-212.237.38.79
  212.237.46.77
  212.237.49.211
  212.237.51.43
  212.237.53.82
  212.237.54.93
-212.237.56.214
-212.237.57.252
-212.237.60.187
  212.237.7.173
  212.237.96.98
  212.24.148.234
@@ -92205,7 +86803,6 @@
  212.241.14.104
  212.241.70.213
  212.244.23.122
-212.244.23.42
  212.247.113.115
  212.247.59.121
  212.25.25.41
@@ -92218,8 +86815,6 @@
  212.251.48.70
  212.251.7.4
  212.251.95.73
-212.252.106.196
-212.252.119.75
  212.252.134.107
  212.252.63.247
  212.253.125.253
@@ -92231,7 +86826,6 @@
  212.253.94.254
  212.26.136.212
  212.26.236.102
-212.26.236.112
  212.26.236.129
  212.26.236.136
  212.26.236.157
@@ -92243,8 +86837,6 @@
  212.26.236.38
  212.26.236.40
  212.26.236.47
-212.26.236.58
-212.26.236.86
  212.26.248.156
  212.26.249.138
  212.28.71.86
@@ -92267,7 +86859,6 @@
  212.32.231.161
  212.32.233.237
  212.33.129.166
-212.33.194.107
  212.33.198.51
  212.33.199.190
  212.33.199.197
@@ -92279,11 +86870,11 @@
  212.33.28.50
  212.34.144.12
  212.34.15.65
-212.34.22.174
  212.34.225.118
  212.34.238.164
  212.34.239.253
  212.34.24.201
+212.34.4.98
  212.34.8.226
  212.35.69.38
  212.37.27.58
@@ -92306,7 +86897,6 @@
  212.42.99.32
  212.43.99.2
  212.45.80.112
-212.46.18.135
  212.46.18.158
  212.46.255.78
  212.47.220.165
@@ -92316,14 +86906,12 @@
  212.47.231.221
  212.47.231.31
  212.47.232.242
-212.47.233.253
  212.47.233.68
  212.47.234.231
  212.47.234.78
  212.47.234.85
  212.47.234.93
  212.47.236.238
-212.47.237.75
  212.47.238.115
  212.47.238.193
  212.47.238.207
@@ -92341,10 +86929,8 @@
  212.47.247.88
  212.47.248.81
  212.47.249.80
-212.47.251.195
  212.47.251.79
  212.47.252.143
-212.47.253.99
  212.48.159.7
  212.48.251.21
  212.48.66.92
@@ -92373,7 +86959,6 @@
  212.51.159.132
  212.54.116.100
  212.55.181.78
-212.55.28.30
  212.56.152.151
  212.56.194.238
  212.56.202.198
@@ -92392,10 +86977,9 @@
  212.60.21.95
  212.60.5.220
  212.60.5.92
-212.60.64.220
  212.62.49.110
  212.63.206.39
-212.64.0.99
+212.64.0.75
  212.64.1.170
  212.64.102.106
  212.64.111.18
@@ -92403,16 +86987,12 @@
  212.64.13.147
  212.64.14.101
  212.64.14.185
-212.64.16.31
-212.64.19.123
-212.64.19.237
  212.64.198.41
  212.64.221.102
  212.64.23.30
  212.64.25.141
  212.64.27.53
  212.64.29.136
-212.64.3.40
  212.64.33.244
  212.64.36.88
  212.64.39.90
@@ -92422,10 +87002,7 @@
  212.64.43.52
  212.64.5.28
  212.64.53.252
-212.64.54.167
-212.64.54.49
  212.64.55.229
-212.64.59.227
  212.64.60.187
  212.64.60.50
  212.64.61.224
@@ -92453,12 +87030,10 @@
  212.64.8.10
  212.64.80.169
  212.64.86.16
-212.64.88.97
  212.64.91.105
  212.64.91.114
  212.64.93.138
  212.64.95.187
-212.64.95.2
  212.66.152.231
  212.67.0.150
  212.67.205.246
@@ -92467,19 +87042,23 @@
  212.69.166.122
  212.69.19.223
  212.69.218.47
-212.69.22.119
  212.69.22.127
+212.69.22.208
+212.69.22.210
  212.69.22.218
  212.69.22.221
-212.69.22.232
  212.69.22.233
+212.69.22.50
+212.69.22.58
+212.69.22.84
  212.69.24.158
  212.69.24.178
  212.69.24.202
+212.69.24.58
  212.69.27.102
-212.69.27.48
+212.69.27.19
+212.69.27.98
  212.7.20.104
-212.70.149.0
  212.70.149.21
  212.70.149.37
  212.70.149.5
@@ -92503,19 +87082,15 @@
  212.72.47.218
  212.73.128.194
  212.73.131.30
-212.73.136.71
-212.73.136.72
  212.73.150.21
+212.73.45.15
  212.73.68.142
  212.73.68.162
  212.73.69.6
  212.73.81.242
-212.73.90.82
-212.73.90.86
  212.75.26.171
  212.76.185.92
  212.77.138.155
-212.77.138.161
  212.77.214.52
  212.77.43.160
  212.79.169.50
@@ -92531,10 +87106,7 @@
  212.83.128.152
  212.83.129.11
  212.83.129.80
-212.83.130.62
-212.83.130.88
  212.83.130.99
-212.83.131.135
  212.83.133.41
  212.83.133.63
  212.83.134.226
@@ -92545,19 +87117,19 @@
  212.83.141.237
  212.83.142.33
  212.83.144.11
+212.83.146.182
+212.83.148.8
  212.83.150.172
  212.83.152.183
-212.83.157.111
  212.83.157.81
  212.83.158.105
  212.83.161.110
-212.83.165.14
+212.83.163.230
  212.83.166.62
  212.83.167.190
  212.83.167.87
  212.83.168.97
  212.83.169.24
-212.83.169.52
  212.83.169.71
  212.83.170.121
  212.83.170.57
@@ -92575,17 +87147,15 @@
  212.83.181.201
  212.83.182.10
  212.83.183.33
-212.83.183.57
  212.83.185.93
-212.83.186.26
  212.83.188.158
  212.83.188.161
+212.83.188.82
  212.83.189.95
  212.83.35.11
  212.83.35.173
  212.83.40.238
  212.83.40.239
-212.83.56.182
  212.83.58.207
  212.83.58.213
  212.83.58.215
@@ -92602,11 +87172,8 @@
  212.87.169.49
  212.87.172.113
  212.87.200.88
-212.87.243.60
  212.87.243.68
-212.89.13.137
  212.89.173.216
-212.89.188.115
  212.9.185.194
  212.90.166.34
  212.90.167.90
@@ -92633,7 +87200,6 @@
  212.94.8.41
  212.95.110.30
  212.95.137.19
-212.95.137.50
  212.95.146.3
  212.95.150.46
  212.95.152.141
@@ -92641,24 +87207,22 @@
  212.95.152.251
  212.95.175.140
  212.95.175.226
-212.95.180.50
  212.95.41.41
  212.96.34.143
+212.97.48.5
  212.98.122.91
  212.98.171.75
  212.98.171.91
-212.98.184.2
+212.98.190.22
  212.98.97.152
  212.99.226.35
  2122159.cloudcommercepro.com
-213.0.69.74
  213.0.86.62
  213.0.87.120
  213.10.100.182
  213.10.181.49
  213.100.170.137
  213.100.172.244
-213.100.212.187
  213.100.219.99
  213.100.252.255
  213.101.151.4
@@ -92677,15 +87241,13 @@
  213.108.1.176
  213.108.1.195
  213.108.1.251
-213.108.1.63
  213.108.1.65
  213.108.1.94
  213.108.117.90
+213.108.134.182
  213.108.134.191
-213.108.162.108
  213.108.18.34
  213.108.196.20
-213.108.2.105
  213.108.2.133
  213.108.2.218
  213.108.200.11
@@ -92714,9 +87276,7 @@
  213.113.250.106
  213.114.207.160
  213.114.231.129
-213.114.94.18
  213.115.254.197
-213.118.170.210
  213.119.79.248
  213.120.108.169
  213.123.237.152
@@ -92725,9 +87285,7 @@
  213.124.184.182
  213.125.144.146
  213.125.67.108
-213.126.12.218
  213.126.15.210
-213.127.185.216
  213.129.99.10
  213.130.206.240
  213.131.247.180
@@ -92737,10 +87295,8 @@
  213.134.19.163
  213.134.192.13
  213.135.131.113
-213.135.138.212
  213.135.154.16
  213.135.154.63
-213.135.155.133
  213.135.156.112
  213.135.156.240
  213.135.158.148
@@ -92763,7 +87319,7 @@
  213.136.76.46
  213.136.77.103
  213.136.78.113
-213.136.83.212
+213.136.79.123
  213.136.83.223
  213.136.86.218
  213.136.87.165
@@ -92775,7 +87331,6 @@
  213.138.77.238
  213.138.78.150
  213.139.206.50
-213.139.212.10
  213.139.212.154
  213.139.58.237
  213.14.112.92
@@ -92811,7 +87366,6 @@
  213.145.110.75
  213.145.137.102
  213.145.5.146
-213.145.99.194
  213.147.107.58
  213.147.97.225
  213.148.137.23
@@ -92824,10 +87378,9 @@
  213.149.187.118
  213.149.187.163
  213.149.190.193
-213.150.201.59
-213.150.206.88
  213.152.106.56
  213.152.161.101
+213.152.161.165
  213.152.161.40
  213.152.176.162
  213.153.155.96
@@ -92836,13 +87389,11 @@
  213.154.19.42
  213.154.22.216
  213.154.229.27
-213.154.245.251
  213.154.3.102
  213.154.70.102
  213.155.116.179
  213.155.3.216
  213.157.50.82
-213.158.10.101
  213.158.29.179
  213.159.38.90
  213.159.59.41
@@ -92857,7 +87408,6 @@
  213.162.112.80
  213.162.22.190
  213.162.241.237
-213.163.113.5
  213.163.120.226
  213.163.181.33
  213.163.73.106
@@ -92875,7 +87425,6 @@
  213.165.246.66
  213.166.152.12
  213.166.69.147
-213.166.76.133
  213.166.76.170
  213.166.76.20
  213.166.76.220
@@ -92888,23 +87437,19 @@
  213.166.77.106
  213.166.77.11
  213.166.77.118
-213.166.77.128
  213.166.77.138
  213.166.77.151
  213.166.77.161
  213.166.77.192
-213.166.77.229
  213.166.77.253
  213.166.77.30
  213.166.77.43
  213.166.77.52
-213.166.77.62
  213.166.78.162
  213.166.78.18
  213.166.78.214
  213.166.78.237
  213.166.78.40
-213.166.78.76
  213.166.78.88
  213.166.79.100
  213.166.79.13
@@ -92913,15 +87458,11 @@
  213.166.79.161
  213.166.79.167
  213.166.79.17
-213.166.79.189
-213.166.79.191
  213.166.79.226
  213.166.79.235
-213.166.79.247
  213.166.79.85
  213.166.79.90
  213.166.79.98
-213.167.206.132
  213.167.215.70
  213.167.217.35
  213.167.221.148
@@ -92930,7 +87471,6 @@
  213.168.210.76
  213.168.250.126
  213.169.151.199
-213.169.39.218
  213.171.196.14
  213.171.196.79
  213.171.225.234
@@ -92938,12 +87478,12 @@
  213.171.37.45
  213.171.46.182
  213.171.50.48
-213.171.53.158
  213.171.58.162
  213.172.40.21
  213.172.49.129
  213.172.91.53
  213.173.80.3
+213.173.93.228
  213.174.0.72
  213.174.10.58
  213.174.123.194
@@ -92956,11 +87496,8 @@
  213.176.36.147
  213.176.36.42
  213.176.48.151
-213.176.63.139
  213.177.107.170
  213.178.155.74
-213.178.252.23
-213.178.252.27
  213.178.252.28
  213.178.252.29
  213.178.252.30
@@ -92976,7 +87513,6 @@
  213.181.195.31
  213.181.84.69
  213.182.138.224
-213.183.101.89
  213.183.107.6
  213.183.179.42
  213.183.44.17
@@ -93003,7 +87539,7 @@
  213.188.179.243
  213.188.179.245
  213.189.179.83
-213.189.219.206
+213.189.185.198
  213.189.240.136
  213.189.4.139
  213.190.100.135
@@ -93032,30 +87568,23 @@
  213.194.166.165
  213.194.168.110
  213.194.173.90
-213.194.99.235
-213.194.99.250
  213.195.106.78
  213.195.107.194
  213.195.114.156
  213.195.127.45
-213.195.60.196
  213.195.96.152
  213.195.98.68
  213.196.154.68
  213.197.182.158
  213.198.67.46
-213.199.138.254
  213.199.255.145
  213.200.174.133
  213.200.174.159
  213.200.221.94
  213.200.236.95
-213.200.31.118
  213.200.91.22
-213.202.101.114
  213.202.103.242
  213.202.103.254
-213.202.211.200
  213.202.212.78
  213.202.218.70
  213.202.222.225
@@ -93101,11 +87630,8 @@
  213.222.34.200
  213.222.47.202
  213.222.56.130
-213.225.4.229
  213.226.11.149
-213.226.113.73
  213.226.114.189
-213.226.114.41
  213.226.197.230
  213.227.154.145
  213.227.155.145
@@ -93116,12 +87642,9 @@
  213.229.125.87
  213.229.60.50
  213.229.86.240
-213.229.94.19
  213.23.12.149
-213.230.107.202
  213.230.110.154
-213.230.127.139
-213.230.127.140
+213.230.127.138
  213.230.67.32
  213.230.67.33
  213.230.69.33
@@ -93139,9 +87662,7 @@
  213.234.195.152
  213.234.197.54
  213.234.238.52
-213.234.252.110
  213.234.31.22
-213.238.180.195
  213.238.182.150
  213.238.182.163
  213.238.182.247
@@ -93174,7 +87695,6 @@
  213.24.126.143
  213.24.126.193
  213.24.126.213
-213.24.126.214
  213.24.126.217
  213.24.126.23
  213.24.126.254
@@ -93187,21 +87707,17 @@
  213.24.127.146
  213.24.127.148
  213.24.127.151
-213.24.127.161
  213.24.127.162
  213.24.127.164
  213.24.127.173
  213.24.127.18
-213.24.127.189
  213.24.127.200
  213.24.127.201
  213.24.127.205
-213.24.127.215
  213.24.127.225
  213.24.127.226
  213.24.127.231
  213.24.127.237
-213.24.127.244
  213.24.127.252
  213.24.127.27
  213.24.127.29
@@ -93225,11 +87741,9 @@
  213.24.132.225
  213.24.132.70
  213.24.132.82
-213.24.133.101
  213.24.133.124
  213.24.133.142
  213.24.133.143
-213.24.133.162
  213.24.133.166
  213.24.133.171
  213.24.133.187
@@ -93244,16 +87758,12 @@
  213.24.134.117
  213.24.134.128
  213.24.134.135
-213.24.134.156
  213.24.134.159
  213.24.134.160
  213.24.134.165
-213.24.134.19
  213.24.134.201
  213.24.134.208
  213.24.134.221
-213.24.134.227
-213.24.134.240
  213.24.134.249
  213.24.134.250
  213.24.134.33
@@ -93266,7 +87776,6 @@
  213.24.135.16
  213.24.135.168
  213.24.135.188
-213.24.135.210
  213.24.135.213
  213.24.135.224
  213.24.135.248
@@ -93277,7 +87786,6 @@
  213.24.135.55
  213.24.135.57
  213.24.135.86
-213.24.167.60
  213.240.78.205
  213.244.115.130
  213.244.123.182
@@ -93301,7 +87809,6 @@
  213.251.184.38
  213.251.185.63
  213.251.189.204
-213.251.236.97
  213.251.255.170
  213.251.40.3
  213.252.244.108
@@ -93322,10 +87829,13 @@
  213.3.25.204
  213.3.26.176
  213.30.51.82
-213.32.10.226
-213.32.105.159
+213.32.10.80
+213.32.10.81
+213.32.101.181
+213.32.101.187
+213.32.101.189
+213.32.101.190
  213.32.108.123
-213.32.11.200
  213.32.111.52
  213.32.111.53
  213.32.122.80
@@ -93358,16 +87868,14 @@
  213.32.39.43
  213.32.39.44
  213.32.39.45
+213.32.39.46
  213.32.39.47
-213.32.40.155
  213.32.46.100
  213.32.47.9
  213.32.6.132
  213.32.6.27
  213.32.63.123
  213.32.63.93
-213.32.67.160
-213.32.69.188
  213.32.71.196
  213.32.77.242
  213.32.78.219
@@ -93376,7 +87884,6 @@
  213.32.91.37
  213.32.91.71
  213.32.92.57
-213.32.93.237
  213.32.95.147
  213.33.147.219
  213.33.147.220
@@ -93391,7 +87898,6 @@
  213.35.152.198
  213.35.233.247
  213.37.205.33
-213.37.40.162
  213.37.5.133
  213.39.25.37
  213.39.51.93
@@ -93408,7 +87914,6 @@
  213.46.47.135
  213.46.85.185
  213.46.89.14
-213.47.1.88
  213.47.114.114
  213.47.148.252
  213.47.252.190
@@ -93425,18 +87930,14 @@
  213.50.195.125
  213.52.128.76
  213.52.129.250
-213.52.50.166
  213.52.74.198
-213.55.169.120
  213.55.225.138
  213.55.73.205
  213.55.77.131
  213.58.196.146
  213.58.202.70
-213.59.129.30
  213.59.135.87
  213.59.158.2
-213.59.223.225
  213.59.249.19
  213.6.10.148
  213.6.101.174
@@ -93445,6 +87946,7 @@
  213.6.118.170
  213.6.122.225
  213.6.130.133
+213.6.134.188
  213.6.141.114
  213.6.141.146
  213.6.147.138
@@ -93476,14 +87978,13 @@
  213.61.149.100
  213.61.215.54
  213.61.220.144
+213.61.89.51
  213.64.219.153
  213.64.23.118
  213.64.64.131
-213.65.156.239
  213.65.244.86
  213.65.86.154
  213.66.145.99
-213.66.159.127
  213.66.201.14
  213.67.105.156
  213.67.145.246
@@ -93539,7 +88040,6 @@
  213.86.4.51
  213.87.101.176
  213.87.202.193
-213.87.44.152
  213.89.131.35
  213.89.131.53
  213.89.176.166
@@ -93551,17 +88051,16 @@
  213.91.187.242
  213.91.202.230
  213.91.221.54
+213.91.236.37
  213.91.247.55
  213.92.109.101
  213.92.118.159
  213.92.191.122
-213.92.194.203
-213.92.204.194
  213.92.204.228
-213.92.248.119
  213.92.254.112
  213.92.254.28
  213.92.254.32
+213.93.134.79
  213.93.145.183
  213.93.215.153
  213.94.52.201
@@ -93580,9 +88079,11 @@
  215b401f60fafd39ce86a7109ac71ed0.icu
  215betasus.com
  216-information.com
+216.10.163.84
  216.10.242.97
  216.10.245.150
  216.10.247.146
+216.10.251.112
  216.104.15.130
  216.104.37.122
  216.104.40.170
@@ -93602,7 +88103,6 @@
  216.117.227.198
  216.118.128.126
  216.118.153.243
-216.118.251.2
  216.12.174.124
  216.120.237.30
  216.121.123.115
@@ -93610,11 +88110,9 @@
  216.126.107.245
  216.126.193.24
  216.126.225.148
-216.126.231.15
  216.126.239.38
  216.126.41.115
  216.126.41.89
-216.126.59.61
  216.126.74.66
  216.126.81.9
  216.126.82.39
@@ -93636,13 +88134,13 @@
  216.143.135.241
  216.144.120.16
  216.144.243.34
+216.144.248.186
  216.145.110.42
  216.145.83.161
  216.145.87.218
  216.145.88.119
  216.145.89.198
  216.146.251.8
-216.146.33.123
  216.151.130.0
  216.151.130.1
  216.151.130.10
@@ -94412,29 +88910,35 @@
  216.151.138.98
  216.151.138.99
  216.151.163.114
-216.151.180.111
-216.151.180.135
+216.151.180.105
+216.151.180.147
  216.151.180.154
+216.151.180.160
  216.151.180.165
-216.151.180.171
  216.151.180.183
  216.151.180.184
-216.151.180.225
-216.151.180.39
-216.151.180.57
+216.151.180.190
+216.151.180.238
+216.151.180.28
+216.151.180.58
  216.151.180.63
+216.151.180.75
  216.151.180.87
  216.151.180.88
  216.151.180.9
-216.151.180.93
-216.151.180.99
+216.151.180.94
  216.151.183.105
+216.151.183.112
  216.151.183.16
-216.151.183.22
-216.151.183.28
+216.151.183.3
+216.151.183.34
+216.151.183.39
+216.151.183.40
+216.151.183.45
+216.151.183.46
  216.151.183.57
-216.151.183.64
-216.151.183.81
+216.151.183.63
+216.151.183.70
  216.151.183.82
  216.151.183.88
  216.151.183.94
@@ -94959,7 +89463,6 @@
  216.155.94.51
  216.157.21.35
  216.157.27.59
-216.158.146.154
  216.158.217.2
  216.158.226.253
  216.158.232.133
@@ -94979,7 +89482,6 @@
  216.167.190.166
  216.168.195.253
  216.168.37.169
-216.169.134.154
  216.169.73.65
  216.17.109.216
  216.17.99.183
@@ -94993,7 +89495,6 @@
  216.170.120.124
  216.170.123.111
  216.170.123.13
-216.170.125.163
  216.170.126.100
  216.170.126.102
  216.170.240.98
@@ -95004,7 +89505,6 @@
  216.177.140.4
  216.177.193.90
  216.18.201.130
-216.18.204.202
  216.18.22.198
  216.18.231.50
  216.18.242.55
@@ -95041,8 +89541,6 @@
  216.189.116.247
  216.189.145.11
  216.189.146.52
-216.189.153.12
-216.189.153.176
  216.189.153.207
  216.189.153.64
  216.189.177.22
@@ -95052,9 +89550,9 @@
  216.193.128.54
  216.193.130.240
  216.194.165.98
+216.195.41.24
  216.196.140.205
  216.196.223.82
-216.198.73.116
  216.198.92.184
  216.198.92.72
  216.199.232.112
@@ -95088,7 +89586,6 @@
  216.218.245.10
  216.218.245.82
  216.218.245.9
-216.218.253.45
  216.218.254.165
  216.218.254.181
  216.218.255.35
@@ -95108,7 +89605,6 @@
  216.227.40.37
  216.229.241.250
  216.230.117.128
-216.230.229.178
  216.230.232.19
  216.231.214.102
  216.231.214.121
@@ -95126,12 +89622,9 @@
  216.231.214.89
  216.231.214.94
  216.232.223.30
-216.234.148.189
  216.235.110.164
  216.235.244.68
  216.236.164.82
-216.238.183.171
-216.238.224.136
  216.238.234.28
  216.238.241.63
  216.238.244.19
@@ -95140,6 +89633,7 @@
  216.238.248.145
  216.238.250.71
  216.239.90.19
+216.24.179.112
  216.24.193.163
  216.24.249.75
  216.24.255.160
@@ -95176,7 +89670,6 @@
  216.245.220.19
  216.245.221.230
  216.246.109.114
-216.246.234.77
  216.246.49.197
  216.246.49.199
  216.246.49.201
@@ -95194,7 +89687,6 @@
  216.251.20.209
  216.251.26.123
  216.251.83.79
-216.252.20.47
  216.252.209.8
  216.254.186.76
  216.26.212.35
@@ -95210,9 +89702,11 @@
  216.41.234.16
  216.45.23.6
  216.45.54.89
+216.45.57.151
  216.45.59.90
  216.45.85.239
  216.46.0.102
+216.46.134.199
  216.46.157.4
  216.47.196.104
  216.47.216.113
@@ -95244,7 +89738,6 @@
  216.66.0.119
  216.66.27.194
  216.66.51.102
-216.66.80.238
  216.66.81.10
  216.66.81.43
  216.67.130.44
@@ -95259,7 +89752,6 @@
  216.70.101.140
  216.71.197.245
  216.73.105.71
-216.74.106.7
  216.74.255.182
  216.74.32.109
  216.75.113.182
@@ -95273,9 +89765,7 @@
  216.82.243.88
  216.82.251.237
  216.83.198.99
-216.83.45.162
  216.83.46.180
-216.83.52.120
  216.83.55.154
  216.85.161.204
  216.85.161.220
@@ -95296,7 +89786,6 @@
  216.98.85.200
  216.99.158.179
  216.99.158.78
-216.99.218.7
  21625.xc.iziyo.com
  2162e66b18eb.ngrok.io
  217.10.103.163
@@ -95306,6 +89795,7 @@
  217.100.113.174
  217.100.185.246
  217.100.97.156
+217.103.102.96
  217.103.94.158
  217.104.67.229
  217.104.75.11
@@ -95336,16 +89826,11 @@
  217.107.124.180
  217.107.124.185
  217.107.124.236
-217.107.124.41
-217.107.124.54
  217.107.124.58
  217.107.124.64
-217.107.124.7
-217.107.124.77
  217.107.124.9
  217.107.125.101
  217.107.125.107
-217.107.125.114
  217.107.125.116
  217.107.125.117
  217.107.125.124
@@ -95356,13 +89841,10 @@
  217.107.125.154
  217.107.125.162
  217.107.125.164
-217.107.125.181
  217.107.125.190
  217.107.125.199
  217.107.125.216
-217.107.125.223
  217.107.125.23
-217.107.125.233
  217.107.125.239
  217.107.125.243
  217.107.125.247
@@ -95384,7 +89866,6 @@
  217.107.126.59
  217.107.126.77
  217.107.126.82
-217.107.126.86
  217.107.127.110
  217.107.127.119
  217.107.127.125
@@ -95412,7 +89893,6 @@
  217.111.239.37
  217.111.245.138
  217.112.131.7
-217.112.163.134
  217.112.92.251
  217.113.114.80
  217.113.119.245
@@ -95444,17 +89924,17 @@
  217.12.57.89
  217.12.68.58
  217.120.103.59
+217.121.10.175
+217.122.106.12
  217.122.77.150
  217.123.170.239
  217.123.207.149
-217.125.110.139
  217.126.115.60
  217.126.50.212
  217.127.133.214
-217.128.110.231
-217.128.133.167
  217.128.2.177
  217.128.221.161
+217.128.241.104
  217.128.8.98
  217.129.216.122
  217.13.107.26
@@ -95471,24 +89951,25 @@
  217.133.138.66
  217.133.40.144
  217.133.58.148
+217.133.91.114
  217.133.95.209
  217.136.113.229
  217.136.13.236
-217.136.88.211
-217.138.116.252
  217.138.193.184
  217.138.193.62
  217.138.205.162
  217.138.207.254
  217.138.211.245
  217.138.219.141
-217.14.211.216
-217.14.254.108
+217.138.222.86
+217.138.222.94
  217.14.6.158
  217.14.7.228
  217.14.7.228bin.sh
  217.144.104.65
  217.144.104.66
+217.144.98.115
+217.144.98.122
  217.145.150.19
  217.145.199.112
  217.145.199.45
@@ -95503,6 +89984,7 @@
  217.147.1.128
  217.147.162.201
  217.147.169.244
+217.147.173.159
  217.147.28.102
  217.147.29.44
  217.148.223.170
@@ -95515,7 +89997,6 @@
  217.15.139.219
  217.15.178.7
  217.15.195.141
-217.150.211.7
  217.150.220.15
  217.150.77.31
  217.150.80.59
@@ -95524,7 +90005,7 @@
  217.150.87.244
  217.150.87.248
  217.150.87.250
-217.153.229.226
+217.16.131.16
  217.16.18.219
  217.160.170.24
  217.160.170.74
@@ -95534,23 +90015,17 @@
  217.160.2.23
  217.160.212.175
  217.160.214.101
-217.160.214.48
  217.160.239.186
-217.160.244.29
-217.160.246.60
  217.160.250.141
  217.160.254.33
  217.160.59.241
  217.160.59.40
  217.160.59.64
  217.160.65.177
-217.160.75.142
  217.163.11.111
  217.163.28.231
  217.164.255.35
  217.165.115.121
-217.165.22.147
-217.165.23.53
  217.165.28.158
  217.165.31.5
  217.168.76.230
@@ -95568,13 +90043,12 @@
  217.170.206.138
  217.170.206.146
  217.170.206.192
-217.171.12.154
  217.171.147.164
  217.171.39.143
  217.171.66.171
+217.172.119.254
  217.172.122.11
  217.172.122.12
-217.172.122.14
  217.172.122.16
  217.172.122.4
  217.172.179.138
@@ -95591,22 +90065,22 @@
  217.182.103.201
  217.182.131.4
  217.182.136.154
+217.182.140.117
  217.182.141.253
  217.182.142.251
+217.182.15.150
  217.182.16.10
  217.182.16.12
  217.182.16.13
  217.182.16.9
  217.182.169.183
-217.182.169.228
-217.182.170.54
  217.182.172.114
  217.182.172.117
  217.182.173.156
  217.182.174.139
  217.182.192.217
-217.182.193.49
  217.182.195.5
+217.182.196.227
  217.182.196.3
  217.182.197.93
  217.182.198.228
@@ -95614,7 +90088,6 @@
  217.182.201.204
  217.182.204.110
  217.182.204.25
-217.182.204.34
  217.182.205.27
  217.182.206.121
  217.182.206.215
@@ -95625,10 +90098,10 @@
  217.182.252.30
  217.182.253.249
  217.182.27.217
+217.182.32.67
  217.182.37.121
  217.182.38.130
  217.182.38.147
-217.182.41.179
  217.182.44.117
  217.182.54.204
  217.182.54.205
@@ -95640,18 +90113,16 @@
  217.182.68.93
  217.182.70.150
  217.182.71.175
-217.182.71.54
  217.182.78.180
  217.182.78.195
  217.182.81.8
-217.182.9.226
  217.182.95.74
  217.183.49.90
  217.19.154.218
  217.19.209.253
  217.19.216.210
-217.194.244.17
  217.194.6.58
+217.195.155.42
  217.195.164.4
  217.195.170.121
  217.195.202.34
@@ -95661,11 +90132,12 @@
  217.196.64.12
  217.196.67.61
  217.197.160.186
-217.197.185.44
  217.197.241.85
  217.199.160.224
+217.199.162.174
  217.199.168.23
  217.199.217.196
+217.20.113.137
  217.20.114.233
  217.20.130.72
  217.20.166.178
@@ -95674,14 +90146,10 @@
  217.208.80.36
  217.209.74.154
  217.209.85.167
-217.21.0.161
-217.21.114.170
  217.21.124.194
  217.21.125.179
  217.21.125.180
  217.21.147.112
-217.21.218.23
-217.21.24.146
  217.21.54.173
  217.21.54.221
  217.210.105.171
@@ -95689,20 +90157,14 @@
  217.210.80.68
  217.211.67.122
  217.216.128.185
-217.217.179.17
-217.217.22.58
-217.217.90.149
  217.218.222.34
  217.218.233.164
  217.219.116.116
  217.219.136.129
  217.219.137.203
  217.219.155.34
-217.219.172.13
-217.219.172.8
  217.219.173.200
  217.219.217.81
-217.219.245.17
  217.219.31.210
  217.219.61.27
  217.22.141.61
@@ -95710,6 +90172,7 @@
  217.22.60.25
  217.226.88.64
  217.229.52.180
+217.229.62.246
  217.23.12.100
  217.23.12.47
  217.23.140.103
@@ -95728,24 +90191,25 @@
  217.23.69.146
  217.23.74.198
  217.23.8.80
+217.230.217.80
  217.230.218.178
-217.230.222.10
  217.233.46.138
  217.24.119.11
  217.24.18.226
  217.24.240.68
  217.24.72.52
+217.244.237.106
  217.248.124.114
-217.249.215.211
  217.25.177.130
  217.25.198.133
  217.25.221.60
  217.25.225.192
  217.25.25.246
  217.25.31.20
-217.251.134.241
  217.251.139.33
+217.251.140.252
  217.26.163.82
+217.26.32.10
  217.26.47.10
  217.27.117.136
  217.27.124.81
@@ -95765,6 +90229,7 @@
  217.31.48.13
  217.31.48.30
  217.31.58.188
+217.33.76.158
  217.34.51.191
  217.35.82.250
  217.36.106.49
@@ -95775,36 +90240,30 @@
  217.57.140.58
  217.57.32.210
  217.57.74.118
-217.58.220.34
-217.6.79.202
  217.60.186.196
  217.60.186.50
+217.60.186.68
  217.60.50.197
  217.61.0.54
  217.61.107.36
-217.61.108.147
-217.61.121.23
-217.61.121.57
-217.61.123.72
-217.61.125.97
+217.61.112.20
  217.61.17.235
  217.61.19.109
-217.61.3.153
-217.61.6.112
  217.61.61.60
-217.61.7.72
+217.64.103.91
  217.64.108.66
  217.64.111.248
  217.64.113.195
  217.64.133.220
  217.64.134.145
-217.64.28.4
+217.64.17.54
  217.64.42.157
  217.64.42.35
  217.64.47.138
  217.64.98.169
  217.65.120.5
  217.65.121.108
+217.65.126.152
  217.65.6.12
  217.66.106.216
  217.67.182.170
@@ -95829,6 +90288,7 @@
  217.73.135.21
  217.73.143.168
  217.73.143.80
+217.74.9.215
  217.77.219.21
  217.77.221.209
  217.77.46.38
@@ -95864,14 +90324,8 @@
  217.8.44.38
  217.80.128.105
  217.81.21.173
-217.84.24.22
-217.88.73.72
+217.88.124.173
  217.9.250.33
-217.91.110.132
-217.91.144.95
-217.91.99.128
-217.92.210.164
-217.92.240.14
  217.92.55.246
  217.94.210.172
  217.94.242.128
@@ -95879,9 +90333,7 @@
  217.96.211.237
  217.96.41.250
  217538-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-218.0.57.245
-218.0.60.235
-218.1.18.78
+218.0.56.209
  218.10.13.98
  218.10.234.35
  218.10.239.96
@@ -95891,21 +90343,21 @@
  218.10.97.44
  218.101.202.186
  218.102.101.123
+218.102.104.169
  218.102.175.214
  218.102.208.195
  218.102.235.81
-218.103.156.117
  218.103.156.170
  218.103.179.247
  218.103.184.136
  218.103.188.208
-218.103.242.226
  218.103.37.97
-218.104.128.54
+218.104.175.43
  218.104.225.140
  218.104.67.138
  218.106.120.122
  218.106.167.102
+218.106.244.72
  218.106.92.66
  218.107.195.117
  218.107.38.70
@@ -95919,7 +90371,6 @@
  218.109.145.152
  218.109.146.170
  218.11.121.12
-218.11.202.37
  218.111.88.185
  218.12.196.14
  218.12.33.155
@@ -95948,11 +90399,13 @@
  218.146.121.30
  218.146.126.115
  218.146.127.68
+218.146.17.125
  218.146.20.61
  218.146.227.203
  218.146.232.130
  218.146.249.90
  218.147.109.163
+218.147.179.218
  218.147.217.228
  218.147.229.218
  218.147.56.90
@@ -95961,6 +90414,7 @@
  218.147.89.188
  218.147.89.62
  218.147.9.75
+218.147.92.154
  218.148.115.144
  218.148.146.236
  218.148.196.212
@@ -95978,6 +90432,7 @@
  218.149.245.123
  218.149.40.233
  218.149.49.16
+218.149.78.7
  218.149.78.96
  218.15.119.188
  218.15.164.205
@@ -95990,18 +90445,17 @@
  218.150.255.81
  218.150.67.35
  218.150.85.170
-218.151.100.194
  218.151.47.243
  218.151.55.224
  218.152.110.1
  218.152.134.203
  218.152.150.177
  218.152.150.177bin.sh
+218.152.186.146
  218.152.216.63
  218.152.237.218
  218.152.254.145
  218.152.82.84
-218.153.133.68
  218.153.205.69
  218.153.243.136
  218.154.126.47
@@ -96009,12 +90463,12 @@
  218.154.131.207
  218.154.134.246
  218.154.140.142
-218.154.16.69
  218.154.181.253
  218.154.182.243
  218.154.202.67
  218.154.205.101
  218.154.21.22
+218.154.217.103
  218.154.74.8
  218.155.169.37
  218.155.170.202
@@ -96029,6 +90483,7 @@
  218.155.6.251
  218.155.66.206
  218.156.118.149
+218.156.179.97
  218.156.190.130
  218.156.226.141
  218.156.26.85
@@ -96041,7 +90496,6 @@
  218.157.174.102
  218.157.174.24
  218.157.202.244
-218.157.203.53
  218.157.214.219
  218.157.64.77
  218.158.113.142
@@ -96055,12 +90509,11 @@
  218.158.81.187
  218.159.150.103
  218.159.169.3
+218.159.233.130
  218.159.239.212
  218.159.61.174
-218.16.121.2
  218.16.129.48
  218.16.146.124
-218.16.204.227
  218.161.0.155
  218.161.0.248
  218.161.100.11
@@ -96132,11 +90585,13 @@
  218.161.31.89
  218.161.33.23
  218.161.36.89
+218.161.37.174
  218.161.37.47
  218.161.38.199
  218.161.39.151
  218.161.39.30
  218.161.4.120
+218.161.42.248
  218.161.47.230
  218.161.48.73
  218.161.49.162
@@ -96157,6 +90612,7 @@
  218.161.63.168
  218.161.63.47
  218.161.64.132
+218.161.64.147
  218.161.66.108
  218.161.66.150
  218.161.66.163
@@ -96225,12 +90681,13 @@
  218.17.185.223
  218.17.228.102
  218.17.37.90
+218.173.134.183
  218.173.137.92
  218.173.166.132
+218.173.167.120
  218.173.29.60
  218.18.101.84
  218.18.152.89
-218.18.161.186
  218.18.232.29
  218.185.20.88
  218.186.136.7
@@ -96261,22 +90718,20 @@
  218.195.119.72
  218.2.106.125
  218.2.113.234
+218.2.157.188
  218.2.176.26
  218.2.191.148
  218.2.197.240
-218.2.220.254
-218.2.220.66
  218.2.53.161
  218.2.55.154
  218.20.254.247
+218.20.33.240
  218.200.138.110
  218.200.3.26
  218.200.5.178
  218.200.68.199
  218.201.100.66
-218.201.102.250
  218.201.113.143
-218.201.114.34
  218.201.160.34
  218.201.160.40
  218.201.160.43
@@ -96296,13 +90751,11 @@
  218.204.54.242
  218.204.76.70
  218.205.197.49
-218.205.219.182
  218.206.140.38
  218.206.168.34
  218.206.245.124
  218.206.25.11
  218.207.126.155
-218.208.186.13
  218.208.21.7
  218.209.47.222
  218.21.170.15
@@ -96326,12 +90779,15 @@
  218.21.171.55
  218.21.171.57
  218.21.196.234
+218.21.240.201
  218.21.240.24
  218.21.243.102
  218.21.250.162
  218.21.250.60
  218.21.27.178
+218.21.32.98
  218.21.70.248
+218.21.71.36
  218.21.78.35
  218.21.80.21
  218.21.97.106
@@ -96359,21 +90815,20 @@
  218.213.137.21
  218.217.114.239
  218.219.125.157
-218.219.149.130
  218.219.209.202
  218.22.127.176
  218.22.197.74
  218.22.223.201
-218.22.26.84
+218.22.254.194
  218.22.36.135
  218.227.171.11
  218.23.12.55
  218.23.227.52
  218.23.57.244
+218.23.60.180
  218.23.69.27
  218.23.9.170
  218.232.109.160
-218.232.135.95
  218.232.136.177
  218.233.105.38
  218.234.136.102
@@ -96394,12 +90849,9 @@
  218.238.2.226
  218.238.72.254
  218.239.6.144
-218.24.106.222
  218.24.16.198
  218.24.173.120
  218.24.73.123
-218.240.130.106
-218.240.137.68
  218.240.148.144
  218.240.148.145
  218.240.148.211
@@ -96419,14 +90871,13 @@
  218.242.47.98
  218.244.131.108
  218.245.1.169
-218.245.5.248
  218.245.61.134
  218.246.20.221
  218.246.22.202
-218.246.65.26
+218.246.71.42
  218.246.93.97
-218.248.0.6
  218.248.116.142
+218.248.23.33
  218.248.232.24
  218.248.240.108
  218.248.64.239
@@ -96442,7 +90893,6 @@
  218.25.161.226
  218.25.224.23
  218.250.10.252
-218.250.10.42
  218.250.137.45
  218.250.137.96
  218.250.145.132
@@ -96463,7 +90913,6 @@
  218.255.136.110
  218.255.160.83
  218.255.163.212
-218.255.174.70
  218.255.242.114
  218.255.245.10
  218.255.88.178
@@ -96497,13 +90946,11 @@
  218.28.199.237
  218.28.20.18
  218.28.21.210
-218.28.21.236
-218.28.238.162
-218.28.244.242
  218.28.244.83
  218.28.253.146
  218.28.39.147
  218.28.41.110
+218.28.49.68
  218.28.78.243
  218.28.83.106
  218.28.99.248
@@ -96512,13 +90959,11 @@
  218.29.120.11
  218.29.120.70
  218.29.128.195
+218.29.135.98
  218.29.188.139
-218.29.188.148
  218.29.188.169
-218.29.188.44
  218.29.188.94
  218.29.196.186
-218.29.203.109
  218.29.219.20
  218.29.219.36
  218.29.222.114
@@ -96527,14 +90972,11 @@
  218.29.67.194
  218.29.7.11
  218.29.81.106
-218.29.83.38
  218.29.85.98
  218.3.124.180
  218.3.194.126
  218.3.194.137
  218.3.223.134
-218.3.240.150
-218.30.19.190
  218.30.21.112
  218.30.21.209
  218.30.21.46
@@ -96548,6 +90990,7 @@
  218.32.150.57
  218.32.96.17
  218.32.96.37
+218.35.168.196
  218.35.171.246
  218.35.207.25
  218.35.207.81
@@ -96562,11 +91005,10 @@
  218.35.49.153
  218.35.57.213
  218.35.57.84
-218.35.59.69
+218.35.67.188
  218.35.68.33
  218.35.77.247
  218.35.82.232
-218.36.252.3
  218.36.86.40
  218.37.112.143
  218.37.112.244
@@ -96592,7 +91034,6 @@
  218.4.192.27
  218.4.201.122
  218.4.202.186
-218.4.214.115
  218.4.239.146
  218.4.240.194
  218.4.240.42
@@ -96612,6 +91053,7 @@
  218.50.223.112
  218.50.52.241
  218.50.53.15
+218.51.127.13
  218.51.205.132
  218.53.144.81
  218.54.123.239
@@ -96630,7 +91072,6 @@
  218.56.158.83
  218.56.160.82
  218.56.161.69
-218.56.216.46
  218.56.222.127
  218.56.226.68
  218.56.27.194
@@ -96643,7 +91084,6 @@
  218.57.118.56
  218.57.123.247
  218.57.129.37
-218.57.146.235
  218.57.204.114
  218.57.204.230
  218.57.241.209
@@ -96664,7 +91104,6 @@
  218.58.96.189
  218.59.104.63
  218.59.118.11
-218.59.126.8
  218.59.13.88
  218.59.139.12
  218.59.14.132
@@ -96672,41 +91111,35 @@
  218.59.193.14
  218.59.38.36
  218.59.46.158
-218.59.98.138
  218.59.98.138bin.sh
  218.59.98.44
-218.6.130.195
  218.6.192.238
  218.6.224.50
  218.6.95.146
-218.60.148.23
  218.60.41.136
  218.60.8.99
  218.60.95.42
  218.61.145.90
  218.61.171.158
  218.61.179.179
-218.61.188.184
  218.61.194.13
  218.61.30.20
-218.61.47.132
  218.61.5.68
  218.61.58.118
  218.61.58.206
  218.62.42.51
  218.62.51.90
  218.62.64.153
+218.62.64.66
  218.62.83.66
  218.62.91.252
  218.63.208.213
  218.63.252.195
-218.63.254.167
  218.64.174.207
  218.64.218.43
  218.64.251.194
  218.64.53.20
  218.64.69.79
-218.64.80.94
  218.64.84.147
  218.65.131.26
  218.65.131.48
@@ -96715,25 +91148,25 @@
  218.65.221.24
  218.66.16.241
  218.66.57.217
-218.66.81.60
-218.67.220.62
  218.67.28.72
  218.67.29.180
  218.67.65.194
+218.67.88.169
  218.67.90.176
+218.68.0.42
  218.68.172.131
  218.68.185.240
  218.68.204.130
  218.69.1.90
-218.69.11.166
  218.69.111.107
  218.69.139.190
+218.69.174.6
  218.69.18.170
-218.69.19.22
  218.69.33.116
  218.69.91.84
  218.69.96.188
  218.69.98.170
+218.7.116.115
  218.7.141.51
  218.7.19.244
  218.7.201.234
@@ -96750,9 +91183,7 @@
  218.71.140.223
  218.71.141.62
  218.72.212.46
-218.72.213.103
  218.72.253.212
-218.73.110.231
  218.73.111.41
  218.73.60.118
  218.73.99.204
@@ -96801,27 +91232,16 @@
  218.77.50.45
  218.77.8.142
  218.78.103.91
-218.78.105.98
-218.78.110.114
  218.78.209.1
  218.78.209.241
  218.78.21.74
  218.78.26.250
-218.78.35.157
-218.78.36.85
  218.78.46.81
-218.78.48.37
  218.78.50.164
  218.78.54.80
  218.78.70.55
  218.78.73.117
-218.78.79.147
  218.78.81.207
-218.78.84.162
-218.78.87.25
-218.78.92.29
-218.78.98.97
-218.78.99.70
  218.79.183.161
  218.79.94.255
  218.8.166.195
@@ -96830,7 +91250,6 @@
  218.80.245.54
  218.81.48.115
  218.82.137.230
-218.82.137.80
  218.82.144.217
  218.83.38.244
  218.83.58.87
@@ -96841,7 +91260,6 @@
  218.86.155.143
  218.86.3.35
  218.86.31.67
-218.86.84.189
  218.86.87.171
  218.87.107.134
  218.87.149.136
@@ -96850,32 +91268,24 @@
  218.87.30.153
  218.87.30.155
  218.87.30.159
-218.87.96.224
+218.88.124.76
  218.88.215.252
  218.88.215.49
-218.88.235.36
  218.88.245.94
  218.88.25.87
-218.88.25.9
  218.88.250.6
  218.88.29.119
-218.88.29.188
  218.88.29.226
-218.88.29.235
  218.89.146.66
  218.89.196.150
  218.89.222.119
  218.89.222.16
-218.89.222.57
  218.89.238.130
  218.89.238.21
  218.89.241.68
-218.89.48.175
  218.89.50.90
-218.89.77.105
  218.89.77.122
  218.89.77.123
-218.89.77.19
  218.89.77.2
  218.89.77.21
  218.89.77.38
@@ -96891,6 +91301,7 @@
  218.89.77.94
  218.89.77.98
  218.89.81.109
+218.9.28.167
  218.90.1.50
  218.90.119.149
  218.90.138.98
@@ -96913,7 +91324,6 @@
  218.92.0.184
  218.92.0.185
  218.92.0.189
-218.92.0.192
  218.92.0.198
  218.92.0.199
  218.92.0.200
@@ -96933,7 +91343,6 @@
  218.92.0.250
  218.92.0.251
  218.92.115.130
-218.92.150.130
  218.92.164.26
  218.92.194.154
  218.92.204.214
@@ -96958,16 +91367,11 @@
  218.93.172.55
  218.93.172.59
  218.93.179.82
-218.93.194.242
  218.93.198.230
  218.93.225.150
  218.93.44.222
-218.93.53.118
  218.94.1.54
-218.94.103.226
  218.94.119.66
-218.94.125.234
-218.94.125.246
  218.94.129.162
  218.94.13.94
  218.94.132.114
@@ -96984,7 +91388,6 @@
  218.94.179.182
  218.94.179.194
  218.94.179.202
-218.94.23.132
  218.94.29.50
  218.94.33.166
  218.94.57.147
@@ -96995,10 +91398,8 @@
  218.94.93.34
  218.95.136.168
  218.95.167.34
-218.95.175.166
  218.95.182.149
  218.95.253.98
-218.95.37.198
  218.95.37.244
  218.95.37.251
  218.95.37.50
@@ -97009,6 +91410,7 @@
  218847280326116-dot-wetransfer-auth-file334.appspot.com
  21897secured.info
  218betasus.com
+219.100.37.245
  219.101.192.141
  219.111.2.38
  219.115.27.157
@@ -97026,6 +91428,7 @@
  219.128.8.78
  219.128.88.186
  219.129.181.4
+219.129.181.70
  219.129.28.61
  219.129.60.42
  219.130.55.201
@@ -97033,6 +91436,7 @@
  219.131.240.209
  219.131.241.189
  219.131.241.69
+219.131.242.144
  219.131.243.148
  219.131.243.220
  219.131.60.195
@@ -97056,10 +91460,10 @@
  219.136.207.78
  219.136.243.47
  219.136.249.151
+219.136.5.88
  219.136.6.97
  219.137.228.131
  219.137.228.132
-219.137.64.223
  219.138.137.129
  219.138.150.220
  219.138.158.131
@@ -97069,9 +91473,6 @@
  219.138.66.239
  219.139.128.2
  219.139.128.60
-219.139.130.49
-219.139.131.131
-219.139.131.134
  219.139.207.33
  219.139.25.249
  219.139.44.135
@@ -97080,10 +91481,9 @@
  219.139.78.67
  219.139.83.165
  219.140.124.119
-219.140.154.66
  219.141.167.120
-219.141.176.186
  219.141.231.161
+219.141.52.153
  219.142.106.204
  219.142.14.126
  219.142.14.30
@@ -97099,14 +91499,11 @@
  219.144.196.98
  219.144.196.99
  219.144.218.163
-219.144.218.207
  219.144.218.90
  219.144.219.125
  219.144.245.34
  219.144.67.60
-219.144.68.15
  219.144.82.202
-219.145.118.23
  219.145.169.4
  219.145.189.125
  219.145.195.109
@@ -97131,8 +91528,6 @@
  219.147.85.221
  219.148.52.18
  219.148.83.88
-219.149.108.195
-219.149.220.82
  219.150.189.215
  219.150.218.132
  219.150.218.243
@@ -97143,10 +91538,8 @@
  219.150.85.238
  219.150.93.157
  219.151.11.109
-219.151.135.44
  219.151.147.148
  219.151.151.35
-219.151.155.247
  219.151.22.209
  219.151.22.56
  219.151.248.79
@@ -97157,11 +91550,8 @@
  219.151.45.15
  219.151.8.70
  219.151.9.139
-219.152.168.133
  219.152.170.58
  219.153.100.153
-219.153.107.186
-219.153.13.16
  219.153.13.70
  219.153.33.234
  219.153.6.161
@@ -97170,23 +91560,16 @@
  219.153.74.70
  219.154.0.124
  219.154.0.42
+219.154.100.168
  219.154.100.62
-219.154.100.91
-219.154.101.9
  219.154.102.109
-219.154.105.74
-219.154.109.121
-219.154.109.221
-219.154.109.234
-219.154.110.22
+219.154.103.77
+219.154.11.0
  219.154.115.48
-219.154.116.28
-219.154.117.229
+219.154.121.22
  219.154.122.126
-219.154.122.142
  219.154.123.94
-219.154.126.188
-219.154.142.115
+219.154.125.78
  219.154.152.129
  219.154.154.104
  219.154.160.74
@@ -97202,61 +91585,65 @@
  219.154.7.30
  219.154.81.199
  219.154.97.17
-219.154.99.210
  219.154.99.216
  219.155.100.215
  219.155.103.99
  219.155.112.128
  219.155.113.232
-219.155.115.118
  219.155.115.133
  219.155.117.127
-219.155.118.74
-219.155.12.108
+219.155.12.139
  219.155.13.2
  219.155.13.234
  219.155.13.78
  219.155.14.130
  219.155.156.139
+219.155.168.102
+219.155.172.137
+219.155.188.246
+219.155.19.1
  219.155.207.191
+219.155.21.180
  219.155.210.213
  219.155.212.228
  219.155.215.80
+219.155.216.56
  219.155.217.31
-219.155.22.235
  219.155.22.89
  219.155.225.43
  219.155.23.198
-219.155.241.206
-219.155.252.18
+219.155.230.201
+219.155.24.93
+219.155.26.63
+219.155.26.77
  219.155.27.242
-219.155.28.156
-219.155.37.140
+219.155.30.31
+219.155.42.253
  219.155.62.104
  219.155.69.108
  219.155.69.112
  219.155.70.125
  219.155.71.14
+219.155.75.192
  219.155.8.16
-219.155.8.238
  219.155.96.191
  219.155.96.208
  219.155.96.239
  219.155.98.184
  219.155.98.219
  219.155.98.255
-219.155.99.110
+219.155.99.148
  219.155.99.181
-219.155.99.238
  219.155.99.64
  219.156.103.225
  219.156.11.19
  219.156.11.203
-219.156.12.207
+219.156.11.67
+219.156.12.71
  219.156.126.100
  219.156.126.5
+219.156.14.104
  219.156.14.138
-219.156.14.93
  219.156.146.13
  219.156.146.3
  219.156.15.157
@@ -97265,112 +91652,105 @@
  219.156.154.70
  219.156.168.44
  219.156.18.10
+219.156.184.83
  219.156.188.241
  219.156.20.153
  219.156.20.154
+219.156.20.156
  219.156.209.49
-219.156.21.81
+219.156.21.217
  219.156.210.6
+219.156.211.232
  219.156.22.69
-219.156.23.6
+219.156.23.245
  219.156.243.241
-219.156.33.163
  219.156.61.116
+219.156.72.239
  219.156.77.236
  219.156.88.132
-219.156.93.17
  219.156.94.195
-219.156.95.145
-219.156.97.216
-219.156.98.150
+219.156.96.254
  219.157.132.63
  219.157.134.144
-219.157.134.231
+219.157.134.40
  219.157.134.7
  219.157.135.169
-219.157.135.190
  219.157.139.165
-219.157.145.113
-219.157.145.151
+219.157.144.168
  219.157.146.91
-219.157.150.141
+219.157.150.105
  219.157.151.5
  219.157.152.81
-219.157.162.142
  219.157.168.233
-219.157.169.47
  219.157.171.124
  219.157.171.92
  219.157.176.45
  219.157.179.101
+219.157.181.22
  219.157.182.170
+219.157.19.133
  219.157.202.184
  219.157.202.34
-219.157.203.1
-219.157.206.252
+219.157.202.48
+219.157.204.227
+219.157.204.49
  219.157.212.114
  219.157.212.131
  219.157.212.162
  219.157.212.205
  219.157.213.228
-219.157.214.202
+219.157.214.15
  219.157.214.22
  219.157.214.236
+219.157.214.40
  219.157.214.42
-219.157.214.55
+219.157.215.106
  219.157.215.139
+219.157.215.182
  219.157.215.236
  219.157.215.240
  219.157.215.31
-219.157.215.61
  219.157.215.64
-219.157.215.76
-219.157.218.54
-219.157.218.56
-219.157.219.252
-219.157.220.84
+219.157.216.101
+219.157.220.6
  219.157.221.183
-219.157.223.187
-219.157.223.189
-219.157.226.47
-219.157.230.178
+219.157.224.200
+219.157.227.176
+219.157.229.144
+219.157.231.75
+219.157.232.15
+219.157.235.71
  219.157.235.93
  219.157.237.112
  219.157.237.31
+219.157.238.22
  219.157.238.66
  219.157.239.65
  219.157.24.148
-219.157.243.20
-219.157.243.92
+219.157.243.236
+219.157.245.186
  219.157.245.42
-219.157.247.210
  219.157.248.201
-219.157.25.162
-219.157.25.84
+219.157.250.121
  219.157.255.184
-219.157.26.102
  219.157.26.104
-219.157.26.115
-219.157.27.4
-219.157.28.30
+219.157.28.50
+219.157.29.237
  219.157.29.36
-219.157.30.125
-219.157.30.92
+219.157.30.121
+219.157.31.77
  219.157.32.53
-219.157.33.10
-219.157.34.18
-219.157.34.4
+219.157.33.199
  219.157.36.105
-219.157.49.23
-219.157.50.254
-219.157.51.202
+219.157.37.218
+219.157.38.255
+219.157.52.32
  219.157.54.231
-219.157.56.175
-219.157.57.125
-219.157.57.230
+219.157.58.86
+219.157.60.131
  219.157.60.177
  219.157.61.38
-219.157.67.78
+219.157.67.225
  219.157.75.62
  219.159.164.237
  219.159.170.38
@@ -97380,7 +91760,6 @@
  219.159.245.20
  219.159.245.35
  219.159.250.226
-219.159.83.164
  219.160.230.56
  219.160.232.85
  219.165.142.209
@@ -97417,23 +91796,15 @@
  219.244.16.225
  219.244.16.227
  219.246.67.82
+219.247.63.186
  219.248.190.234
  219.249.113.183
  219.249.5.217
  219.250.174.170
-219.250.188.107
-219.250.188.134
-219.250.188.140
-219.250.188.142
-219.250.188.143
-219.250.188.144
-219.250.188.165
-219.250.188.2
-219.250.188.219
-219.250.188.41
  219.255.134.109
  219.255.59.153
  219.68.1.186
+219.68.1.36
  219.68.1.84
  219.68.100.60
  219.68.160.166
@@ -97453,6 +91824,7 @@
  219.71.14.125
  219.71.210.212
  219.73.1.51
+219.73.109.145
  219.73.24.132
  219.73.42.54
  219.73.5.167
@@ -97468,7 +91840,6 @@
  219.74.87.45
  219.75.134.27
  219.75.19.89
-219.75.67.242
  219.75.75.96
  219.76.165.12
  219.76.178.193
@@ -97476,11 +91847,10 @@
  219.76.194.185
  219.76.200.27
  219.77.126.167
-219.77.169.124
+219.77.175.7
  219.77.180.73
  219.77.183.165
  219.77.198.46
-219.77.206.199
  219.77.234.157
  219.77.27.183
  219.77.31.160
@@ -97488,7 +91858,6 @@
  219.77.67.202
  219.77.67.78
  219.78.100.144
-219.78.125.145
  219.78.126.186
  219.78.13.83
  219.78.195.156
@@ -97496,7 +91865,6 @@
  219.78.254.76
  219.78.53.220
  219.78.66.10
-219.78.67.78
  219.78.77.79
  219.79.112.34
  219.79.154.154
@@ -97518,8 +91886,8 @@
  219.84.212.66
  219.84.213.126
  219.84.213.145
+219.84.218.135
  219.84.234.73
-219.84.236.108
  219.84.250.125
  219.84.28.244
  219.85.108.79
@@ -97530,7 +91898,6 @@
  219.85.184.134
  219.85.185.234
  219.85.186.228
-219.85.187.131
  219.85.190.161
  219.85.201.133
  219.85.201.134
@@ -97555,9 +91922,7 @@
  219.89.196.131
  219.90.112.44
  219.91.110.131
-219.91.14.252
  219.91.142.47
-219.91.153.134
  219.91.153.165
  219.91.153.198
  219.91.163.117
@@ -97578,7 +91943,6 @@
  219.92.54.252
  219.92.59.93
  219.92.6.185
-219.93.110.60
  219.93.111.93
  219.94.128.174
  219.94.194.248
@@ -97598,7 +91962,6 @@
  220.100.117.121
  220.102.43.235
  220.104.108.95
-220.106.13.14
  220.108.44.75
  220.110.145.21
  220.110.164.66
@@ -97606,6 +91969,7 @@
  220.112.207.212
  220.113.1.226
  220.113.15.56
+220.116.155.73
  220.116.200.30
  220.116.55.86
  220.116.55.86bin.sh
@@ -97616,9 +91980,11 @@
  220.118.111.189
  220.118.168.155
  220.118.249.176
+220.118.75.234
  220.119.120.146
  220.119.157.45
  220.119.221.19
+220.119.224.235
  220.119.235.183
  220.119.52.46
  220.119.64.247
@@ -97632,6 +91998,7 @@
  220.121.112.224
  220.121.181.183
  220.121.184.53
+220.121.224.233
  220.121.233.180
  220.121.233.68
  220.121.58.55
@@ -97640,7 +92007,6 @@
  220.122.126.184
  220.122.182.12
  220.122.194.200
-220.122.231.95
  220.123.122.250
  220.123.122.250bin.sh
  220.123.143.241
@@ -97653,14 +92019,13 @@
  220.123.239.163
  220.123.241.30
  220.123.75.150
+220.123.99.232
  220.124.10.172
-220.124.130.66
  220.124.164.77
  220.124.184.174
  220.124.186.246
  220.124.192.178
  220.124.22.93
-220.124.240.66
  220.124.246.99
  220.125.223.105
  220.125.230.193
@@ -97670,17 +92035,18 @@
  220.125.61.132
  220.126.128.243
  220.126.255.210
+220.126.37.235
  220.127.118.104
  220.127.118.116
  220.127.118.117
  220.127.135.103
-220.127.148.8
  220.127.2.231
  220.127.201.5
  220.127.221.123
  220.127.239.7
  220.127.3.59
  220.127.50.88
+220.127.53.223
  220.128.108.79
  220.128.125.59
  220.128.139.19
@@ -97697,7 +92063,6 @@
  220.129.145.218
  220.129.154.221
  220.129.155.218
-220.129.180.244
  220.129.3.101
  220.130.10.13
  220.130.105.55
@@ -97708,7 +92073,6 @@
  220.130.167.59
  220.130.168.100
  220.130.174.113
-220.130.178.36
  220.130.184.5
  220.130.193.234
  220.130.213.221
@@ -97719,6 +92083,7 @@
  220.130.227.165
  220.130.229.62
  220.130.239.185
+220.130.239.186
  220.130.252.247
  220.130.252.248
  220.130.4.67
@@ -97753,6 +92118,7 @@
  220.132.114.51
  220.132.115.7
  220.132.118.135
+220.132.119.115
  220.132.120.144
  220.132.120.207
  220.132.120.221
@@ -97825,7 +92191,6 @@
  220.132.171.76
  220.132.173.152
  220.132.174.222
-220.132.174.229
  220.132.177.208
  220.132.18.157
  220.132.18.160
@@ -98001,7 +92366,6 @@
  220.132.83.127
  220.132.83.245
  220.132.84.135
-220.132.84.191
  220.132.84.234
  220.132.84.78
  220.132.86.14
@@ -98043,7 +92407,6 @@
  220.133.108.173
  220.133.108.29
  220.133.108.64
-220.133.109.2
  220.133.109.250
  220.133.109.59
  220.133.11.108
@@ -98105,13 +92468,13 @@
  220.133.155.136
  220.133.156.203
  220.133.156.228
+220.133.157.219
  220.133.158.188
  220.133.158.92
  220.133.159.11
  220.133.159.21
  220.133.159.226
  220.133.159.89
-220.133.16.166
  220.133.160.158
  220.133.161.196
  220.133.161.202
@@ -98120,12 +92483,10 @@
  220.133.163.230
  220.133.168.110
  220.133.168.156
-220.133.170.132
  220.133.175.150
  220.133.175.228
  220.133.178.169
  220.133.179.80
-220.133.18.137
  220.133.186.124
  220.133.187.241
  220.133.187.251
@@ -98185,7 +92546,6 @@
  220.133.231.208
  220.133.231.42
  220.133.231.81
-220.133.233.209
  220.133.234.91
  220.133.235.21
  220.133.235.23
@@ -98196,7 +92556,6 @@
  220.133.237.166
  220.133.237.211
  220.133.237.4
-220.133.238.130
  220.133.238.38
  220.133.24.178
  220.133.24.190
@@ -98223,8 +92582,7 @@
  220.133.34.225
  220.133.34.78
  220.133.35.114
-220.133.35.152
-220.133.36.112
+220.133.35.92
  220.133.36.135
  220.133.36.217
  220.133.38.234
@@ -98289,7 +92647,6 @@
  220.133.95.181
  220.133.95.68
  220.133.96.128
-220.133.97.20
  220.133.98.95
  220.134.0.44
  220.134.10.32
@@ -98302,7 +92659,6 @@
  220.134.103.202
  220.134.104.125
  220.134.105.176
-220.134.105.187
  220.134.109.12
  220.134.110.191
  220.134.112.13
@@ -98359,7 +92715,6 @@
  220.134.145.163
  220.134.146.27
  220.134.146.65
-220.134.146.76
  220.134.147.193
  220.134.148.125
  220.134.148.16
@@ -98417,6 +92772,7 @@
  220.134.187.187
  220.134.189.46
  220.134.192.221
+220.134.193.71
  220.134.196.123
  220.134.196.155
  220.134.196.19
@@ -98426,7 +92782,6 @@
  220.134.201.191
  220.134.201.210
  220.134.201.8
-220.134.201.87
  220.134.203.206
  220.134.203.34
  220.134.203.76
@@ -98459,7 +92814,6 @@
  220.134.227.100
  220.134.227.187
  220.134.23.143
-220.134.23.206
  220.134.23.49
  220.134.230.23
  220.134.231.7
@@ -98470,6 +92824,7 @@
  220.134.234.50
  220.134.237.10
  220.134.237.127
+220.134.239.22
  220.134.24.109
  220.134.24.14
  220.134.240.226
@@ -98484,7 +92839,6 @@
  220.134.246.253
  220.134.249.134
  220.134.249.25
-220.134.249.65
  220.134.25.204
  220.134.25.49
  220.134.250.230
@@ -98496,7 +92850,6 @@
  220.134.252.251
  220.134.26.170
  220.134.27.40
-220.134.28.166
  220.134.3.67
  220.134.3.89
  220.134.30.104
@@ -98563,6 +92916,7 @@
  220.135.1.198
  220.135.1.90
  220.135.10.172
+220.135.10.34
  220.135.102.99
  220.135.103.214
  220.135.104.83
@@ -98615,6 +92969,7 @@
  220.135.149.244
  220.135.149.90
  220.135.15.52
+220.135.150.104
  220.135.150.30
  220.135.150.55
  220.135.151.127
@@ -98622,6 +92977,7 @@
  220.135.151.17
  220.135.151.244
  220.135.152.192
+220.135.154.107
  220.135.154.163
  220.135.154.75
  220.135.156.151
@@ -98649,7 +93005,6 @@
  220.135.184.126
  220.135.186.177
  220.135.189.142
-220.135.19.18
  220.135.190.171
  220.135.191.28
  220.135.191.7
@@ -98663,7 +93018,6 @@
  220.135.203.117
  220.135.203.16
  220.135.203.77
-220.135.204.49
  220.135.209.78
  220.135.21.218
  220.135.211.155
@@ -98676,6 +93030,7 @@
  220.135.219.102
  220.135.219.205
  220.135.22.1
+220.135.220.215
  220.135.221.10
  220.135.223.147
  220.135.223.157
@@ -98685,6 +93040,7 @@
  220.135.225.148
  220.135.225.189
  220.135.225.246
+220.135.226.239
  220.135.232.107
  220.135.232.111
  220.135.232.172
@@ -98724,6 +93080,7 @@
  220.135.32.207
  220.135.32.30
  220.135.32.35
+220.135.33.83
  220.135.35.183
  220.135.40.55
  220.135.40.67
@@ -98747,6 +93104,7 @@
  220.135.60.34
  220.135.60.73
  220.135.61.168
+220.135.62.144
  220.135.63.209
  220.135.64.20
  220.135.67.214
@@ -98777,8 +93135,6 @@
  220.135.93.60
  220.135.95.1
  220.135.95.98
-220.136.127.45
-220.137.29.31
  220.137.3.174
  220.137.5.244
  220.141.10.236
@@ -98805,7 +93161,6 @@
  220.149.227.105
  220.149.242.9
  220.156.236.162
-220.158.148.132
  220.158.216.101
  220.158.216.107
  220.158.216.121
@@ -98814,6 +93169,7 @@
  220.158.216.15
  220.160.18.35
  220.160.200.222
+220.161.104.106
  220.161.15.189
  220.161.32.25
  220.161.33.17
@@ -98821,7 +93177,6 @@
  220.161.7.6
  220.161.72.230
  220.161.77.42
-220.161.81.131
  220.161.81.162
  220.162.164.101
  220.162.164.215
@@ -98841,6 +93196,7 @@
  220.164.192.25
  220.164.192.6
  220.164.2.111
+220.164.2.131
  220.164.2.134
  220.164.226.211
  220.164.226.212
@@ -98848,7 +93204,6 @@
  220.165.147.62
  220.165.15.150
  220.165.15.228
-220.165.15.247
  220.165.15.250
  220.165.9.87
  220.166.33.7
@@ -98873,12 +93228,13 @@
  220.168.239.80
  220.168.240.227
  220.168.44.226
-220.168.85.107
+220.168.44.238
  220.169.101.4
  220.169.127.172
  220.169.252.147
  220.169.253.135
  220.169.253.248
+220.169.254.109
  220.169.254.223
  220.169.255.0
  220.169.63.94
@@ -98899,10 +93255,12 @@
  220.173.160.221bin.sh
  220.173.160.3
  220.173.167.164
+220.173.208.92
  220.173.209.166
  220.173.210.137
  220.173.210.68
  220.173.211.29
+220.173.235.209
  220.173.246.112
  220.173.36.217
  220.175.106.43
@@ -98915,15 +93273,12 @@
  220.176.197.41
  220.176.197.49
  220.176.204.183
-220.176.204.91
-220.176.28.78
  220.176.78.18
  220.177.92.227
  220.178.164.13
  220.178.171.184
  220.178.221.74
  220.178.254.54
-220.178.31.90
  220.178.62.230
  220.178.65.122
  220.178.67.242
@@ -98931,6 +93286,7 @@
  220.178.67.250
  220.178.71.156
  220.179.151.3
+220.179.180.113
  220.179.231.244
  220.179.241.111
  220.179.28.85
@@ -98941,58 +93297,45 @@
  220.180.148.130
  220.180.192.152
  220.180.192.77
+220.180.239.88
  220.180.24.215
  220.180.74.78
  220.181.187.187
  220.181.87.80
-220.182.2.252
  220.182.47.116
  220.184.0.88
  220.184.126.27
  220.184.202.136
+220.184.71.197
  220.185.195.156
  220.185.196.103
  220.185.198.208
  220.185.215.165
  220.185.217.239
  220.186.131.133
-220.186.132.242
  220.186.134.14
-220.186.135.30
  220.186.137.43
  220.186.138.178
-220.186.142.67
  220.186.147.169
-220.186.147.38
  220.186.152.192
  220.186.153.5
-220.186.156.230
  220.186.164.91
-220.186.165.251
-220.186.167.66
  220.186.168.222
  220.186.168.37
  220.186.169.134
-220.186.171.78
-220.186.176.21
  220.186.177.29
-220.186.181.242
  220.186.181.31
  220.186.182.208
-220.186.183.132
-220.186.189.102
  220.186.189.103
  220.186.189.249
-220.186.189.56
  220.186.191.192
-220.189.192.2
  220.189.196.134
  220.189.196.206
  220.189.211.72
  220.189.216.132
  220.189.68.209
  220.189.99.155
-220.191.10.2
+220.191.10.199
  220.191.161.219
  220.191.173.106
  220.191.173.222
@@ -99000,12 +93343,11 @@
  220.191.210.132
  220.191.23.225
  220.192.156.12
-220.194.140.105
  220.194.238.47
  220.194.238.49
  220.194.248.144
+220.194.41.250
  220.194.59.89
-220.195.3.57
  220.197.200.155
  220.197.200.250
  220.201.110.38
@@ -99021,19 +93363,18 @@
  220.202.73.105
  220.202.73.247
  220.202.74.73
+220.215.143.49
  220.225.126.55
  220.225.133.2
  220.225.87.129
  220.226.103.254
  220.226.188.32
  220.227.61.73
-220.228.192.200
  220.230.121.57
  220.231.134.2
  220.231.195.75
  220.233.69.182
  220.235.116.185
-220.235.166.117
  220.238.111.25
  220.238.226.51
  220.239.24.89
@@ -99060,7 +93401,6 @@
  220.247.174.115
  220.247.174.12
  220.247.174.124
-220.247.174.13
  220.247.174.202
  220.247.174.206
  220.247.174.234
@@ -99068,16 +93408,14 @@
  220.247.174.238
  220.247.201.109
  220.247.224.58
-220.247.237.230
-220.247.238.182
  220.247.244.206
  220.247.3.184
  220.247.3.186
-220.248.101.54
  220.248.113.26
  220.248.118.50
  220.248.166.157
  220.248.18.146
+220.248.188.75
  220.248.238.130
  220.248.3.211
  220.248.36.50
@@ -99099,7 +93437,6 @@
  220.250.51.208
  220.253.5.106
  220.255.1.162
-220.255.127.126
  220.255.158.168
  220.255.158.189
  220.255.186.184
@@ -99110,11 +93447,13 @@
  220.255.48.31
  220.255.54.237
  220.255.71.82
+220.66.155.2
  220.70.154.250
  220.70.199.14
  220.70.255.112
  220.70.255.16
  220.70.255.59
+220.70.31.3
  220.70.43.145
  220.70.43.145bin.sh
  220.70.70.39
@@ -99126,12 +93465,14 @@
  220.72.157.216
  220.72.173.197
  220.72.181.48
+220.72.26.33
  220.72.45.38
  220.72.55.173
  220.73.11.139
  220.73.118.19
  220.73.118.61
  220.73.122.203
+220.73.131.250
  220.73.134.140
  220.73.144.196
  220.73.162.48
@@ -99139,7 +93480,6 @@
  220.73.95.50
  220.74.104.170
  220.74.104.184
-220.74.113.200
  220.74.113.57
  220.74.116.146
  220.74.120.147
@@ -99155,10 +93495,9 @@
  220.76.155.63
  220.76.162.56
  220.76.192.95
-220.76.205.178
+220.76.237.234
+220.76.237.38
  220.76.57.217
-220.76.92.108
-220.76.92.67
  220.77.117.160
  220.77.117.160bin.sh
  220.77.199.222
@@ -99168,6 +93507,7 @@
  220.77.56.80
  220.78.108.217
  220.78.109.210
+220.78.170.101
  220.78.222.126
  220.78.28.68
  220.78.37.228
@@ -99176,6 +93516,8 @@
  220.79.197.239
  220.79.203.49
  220.79.215.142
+220.79.225.68
+220.79.249.133
  220.79.34.109
  220.79.48.96
  220.79.74.11
@@ -99188,31 +93530,35 @@
  220.80.165.23
  220.80.170.217
  220.80.172.116
+220.80.231.240
  220.80.251.133
-220.80.71.23
+220.80.53.135
  220.80.88.10
  220.80.88.107
-220.80.88.26
+220.80.88.117
  220.81.117.171
  220.81.13.97
  220.81.150.85
+220.81.185.30
  220.81.193.183
  220.81.200.65
  220.81.234.126
  220.81.245.117
  220.81.251.220
+220.81.57.60
  220.82.165.202
  220.82.173.68
  220.83.183.250
  220.83.207.33
+220.84.126.136
+220.84.162.232
  220.84.210.10
  220.84.217.186
-220.84.248.58
+220.84.63.83
  220.84.67.123
  220.85.104.202
  220.85.112.68
  220.85.168.222
-220.85.206.96
  220.85.222.97
  220.85.224.183
  220.85.228.122
@@ -99225,6 +93571,7 @@
  220.86.146.229
  220.86.227.220
  220.86.29.35
+220.86.61.166
  220.86.67.9
  220.86.74.75
  220.87.154.188
@@ -99247,11 +93594,15 @@
  220.89.144.64
  220.89.32.59
  220.89.71.36
+220.90.121.40
  220.90.159.158
+220.90.165.250
  220.90.171.194
  220.90.191.5
  220.90.247.2
  220.90.79.110
+220.90.8.49
+220.90.94.201
  220.92.158.71
  220.92.187.4
  220.92.208.5
@@ -99260,23 +93611,26 @@
  220.93.108.28
  220.93.153.142
  220.93.204.226
+220.93.21.169
  220.93.239.104
  220.93.35.130
  220.93.35.148
  220.93.35.203
  220.93.35.229
+220.93.35.95
  220.93.40.246
  220.93.72.52
  220.94.124.83
+220.94.4.14
  220.94.53.193
  220.94.53.197
  220.94.66.153
  220.94.66.153bin.sh
  220.94.85.36
  220.94.87.179
+220.95.124.142
  220.95.14.28
  220.95.2.188
-220.96.225.2
  220.99.118.174
  220betasus.com
  220market.net
@@ -99311,7 +93665,6 @@
  221.10.141.8
  221.10.22.164
  221.10.98.134
-221.11.104.118
  221.11.20.103
  221.11.20.107
  221.11.245.180
@@ -99319,13 +93672,12 @@
  221.11.8.218
  221.113.241.94
  221.114.210.133
+221.12.100.170
  221.12.101.123
-221.12.173.66
  221.12.22.202
  221.120.189.209
  221.120.192.26
  221.120.207.68
-221.120.210.211
  221.120.218.74
  221.120.40.132
  221.120.98.49
@@ -99347,13 +93699,13 @@
  221.122.122.111
  221.122.122.67
  221.122.66.7
-221.122.67.66
  221.122.73.130
  221.122.75.22
  221.122.78.202
  221.122.78.206
  221.122.79.23
  221.122.80.107
+221.122.90.50
  221.122.93.178
  221.122.93.197
  221.123.158.152
@@ -99378,11 +93730,12 @@
  221.127.24.156
  221.127.26.11
  221.127.32.178
+221.13.149.116
  221.13.164.171
  221.13.177.150
  221.13.178.224
  221.13.184.36
-221.13.203.102
+221.13.245.106
  221.13.7.50
  221.13.74.246
  221.13.96.114
@@ -99408,18 +93761,18 @@
  221.139.50.13
  221.139.50.136
  221.14.106.124
-221.14.11.185
+221.14.11.12
  221.14.122.2
  221.14.122.28
  221.14.122.30
+221.14.160.165
  221.14.163.101
  221.14.163.106
  221.14.164.0
+221.14.166.82
  221.14.167.196
-221.14.178.157
  221.14.178.220
  221.14.199.110
-221.14.199.92
  221.14.243.168
  221.14.7.241
  221.141.1.113
@@ -99433,6 +93786,7 @@
  221.143.47.13
  221.143.48.143
  221.143.48.34
+221.144.109.17
  221.144.149.113
  221.144.164.208
  221.144.174.211
@@ -99440,6 +93794,7 @@
  221.144.178.231
  221.144.183.115
  221.144.183.87
+221.144.219.41
  221.144.67.206
  221.145.101.71
  221.145.12.215
@@ -99448,55 +93803,58 @@
  221.145.205.60
  221.145.217.115
  221.145.234.38
+221.146.119.109
  221.146.86.154
  221.146.91.207
  221.146.91.218
-221.147.106.79
  221.147.113.195
  221.147.217.119
  221.148.107.154
  221.148.123.67
  221.148.45.168
  221.149.122.41
+221.149.167.80
  221.149.224.87
  221.15.11.116
-221.15.118.54
-221.15.119.63
-221.15.143.182
+221.15.116.48
+221.15.126.2
+221.15.126.241
  221.15.144.127
+221.15.144.229
+221.15.144.23
  221.15.144.54
+221.15.144.74
  221.15.145.108
  221.15.145.124
  221.15.145.158
+221.15.145.20
  221.15.145.208
  221.15.145.228
-221.15.146.45
-221.15.153.165
-221.15.156.80
-221.15.159.144
+221.15.146.92
+221.15.147.58
+221.15.153.111
+221.15.153.58
  221.15.159.172
  221.15.170.244
-221.15.170.68
-221.15.171.227
+221.15.171.160
  221.15.175.14
+221.15.175.198
  221.15.176.96
  221.15.177.150
  221.15.177.54
-221.15.178.7
-221.15.179.162
-221.15.179.21
-221.15.181.77
-221.15.192.154
+221.15.179.4
+221.15.181.141
  221.15.192.185
  221.15.193.125
-221.15.195.128
  221.15.196.0
  221.15.196.210
+221.15.196.52
  221.15.197.211
-221.15.197.24
+221.15.198.120
  221.15.198.204
  221.15.20.65
-221.15.213.101
+221.15.21.5
+221.15.213.114
  221.15.214.24
  221.15.214.35
  221.15.216.225
@@ -99506,9 +93864,10 @@
  221.15.22.26
  221.15.224.195
  221.15.224.237
-221.15.224.244
  221.15.224.251
+221.15.225.150
  221.15.226.0
+221.15.226.231
  221.15.227.2
  221.15.231.155
  221.15.232.152
@@ -99523,29 +93882,27 @@
  221.15.239.108
  221.15.239.145
  221.15.253.13
-221.15.254.82
-221.15.255.45
  221.15.3.157
  221.15.4.174
-221.15.4.57
-221.15.5.54
+221.15.5.77
  221.15.54.162
  221.15.6.106
  221.15.6.110
-221.15.60.148
  221.15.62.155
  221.15.7.179
-221.15.7.87
-221.15.84.178
+221.15.87.8
  221.150.112.229
+221.150.178.198
  221.150.22.201
  221.150.221.34
  221.151.207.173
+221.151.207.81
  221.151.244.183
  221.152.197.234
  221.152.237.95
  221.152.240.189
  221.152.38.154
+221.153.108.220
  221.153.124.71
  221.153.164.10
  221.153.164.121
@@ -99563,18 +93920,19 @@
  221.153.88.100
  221.154.119.167
  221.154.25.206
-221.154.250.45
  221.154.72.249
+221.155.157.89
+221.155.161.112
  221.155.171.204
  221.155.229.103
  221.155.237.218
  221.155.248.57
-221.155.59.5
  221.156.114.167
  221.156.122.221
  221.156.126.1
  221.156.127.16
  221.156.136.86
+221.156.182.23
  221.156.211.156
  221.156.222.42
  221.156.35.214
@@ -99583,7 +93941,6 @@
  221.157.164.194
  221.157.174.43
  221.157.191.178
-221.157.203.101
  221.157.214.220
  221.157.226.198
  221.157.88.113
@@ -99593,7 +93950,6 @@
  221.158.222.7
  221.159.12.37
  221.159.154.43
-221.159.155.198
  221.159.155.204
  221.159.155.221
  221.159.155.31
@@ -99603,11 +93959,11 @@
  221.159.237.189bin.sh
  221.159.238.103
  221.159.244.41
-221.159.65.11
  221.159.84.164
  221.160.109.57
  221.160.115.22
  221.160.129.2
+221.160.163.16
  221.160.173.22
  221.160.177.112
  221.160.177.153
@@ -99620,7 +93976,7 @@
  221.160.251.98
  221.160.254.135
  221.160.46.28
-221.160.7.41
+221.160.7.234
  221.161.187.166
  221.161.195.249
  221.161.222.60
@@ -99642,13 +93998,13 @@
  221.164.211.139bin.sh
  221.164.31.44
  221.164.65.72
+221.164.66.166
  221.165.13.155
  221.165.252.143
  221.166.250.205
  221.166.250.205bin.sh
  221.167.127.178
  221.167.214.35
-221.167.228.109
  221.167.242.146
  221.167.244.120
  221.167.26.29
@@ -99664,7 +94020,6 @@
  221.176.223.194
  221.178.135.9
  221.178.137.141
-221.178.190.8
  221.178.221.214
  221.178.223.155
  221.178.223.156
@@ -99692,25 +94047,21 @@
  221.178.56.85
  221.178.56.90
  221.178.56.95
-221.179.103.2
  221.179.119.58
  221.179.126.194
  221.179.173.90
  221.179.216.81
  221.180.170.104
  221.180.18.4
-221.180.206.13
-221.180.206.31
  221.180.206.67
+221.181.132.118
  221.181.173.56
-221.181.185.16
  221.182.0.8
  221.182.184.210
  221.182.20.248
  221.182.236.34
  221.182.236.66
  221.182.31.54
-221.182.36.41
  221.182.98.152
  221.188.201.104
  221.192.138.58
@@ -99722,16 +94073,15 @@
  221.193.195.25
  221.193.195.51
  221.193.216.20
-221.193.218.37
  221.193.240.217
  221.193.244.72
  221.194.102.131
-221.194.137.28
  221.194.153.133
  221.195.1.201
  221.195.1.27
  221.195.129.35
  221.195.189.144
+221.195.189.154
  221.195.242.248
  221.195.25.136
  221.195.36.69
@@ -99741,20 +94091,18 @@
  221.195.73.86
  221.196.124.46
  221.196.170.25
-221.197.222.53
  221.197.249.240
  221.198.197.109
  221.198.197.25
  221.198.198.13
-221.198.88.220
+221.198.4.64
  221.199.13.197
  221.199.171.114
  221.199.194.122
  221.199.56.98
-221.2.144.76
+221.2.144.41
  221.2.153.74
  221.2.155.199
-221.2.175.238
  221.2.178.211
  221.2.219.250
  221.2.229.42
@@ -99767,7 +94115,6 @@
  221.200.120.93
  221.200.14.13
  221.200.164.228
-221.200.169.19
  221.200.170.83
  221.200.203.233
  221.200.26.97
@@ -99775,25 +94122,21 @@
  221.200.8.162
  221.200.8.74
  221.200.9.123
-221.201.114.147
  221.201.114.158
  221.201.122.214
  221.201.124.26
  221.201.251.2
  221.202.11.145
  221.202.12.73
-221.202.122.253
  221.202.15.192
  221.202.153.81
  221.202.168.254
  221.202.221.150
  221.202.221.242
-221.202.223.17
  221.202.40.3
  221.202.42.82
  221.202.72.128
  221.202.75.4
-221.202.8.198
  221.202.8.8
  221.202.89.254
  221.202.9.132
@@ -99809,9 +94152,7 @@
  221.203.22.244
  221.203.22.245
  221.203.38.3
-221.203.41.74
  221.203.63.54
-221.203.72.124
  221.203.78.131
  221.203.84.87
  221.203.9.162
@@ -99830,19 +94171,19 @@
  221.206.153.90
  221.206.249.210
  221.207.120.241
-221.207.122.234
  221.207.138.245
  221.207.19.31
  221.207.201.124
  221.207.240.171
-221.207.8.251
  221.207.8.254
  221.207.83.92
  221.207.90.140
  221.208.13.6
+221.208.139.144
  221.208.196.152
  221.208.196.62
  221.208.204.112
+221.208.81.89
  221.209.10.202
  221.209.128.47
  221.209.17.222
@@ -99871,10 +94212,8 @@
  221.210.211.8
  221.210.36.71
  221.210.5.218
-221.210.80.136
  221.210.97.243
  221.212.210.246
-221.212.74.130
  221.213.115.48
  221.213.119.205
  221.213.119.246
@@ -99885,7 +94224,9 @@
  221.214.120.227
  221.214.120.249
  221.214.127.122
+221.214.128.23
  221.214.130.215
+221.214.144.153
  221.214.147.153
  221.214.154.68
  221.214.159.65
@@ -99936,7 +94277,6 @@
  221.216.142.54
  221.216.156.52
  221.216.193.189
-221.216.205.122
  221.216.205.26
  221.216.38.119
  221.216.95.120
@@ -99944,8 +94284,8 @@
  221.217.59.42
  221.218.97.205
  221.219.1.76
+221.219.135.114
  221.219.177.73
-221.219.212.170
  221.219.212.254
  221.220.142.103
  221.221.137.118
@@ -99963,6 +94303,7 @@
  221.224.61.218
  221.224.71.98
  221.224.9.154
+221.225.226.79
  221.225.81.86
  221.225.82.74
  221.226.102.85
@@ -99975,10 +94316,8 @@
  221.226.30.34
  221.226.38.166
  221.226.39.202
-221.226.43.62
  221.226.56.10
  221.226.56.210
-221.226.58.102
  221.226.63.179
  221.226.65.226
  221.226.70.186
@@ -99991,23 +94330,20 @@
  221.228.132.105
  221.228.197.98
  221.228.72.134
+221.228.77.19
  221.229.144.191
  221.229.145.66
  221.229.190.64
-221.229.196.55
  221.229.199.103
  221.229.204.196
-221.229.215.179
  221.229.218.12
-221.229.218.154
  221.229.218.40
-221.229.218.50
-221.229.219.188
  221.229.220.210
  221.229.223.2
  221.229.229.174
  221.229.252.226
  221.229.252.98
+221.229.44.103
  221.229.47.225
  221.231.113.90
  221.231.115.2
@@ -100027,13 +94363,13 @@
  221.233.79.14
  221.233.94.147
  221.234.19.109
-221.234.216.237
  221.234.44.132
  221.234.9.207
  221.235.140.10
  221.235.184.101
  221.235.53.173
  221.235.72.170
+221.236.109.114
  221.236.109.197
  221.236.109.206
  221.236.35.38
@@ -100058,32 +94394,28 @@
  221.3.21.218
  221.3.27.182
  221.3.32.216
+221.3.38.75
  221.3.39.75
-221.3.44.5
  221.3.45.116
  221.3.66.153
-221.3.81.49
  221.3.83.62
  221.3.86.229
  221.3.87.204
  221.3.89.189
  221.4.132.3
-221.4.149.84
  221.4.201.51
-221.4.223.212
  221.5.213.189
  221.5.31.159
  221.5.51.206
  221.5.80.102
  221.5.80.66
-221.6.105.62
  221.6.109.5
  221.6.114.149
  221.6.198.254
-221.6.22.203
  221.6.32.34
  221.7.175.12
  221.7.213.133
+221.7.223.18
  221.7.227.72
  221.7.255.168
  221.7.66.56
@@ -100097,6 +94429,7 @@
  221.8.235.28
  221.8.31.27
  221.8.37.226
+221.8.52.73
  221.8.69.25
  221.9.184.179
  221.9.187.224
@@ -100112,7 +94445,6 @@
  221995a.com
  221betasus.com
  222.100.155.56
-222.100.171.208
  222.100.201.221
  222.100.228.225
  222.100.237.242
@@ -100132,8 +94464,6 @@
  222.102.166.115
  222.102.166.170
  222.102.166.62
-222.102.185.66
-222.102.5.253
  222.103.134.193
  222.103.162.215
  222.103.172.111
@@ -100143,17 +94473,16 @@
  222.103.231.206
  222.103.233.233
  222.103.239.170
-222.104.137.106
-222.104.177.185
+222.103.255.32
+222.104.206.112
+222.104.222.69
  222.104.247.109
  222.104.247.109bin.sh
-222.104.9.180
+222.104.98.60
  222.105.1.89
  222.105.114.14
  222.105.171.44
-222.105.171.66
  222.105.171.70
-222.105.177.33
  222.105.203.161
  222.105.217.221
  222.105.226.99
@@ -100171,6 +94500,10 @@
  222.108.100.241
  222.108.213.43
  222.108.56.238
+222.108.72.166
+222.109.128.117
+222.109.130.103
+222.109.2.105
  222.109.234.67
  222.109.248.188
  222.109.26.50
@@ -100184,8 +94517,11 @@
  222.111.66.33
  222.112.158.200
  222.112.2.21
+222.112.202.40
  222.112.220.12
  222.112.247.204
+222.113.120.70
+222.113.136.236
  222.113.146.220
  222.113.156.56
  222.113.184.193
@@ -100199,11 +94535,13 @@
  222.114.206.142
  222.114.21.218
  222.114.215.49
+222.114.222.50
  222.114.230.229
  222.114.3.23
  222.114.4.69
  222.114.43.115
  222.114.70.188
+222.114.70.246
  222.114.85.2
  222.114.95.114
  222.114.98.62
@@ -100226,17 +94564,22 @@
  222.118.140.89
  222.118.162.243
  222.118.246.19
+222.118.58.209
  222.118.84.75
  222.118.99.179
  222.119.125.236
  222.119.16.92
  222.119.20.68
+222.119.218.5
  222.120.14.251
+222.120.173.52
  222.121.138.169
  222.121.138.172
  222.121.138.189
  222.121.141.168
  222.121.216.157
+222.121.251.243
+222.121.251.85
  222.121.3.205
  222.121.59.89
  222.121.8.67
@@ -100253,7 +94596,6 @@
  222.122.45.146
  222.122.45.223
  222.122.45.62
-222.122.60.110
  222.122.60.175
  222.124.1.226
  222.124.11.139
@@ -100261,7 +94603,6 @@
  222.124.155.106
  222.124.17.227
  222.124.170.66
-222.124.18.146
  222.124.200.250
  222.124.29.18
  222.124.30.138
@@ -100271,15 +94612,12 @@
  222.127.133.58
  222.127.151.230
  222.127.226.225
-222.127.97.91
  222.128.11.75
  222.128.126.51
-222.128.127.25
  222.128.14.106
  222.128.15.208
  222.128.46.27
  222.128.51.106
-222.128.6.194
  222.128.60.162
  222.128.60.184
  222.128.87.85
@@ -100288,7 +94626,7 @@
  222.129.23.83
  222.130.135.145
  222.132.156.2
-222.132.156.3
+222.132.161.77
  222.132.180.124
  222.132.189.4
  222.132.77.14
@@ -100299,6 +94637,7 @@
  222.133.26.118
  222.133.51.18
  222.134.108.62
+222.134.144.190
  222.134.240.141
  222.134.38.158
  222.134.70.166
@@ -100313,27 +94652,25 @@
  222.135.24.18
  222.135.50.65
  222.135.77.101
-222.135.85.97
  222.136.101.222
+222.136.101.229
  222.136.145.24
  222.136.145.8
  222.136.149.104
  222.136.150.147
-222.136.153.127
  222.136.158.20
  222.136.159.99
  222.136.212.112
  222.136.243.229
-222.136.252.203
  222.136.43.229
+222.136.56.206
  222.136.58.44
-222.136.61.76
-222.136.75.24
  222.136.81.43
  222.136.82.220
  222.137.0.44
  222.137.1.11
  222.137.107.212
+222.137.107.214
  222.137.120.106
  222.137.120.11
  222.137.120.141
@@ -100342,20 +94679,19 @@
  222.137.120.37
  222.137.120.62
  222.137.120.96
-222.137.122.112
+222.137.121.131
+222.137.122.123
  222.137.122.127
  222.137.122.142
-222.137.122.33
-222.137.122.62
-222.137.122.85
  222.137.122.90
-222.137.123.110
-222.137.123.14
  222.137.123.156
  222.137.123.188
  222.137.123.221
-222.137.128.157
+222.137.123.228
+222.137.123.49
  222.137.136.116
+222.137.136.146
+222.137.136.160
  222.137.136.188
  222.137.136.35
  222.137.136.9
@@ -100372,11 +94708,12 @@
  222.137.139.109
  222.137.139.188
  222.137.139.4
-222.137.145.120
-222.137.153.68
+222.137.156.222
  222.137.158.189
-222.137.160.156
-222.137.162.140
+222.137.161.46
+222.137.162.16
+222.137.162.17
+222.137.163.179
  222.137.167.117
  222.137.168.113
  222.137.168.23
@@ -100385,175 +94722,170 @@
  222.137.172.128
  222.137.175.219
  222.137.178.26
-222.137.179.32
  222.137.179.79
-222.137.182.135
-222.137.19.79
-222.137.190.200
-222.137.197.96
+222.137.191.204
+222.137.191.38
  222.137.2.47
-222.137.20.108
+222.137.201.6
  222.137.208.123
  222.137.208.186
  222.137.208.39
  222.137.208.61
  222.137.209.103
-222.137.212.80
+222.137.209.111
  222.137.213.73
  222.137.215.6
  222.137.215.83
-222.137.220.219
-222.137.233.121
+222.137.230.103
  222.137.237.212
  222.137.24.191
-222.137.26.28
+222.137.28.148
+222.137.33.157
  222.137.34.182
-222.137.34.219
-222.137.35.225
-222.137.4.209
+222.137.39.234
  222.137.41.155
+222.137.43.249
  222.137.5.102
  222.137.5.44
  222.137.5.69
  222.137.50.160
-222.137.52.140
  222.137.76.194
  222.137.78.22
  222.137.78.253
+222.137.8.143
  222.137.8.67
-222.137.87.214
-222.138.100.117
+222.137.9.201
+222.137.9.29
  222.138.100.227
  222.138.101.2
+222.138.101.221
+222.138.101.83
  222.138.102.183
+222.138.102.215
  222.138.102.73
  222.138.103.158
-222.138.116.70
-222.138.117.166
-222.138.118.201
+222.138.112.113
+222.138.113.160
+222.138.116.16
+222.138.119.244
  222.138.119.78
  222.138.122.73
  222.138.123.202
  222.138.123.93
+222.138.135.80
  222.138.138.174
-222.138.167.103
  222.138.174.120
  222.138.174.182
  222.138.174.243
-222.138.175.152
+222.138.176.119
  222.138.176.135
+222.138.176.18
  222.138.177.242
  222.138.179.196
+222.138.18.34
  222.138.180.34
  222.138.181.119
-222.138.181.32
-222.138.181.63
+222.138.181.206
+222.138.182.39
  222.138.182.94
  222.138.183.239
  222.138.184.55
-222.138.188.173
-222.138.19.20
  222.138.190.135
+222.138.20.136
  222.138.20.244
  222.138.201.98
-222.138.205.167
  222.138.205.74
  222.138.207.3
  222.138.207.77
  222.138.227.189
+222.138.238.206
+222.138.244.194
+222.138.39.193
  222.138.54.62
  222.138.76.91
  222.138.76.96
+222.138.91.173
+222.138.95.132
  222.138.96.44
  222.138.96.7
  222.138.96.76
+222.138.96.86
  222.138.99.105
  222.138.99.132
  222.138.99.8
-222.139.125.209
+222.139.192.240
  222.139.209.19
-222.139.216.25
+222.139.214.55
  222.139.224.153
-222.139.245.70
  222.139.28.84
+222.139.29.109
+222.139.51.95
  222.139.53.73
+222.139.54.52
+222.139.65.60
  222.139.81.170
-222.139.82.57
-222.139.86.198
  222.140.105.137
-222.140.107.133
+222.140.114.39
  222.140.116.115
  222.140.123.16
  222.140.125.92
  222.140.127.154
-222.140.129.37
-222.140.131.125
-222.140.156.41
-222.140.16.238
-222.140.161.135
-222.140.168.164
+222.140.130.162
+222.140.134.113
+222.140.163.208
  222.140.172.241
  222.140.177.223
-222.140.179.102
  222.140.185.43
  222.140.19.172
  222.140.217.153
  222.140.252.3
-222.140.255.60
+222.140.34.150
  222.140.6.20
  222.140.72.174
  222.140.78.238
-222.140.9.136
-222.141.107.41
+222.140.8.242
+222.141.106.171
+222.141.11.237
  222.141.11.54
-222.141.116.51
-222.141.116.93
  222.141.12.245
+222.141.120.196
  222.141.120.77
-222.141.122.35
  222.141.124.42
+222.141.13.209
  222.141.136.207
  222.141.14.132
-222.141.143.0
-222.141.144.33
  222.141.149.69
-222.141.15.167
+222.141.15.71
  222.141.161.195
-222.141.164.67
  222.141.167.216
-222.141.170.121
-222.141.174.8
  222.141.185.12
  222.141.22.251
-222.141.255.156
+222.141.244.110
+222.141.41.86
  222.141.44.196
-222.141.44.240
-222.141.45.26
+222.141.45.95
  222.141.46.18
  222.141.46.239
-222.141.47.192
-222.141.47.9
-222.141.61.246
-222.141.89.165
+222.141.61.180
+222.141.79.243
+222.141.8.111
  222.141.89.216
  222.142.113.51
  222.142.141.208
-222.142.153.151
+222.142.181.118
  222.142.202.158
-222.142.208.94
-222.142.209.208
  222.142.210.79
  222.142.211.103
  222.142.211.108
  222.142.211.190
+222.142.211.86
  222.142.223.3
-222.142.237.105
+222.142.234.169
  222.142.237.129
-222.142.246.117
+222.142.248.92
  222.142.250.220
  222.142.252.168
  222.142.252.77
-222.142.255.237
  222.142.44.156
  222.143.26.79
  222.148.98.230
@@ -100564,6 +94896,7 @@
  222.160.220.19
  222.160.226.14
  222.160.231.151
+222.160.237.29
  222.160.65.50
  222.160.78.94
  222.161.121.72
@@ -100578,6 +94911,7 @@
  222.162.12.107
  222.162.197.234
  222.162.249.204
+222.162.42.182
  222.162.42.210
  222.162.42.59
  222.162.7.118
@@ -100594,8 +94928,8 @@
  222.163.37.174
  222.163.61.170
  222.164.102.195
+222.164.149.227
  222.164.79.21
-222.165.186.51
  222.165.194.67
  222.165.194.68
  222.165.197.230
@@ -100607,7 +94941,6 @@
  222.166.204.36
  222.166.216.104
  222.167.142.155
-222.167.156.220
  222.168.130.186
  222.168.18.227
  222.168.30.18
@@ -100619,6 +94952,7 @@
  222.170.149.123
  222.170.167.162
  222.170.37.22
+222.170.37.95
  222.170.61.66
  222.170.86.42
  222.171.105.242
@@ -100626,7 +94960,6 @@
  222.171.78.203
  222.172.176.219
  222.172.221.238
-222.173.12.35
  222.173.12.98
  222.173.217.146
  222.173.38.41
@@ -100653,7 +94986,6 @@
  222.179.90.110
  222.180.150.130
  222.180.151.86
-222.180.162.8
  222.180.208.14
  222.180.250.42
  222.184.102.46
@@ -100667,7 +94999,6 @@
  222.184.35.115
  222.184.35.137
  222.184.35.139
-222.184.61.150
  222.184.7.26
  222.184.76.162
  222.184.89.186
@@ -100683,7 +95014,6 @@
  222.185.199.202
  222.185.203.225
  222.185.210.11
-222.185.213.217
  222.185.231.246
  222.185.235.139
  222.185.235.186
@@ -100697,8 +95027,6 @@
  222.185.42.110
  222.185.73.210
  222.185.77.105
-222.185.77.134
-222.185.77.147
  222.185.85.228
  222.186.10.154
  222.186.11.228
@@ -100708,6 +95036,7 @@
  222.186.136.123
  222.186.136.150
  222.186.138.148
+222.186.138.28
  222.186.138.56
  222.186.139.94
  222.186.15.43
@@ -100719,6 +95048,7 @@
  222.186.20.57
  222.186.20.77
  222.186.21.147
+222.186.24.109
  222.186.24.192
  222.186.24.66
  222.186.24.74
@@ -100748,6 +95078,7 @@
  222.187.164.187
  222.187.164.188
  222.187.180.157
+222.187.181.130
  222.187.183.88
  222.187.188.200
  222.187.19.108
@@ -100756,16 +95087,16 @@
  222.187.221.88
  222.187.224.132
  222.187.45.234
+222.187.65.14
  222.187.70.6
  222.187.83.243
  222.188.131.220
  222.188.136.124
-222.188.136.156
-222.188.136.161
  222.188.136.22
  222.188.190.206
  222.188.211.234
  222.188.221.118
+222.188.231.30
  222.188.243.137
  222.188.243.195
  222.188.243.225
@@ -100781,6 +95112,7 @@
  222.189.191.123
  222.189.228.131
  222.189.238.236
+222.189.246.70
  222.19.137.25
  222.19.137.26
  222.190.110.196
@@ -100791,8 +95123,6 @@
  222.190.143.206
  222.190.145.130
  222.190.154.234
-222.190.222.98
-222.191.255.26
  222.192.176.220
  222.192.176.45
  222.192.176.57
@@ -100801,7 +95131,6 @@
  222.192.88.101
  222.192.88.105
  222.192.88.52
-222.192.88.54
  222.192.88.60
  222.192.88.62
  222.192.88.65
@@ -100827,7 +95156,9 @@
  222.209.22.149
  222.209.223.91
  222.209.232.24
+222.209.246.214
  222.209.54.193
+222.209.59.122
  222.209.59.179
  222.209.85.197
  222.210.132.87
@@ -100837,7 +95168,6 @@
  222.211.148.83
  222.211.162.123
  222.211.163.233
-222.211.177.227
  222.212.141.178
  222.212.238.154
  222.212.81.137
@@ -100845,6 +95175,7 @@
  222.212.93.19
  222.213.136.78
  222.214.254.167
+222.214.50.141
  222.215.161.142
  222.215.214.10
  222.215.245.162
@@ -100852,7 +95183,6 @@
  222.215.70.166
  222.216.163.69
  222.216.206.143
-222.216.209.18
  222.217.124.78
  222.217.125.198
  222.217.17.51
@@ -100880,10 +95210,13 @@
  222.220.145.169
  222.220.145.207
  222.220.145.55
+222.220.157.47
  222.220.162.172
  222.220.229.121
  222.220.234.113
+222.220.35.31
  222.221.248.242
+222.221.36.120
  222.221.36.63
  222.221.91.153
  222.221.94.136
@@ -100891,7 +95224,6 @@
  222.222.141.113
  222.222.158.23
  222.222.177.80
-222.222.178.22
  222.222.181.214
  222.222.209.147
  222.222.209.149
@@ -100910,7 +95242,7 @@
  222.223.254.125
  222.223.29.110
  222.223.93.194
-222.228.9.169
+222.229.109.174
  222.23.86.45
  222.231.1.69
  222.231.3.128
@@ -100922,7 +95254,6 @@
  222.233.38.252
  222.234.103.90
  222.234.2.152
-222.234.49.69
  222.234.72.23
  222.235.172.14
  222.235.67.132
@@ -100947,6 +95278,7 @@
  222.240.1.0
  222.240.152.132
  222.240.159.67
+222.240.169.10
  222.240.169.12
  222.240.184.126
  222.240.202.162
@@ -100971,39 +95303,30 @@
  222.243.89.144
  222.244.139.113
  222.244.139.132
-222.244.144.163
  222.244.146.232
  222.244.147.183
  222.245.76.42
-222.246.243.238
+222.246.41.52
  222.246.64.221
  222.246.64.62
-222.246.65.230
  222.246.65.51
-222.247.56.5
  222.249.173.26
  222.249.179.174
  222.249.228.37
  222.249.232.90
  222.249.235.234
-222.252.11.10
  222.252.11.236
-222.252.112.6
+222.252.148.137
  222.252.148.190
-222.252.148.208
-222.252.156.61
  222.252.20.20
-222.252.22.193
  222.252.25.168
  222.252.25.186
  222.252.25.241
  222.252.28.31
  222.252.30.29
-222.252.31.191
  222.253.253.168
-222.253.33.14
+222.253.79.26
  222.254.34.129
-222.255.114.251
  222.255.115.237
  222.255.135.243
  222.255.167.104
@@ -101011,13 +95334,9 @@
  222.255.46.58
  222.32.70.174
  222.34.19.112
-222.4.52.149
-222.41.193.211
  222.44.176.113
  222.52.5.5
  222.58.151.67
-222.64.102.120
-222.64.170.223
  222.64.19.187
  222.64.209.104
  222.65.114.193
@@ -101027,9 +95346,6 @@
  222.65.45.188
  222.66.154.98
  222.66.203.60
-222.67.16.152
-222.67.20.51
-222.67.21.31
  222.67.230.166
  222.67.231.1
  222.69.128.119
@@ -101039,21 +95355,21 @@
  222.69.242.163
  222.70.181.55
  222.70.218.3
+222.70.79.9
  222.70.81.124
  222.70.82.49
  222.72.135.108
  222.72.135.98
-222.72.137.109
  222.72.38.22
  222.73.129.15
  222.73.129.45
  222.73.134.185
  222.73.136.144
+222.73.136.163
  222.73.136.205
  222.73.17.7
-222.73.180.219
-222.73.202.117
  222.73.215.81
+222.73.22.8
  222.73.247.91
  222.73.249.45
  222.73.44.37
@@ -101064,6 +95380,7 @@
  222.73.7.242
  222.73.85.107
  222.73.85.76
+222.74.136.222
  222.74.16.162
  222.74.186.134
  222.74.186.136
@@ -101078,15 +95395,14 @@
  222.75.1.197
  222.75.1.42
  222.76.126.213
-222.76.42.211
  222.76.66.110
  222.76.8.22
  222.76.9.205
-222.77.206.247
  222.77.215.224
  222.78.185.234
  222.78.2.250
  222.78.201.180
+222.78.248.133
  222.78.4.102
  222.79.16.150
  222.79.16.19
@@ -101094,11 +95410,9 @@
  222.79.17.128
  222.79.48.123
  222.79.49.230
-222.79.61.45
  222.80.110.191
  222.80.132.148
  222.80.148.4
-222.80.156.115
  222.80.170.172
  222.80.172.181
  222.80.240.242
@@ -101112,7 +95426,6 @@
  222.81.15.33
  222.81.153.248
  222.81.154.52
-222.81.156.100
  222.81.157.148
  222.81.28.26
  222.81.31.104
@@ -101141,7 +95454,6 @@
  222.85.110.36
  222.85.110.39
  222.85.130.66
-222.85.140.116
  222.85.29.121
  222.86.145.202
  222.86.192.246
@@ -101160,13 +95472,10 @@
  222.88.92.227
  222.89.166.120
  222.89.178.60
-222.89.236.71
  222.90.111.62
  222.90.117.159
  222.90.143.208
  222.90.211.2
-222.90.31.169
-222.90.31.186
  222.90.43.110
  222.90.79.50
  222.91.97.134
@@ -101191,7 +95500,7 @@
  222.94.89.112
  222.94.90.215
  222.94.92.221
-222.95.134.120
+222.94.92.245
  222.95.172.59
  222.95.181.42
  222.95.181.56
@@ -101200,9 +95509,10 @@
  222.96.155.188
  222.96.156.84
  222.96.237.2
+222.96.29.55
  222.96.50.40
  222.96.71.250
-222.96.77.64
+222.96.92.154
  222.96.94.72
  222.97.104.205
  222.97.126.167
@@ -101215,7 +95525,7 @@
  222.98.159.9
  222.98.171.132
  222.98.173.216
-222.98.222.120
+222.98.179.37
  222.98.223.130
  222.98.249.244
  222.98.34.101
@@ -101233,7 +95543,6 @@
  222.99.196.220
  222.99.209.34
  222.99.52.216
-222.99.84.121
  222v333.com
  223.10.0.117
  223.10.181.67
@@ -101246,15 +95555,14 @@
  223.100.140.10
  223.100.167.105
  223.100.17.190
-223.100.176.126
  223.100.206.115
  223.100.22.69
  223.100.224.216
  223.100.236.98
  223.100.26.170
  223.100.68.145
-223.100.7.112
  223.100.83.248
+223.106.12.27
  223.111.150.152
  223.111.150.171
  223.111.157.138
@@ -101293,15 +95601,16 @@
  223.135.189.25
  223.145.145.7
  223.145.146.2
-223.145.16.70
  223.145.197.66
  223.15.14.29
  223.15.163.144
-223.150.130.97
+223.150.115.34
+223.150.181.11
+223.150.223.167
  223.150.225.51
+223.150.230.238
  223.150.250.107
-223.150.34.193
-223.150.69.216
+223.150.77.149
  223.154.4.159
  223.154.80.169
  223.154.80.173
@@ -101319,6 +95628,7 @@
  223.16.112.126
  223.16.120.242
  223.16.14.42
+223.16.14.88
  223.16.140.248
  223.16.142.96
  223.16.165.142
@@ -101329,7 +95639,6 @@
  223.16.193.164
  223.16.194.146
  223.16.206.21
-223.16.213.250
  223.16.229.241
  223.16.30.175
  223.16.71.172
@@ -101383,7 +95692,6 @@
  223.18.64.147
  223.18.79.247
  223.180.181.127
-223.181.227.40
  223.19.119.112
  223.19.119.152
  223.19.139.125
@@ -101397,10 +95705,8 @@
  223.194.176.22
  223.194.4.201
  223.196.67.195
-223.197.125.10
  223.197.136.59
  223.197.136.82
-223.197.146.58
  223.197.151.55
  223.197.164.62
  223.197.168.60
@@ -101420,12 +95726,12 @@
  223.198.26.196
  223.199.10.197
  223.199.12.181
-223.199.19.31
  223.199.21.89
  223.199.28.163
  223.199.8.50
-223.200.72.249
  223.202.212.98
+223.205.109.169
+223.205.180.31
  223.206.145.19
  223.206.216.241
  223.206.234.13
@@ -101436,7 +95742,6 @@
  223.207.255.8
  223.211.95.221
  223.212.209.183
-223.212.211.103
  223.212.226.218
  223.212.234.84
  223.212.252.18
@@ -101447,7 +95752,6 @@
  223.213.138.201
  223.213.138.76
  223.213.144.4
-223.214.69.233
  223.215.186.96
  223.218.42.143
  223.22.233.27
@@ -101458,42 +95762,31 @@
  223.220.168.22
  223.220.175.166
  223.220.251.232
-223.221.31.51
  223.221.36.149
  223.222.12.54
-223.222.247.244
  223.223.142.16
  223.223.156.5
  223.223.176.184
  223.223.177.131
  223.223.187.2
  223.223.187.9
-223.223.190.130
-223.223.190.131
  223.223.194.101
  223.223.194.58
  223.223.199.60
-223.223.200.14
  223.223.204.221
  223.223.205.114
  223.223.205.117
  223.223.205.194
  223.223.205.229
  223.235.201.33
-223.235.205.181
  223.240.103.61
  223.240.104.222
-223.240.105.212
-223.240.121.68
+223.240.208.15
  223.240.208.175
-223.240.237.95
-223.240.65.149
  223.240.65.72
  223.240.70.4
+223.240.71.236
  223.240.78.80
-223.240.80.31
-223.240.81.251
-223.240.86.204
  223.240.93.176
  223.241.117.86
  223.241.118.12
@@ -101503,7 +95796,6 @@
  223.242.165.49
  223.242.165.70
  223.242.165.87
-223.244.128.113
  223.244.129.147
  223.244.170.156
  223.244.170.16
@@ -101514,26 +95806,22 @@
  223.244.171.81
  223.244.233.104
  223.244.237.75
-223.244.83.13
+223.244.97.7
+223.245.213.198
  223.247.0.63
  223.247.130.195
-223.247.140.89
  223.247.153.244
+223.247.156.49
  223.247.188.145
  223.247.194.119
  223.247.194.43
-223.247.197.50
  223.247.199.243
  223.247.201.32
  223.247.205.249
-223.247.206.180
  223.247.207.75
  223.247.218.112
-223.247.219.165
  223.247.219.47
  223.247.219.87
-223.247.223.194
-223.247.223.39
  223.25.111.8
  223.25.14.66
  223.25.247.233
@@ -101542,16 +95830,11 @@
  223.25.68.202
  223.25.99.163
  223.25.99.37
-223.252.6.16
  223.252.75.173
  223.255.132.190
-223.255.185.140
  223.255.185.90
  223.255.28.203
-223.27.108.162
-223.27.108.170
  223.27.108.2
-223.27.108.235
  223.27.109.10
  223.27.109.11
  223.27.109.12
@@ -101576,14 +95859,12 @@
  223.27.194.66
  223.27.255.162
  223.27.255.190
-223.27.39.160
  223.28.171.131
  223.29.204.245
  223.29.204.246
-223.29.207.214
  223.31.191.50
-223.4.66.84
-223.68.169.180
+223.4.71.151
+223.65.206.170
  223.68.171.26
  223.68.188.242
  223.68.190.130
@@ -101597,14 +95878,11 @@
  223.70.176.202
  223.70.176.75
  223.70.181.102
-223.70.214.103
-223.70.214.119
  223.70.217.2
  223.70.239.10
  223.70.253.3
  223.71.167.171
  223.71.210.165
-223.71.227.134
  223.71.232.246
  223.71.26.10
  223.71.26.138
@@ -101612,26 +95890,24 @@
  223.71.26.154
  223.71.42.105
  223.71.63.130
-223.71.73.253
  223.71.78.154
  223.71.80.37
  223.72.152.57
  223.72.152.59
  223.72.165.115
-223.72.225.194
  223.72.74.245
  223.72.85.125
+223.74.148.111
  223.75.104.212
  223.75.104.222
  223.75.104.251
+223.75.116.49
  223.75.13.131
  223.75.13.132
  223.75.142.243
  223.75.152.101
  223.75.162.26
-223.75.162.79
  223.75.167.161
-223.75.168.29
  223.75.175.52
  223.75.218.60
  223.75.50.73
@@ -101648,11 +95924,9 @@
  223.80.102.185
  223.80.104.51
  223.80.107.211
-223.80.108.199
  223.80.111.9
  223.80.188.48
  223.80.37.6
-223.80.91.119
  223.81.192.191
  223.82.0.48
  223.82.0.51
@@ -101673,17 +95947,14 @@
  223.84.247.233
  223.84.247.234
  223.84.61.232
-223.85.112.162
  223.85.13.42
  223.85.202.106
  223.85.205.58
-223.85.222.14
  223.85.224.30
  223.85.224.31
  223.85.66.157
  223.86.54.242
  223.88.62.145
-223.88.62.158
  223.88.62.233
  223.88.62.70
  223.88.62.71
@@ -101692,37 +95963,32 @@
  223.88.65.226
  223.9.149.141
  223.91.151.61
-223.92.128.12
  223.93.130.231
  223.93.140.130
  223.93.157.236
  223.93.157.244
  223.93.171.204
  223.93.171.210
-223.93.185.204
  223.93.188.234
  223.93.66.135
  223.94.142.237
  223.94.44.161
  223.95.112.107
  223.95.112.33
-223.95.186.74
  223.95.193.47
  223.95.254.183
-223.95.254.187
  223.95.37.235
  223.95.76.70
  223.95.86.157
  223.95.98.93
  223.96.91.105
  223.98.186.107
-223.99.126.67
+223.99.15.231
  223.99.18.171
  223.99.198.227
  223.99.203.186
  223.99.207.60
  223.99.216.130
-223.99.248.117
  223.99.9.133
  22334444.com
  224001.selcdn.ru
@@ -101756,11 +96022,10 @@
  23.100.51.1
  23.100.56.88
  23.100.68.66
+23.101.119.165
  23.101.123.2
  23.101.126.202
  23.101.142.235
-23.101.150.169
-23.101.154.243
  23.101.156.218
  23.101.164.210
  23.101.171.51
@@ -101783,24 +96048,19 @@
  23.104.161.139
  23.104.161.187
  23.104.161.195
-23.104.161.227
  23.104.161.232
-23.104.161.241
  23.104.161.70
  23.104.184.176
  23.104.184.183
-23.104.184.76
+23.104.184.31
  23.105.157.246
  23.105.157.44
  23.105.157.51
  23.105.159.108
  23.105.159.131
  23.105.159.146
-23.105.159.203
  23.105.159.23
-23.105.159.30
  23.105.159.31
-23.105.196.142
  23.105.203.158
  23.105.207.225
  23.105.213.174
@@ -101831,28 +96091,23 @@
  23.106.58.181
  23.106.58.183
  23.107.13.123
-23.107.176.88
-23.108.252.121
  23.108.252.187
  23.108.252.31
  23.108.252.96
  23.108.254.108
  23.108.254.182
  23.108.254.4
-23.108.254.60
  23.108.4.144
  23.108.4.225
  23.108.4.77
+23.108.42.27
  23.108.44.67
  23.108.45.188
-23.108.45.212
  23.108.45.251
  23.108.47.29
  23.108.48.132
  23.108.50.167
-23.108.50.51
  23.108.86.18
-23.108.86.208
  23.111.114.116
  23.111.114.196
  23.111.136.190
@@ -101869,7 +96124,6 @@
  23.122.142.209
  23.122.176.100
  23.123.181.116
-23.125.186.135
  23.129.64.100
  23.129.64.102
  23.129.64.11
@@ -101910,7 +96164,6 @@
  23.129.64.216
  23.129.64.217
  23.129.64.227
-23.130.192.151
  23.133.5.144
  23.133.5.152
  23.133.5.160
@@ -101919,12 +96172,10 @@
  23.133.5.241
  23.133.5.253
  23.136.64.8
-23.141.128.237
  23.141.240.206
  23.146.144.13
  23.146.144.156
  23.146.144.85
-23.146.240.118
  23.146.240.230
  23.148.64.114
  23.152.0.123
@@ -101940,13 +96191,13 @@
  23.16.231.177
  23.16.24.244
  23.16.69.38
+23.160.193.39
  23.160.208.245
  23.160.208.246
  23.160.208.247
  23.160.208.248
  23.160.208.249
  23.160.208.250
-23.160.240.161
  23.163.0.100
  23.163.0.146
  23.163.0.62
@@ -101957,6 +96208,7 @@
  23.17.9.24
  23.175.0.200
  23.175.0.202
+23.175.0.212
  23.175.0.222
  23.177.160.52
  23.19.248.129
@@ -101987,7 +96239,6 @@
  23.224.20.13
  23.224.229.98
  23.224.37.18
-23.225.154.67
  23.225.169.106
  23.225.171.205
  23.225.197.86
@@ -102020,32 +96271,30 @@
  23.228.96.82
  23.229.10.103
  23.229.111.174
-23.229.13.208
  23.229.13.213
  23.229.13.222
  23.229.13.39
  23.229.13.57
  23.229.14.20
-23.229.14.216
  23.229.14.25
  23.229.25.76
  23.229.25.92
+23.229.25.97
  23.229.29.224
  23.229.34.84
  23.229.35.235
+23.229.35.239
+23.229.35.32
+23.229.35.55
  23.229.55.153
  23.229.55.163
-23.229.57.151
+23.229.57.244
  23.229.57.248
-23.229.58.23
  23.229.58.235
-23.229.58.24
-23.229.58.28
  23.229.70.172
  23.229.73.170
  23.229.73.68
  23.229.73.73
-23.229.73.74
  23.229.73.93
  23.229.75.2
  23.229.75.24
@@ -102053,6 +96302,7 @@
  23.229.76.68
  23.229.88.199
  23.229.90.254
+23.229.92.187
  23.23.181.36
  23.23.185.97
  23.23.208.27
@@ -102065,21 +96315,22 @@
  23.230.98.234
  23.231.13.119
  23.231.13.133
+23.231.15.128
  23.231.15.23
  23.231.15.80
-23.231.32.112
-23.231.32.183
+23.231.32.172
  23.231.32.200
-23.231.32.206
+23.231.32.240
  23.231.32.38
  23.231.32.41
-23.231.32.90
+23.231.32.75
  23.231.32.92
  23.231.32.97
  23.231.34.114
-23.231.34.24
+23.231.34.215
  23.231.37.128
  23.231.37.27
+23.231.39.76
  23.233.107.21
  23.233.124.117
  23.233.48.14
@@ -102087,8 +96338,8 @@
  23.235.199.28
  23.235.221.57
  23.235.227.124
-23.235.251.68
  23.235.252.219
+23.235.253.46
  23.236.126.45
  23.236.131.160
  23.236.148.13
@@ -102098,36 +96349,29 @@
  23.236.148.8
  23.236.181.34
  23.236.210.176
-23.236.210.177
-23.236.221.211
-23.236.221.248
+23.236.210.199
+23.236.221.177
+23.236.221.251
  23.236.221.46
-23.236.223.16
-23.236.223.176
+23.236.221.83
  23.236.223.19
-23.236.223.27
  23.236.223.28
+23.236.227.136
  23.236.228.14
-23.236.228.245
  23.236.228.76
  23.236.228.89
  23.236.228.90
-23.236.228.92
  23.236.229.213
-23.236.229.215
-23.236.229.234
-23.236.229.243
+23.236.229.235
+23.236.229.239
  23.236.229.244
-23.236.229.4
-23.236.229.40
+23.236.229.250
  23.236.231.53
  23.236.231.68
-23.236.232.195
  23.236.232.218
-23.236.232.86
+23.236.232.95
  23.236.238.24
  23.236.242.206
-23.236.254.130
  23.236.49.71
  23.236.53.163
  23.236.57.243
@@ -102136,12 +96380,10 @@
  23.236.76.84
  23.237.114.34
  23.237.137.237
-23.237.26.72
  23.237.4.26
  23.238.18.148
  23.238.187.66
  23.238.231.229
-23.238.43.198
  23.238.48.248
  23.239.1.96
  23.239.106.105
@@ -102153,9 +96395,9 @@
  23.239.3.194
  23.239.31.29
  23.239.67.41
-23.239.68.34
  23.239.7.183
  23.239.9.69
+23.239.97.242
  23.24.100.197
  23.24.175.14
  23.24.213.121
@@ -102165,15 +96407,13 @@
  23.240.42.68
  23.240.89.98
  23.241.138.186
-23.241.196.206
  23.241.199.10
  23.241.214.28
  23.241.250.252
-23.242.100.123
+23.241.44.83
  23.242.138.46
  23.242.187.249
  23.243.149.241
-23.243.150.20
  23.243.21.167
  23.244.90.88
  23.245.152.109
@@ -102192,7 +96432,6 @@
  23.247.33.61
  23.247.42.104
  23.247.5.46
-23.247.55.194
  23.247.97.117
  23.248.152.227
  23.248.163.254
@@ -102202,8 +96441,6 @@
  23.249.164.26
  23.249.165.196
  23.249.166.149
-23.249.41.177
-23.25.121.237
  23.25.142.200
  23.25.211.210
  23.25.60.195
@@ -102212,38 +96449,28 @@
  23.250.101.173
  23.250.105.98
  23.250.107.93
-23.250.108.174
  23.250.108.204
  23.250.11.250
-23.250.16.107
  23.250.16.111
-23.250.16.65
  23.250.16.76
  23.250.16.98
  23.250.22.100
-23.250.26.193
-23.250.26.198
  23.250.26.36
-23.250.36.157
  23.250.42.221
-23.250.43.185
  23.250.43.217
+23.250.49.206
  23.250.52.162
-23.250.52.163
-23.250.53.91
  23.250.54.250
  23.250.55.166
  23.250.56.224
  23.250.60.56
  23.250.70.35
  23.250.85.79
-23.250.94.173
  23.251.149.109
  23.251.157.221
  23.251.32.80
  23.251.52.134
  23.251.55.234
-23.251.56.213
  23.251.86.72
  23.251.90.183
  23.251.93.42
@@ -102251,6 +96478,7 @@
  23.252.170.124
  23.252.194.174
  23.252.34.227
+23.252.53.228
  23.252.75.254
  23.253.119.33
  23.253.150.217
@@ -102283,9 +96511,8 @@
  23.254.166.237
  23.254.167.102
  23.254.167.112
-23.254.167.187
  23.254.17.74
-23.254.18.15
+23.254.17.94
  23.254.20.170
  23.254.201.58
  23.254.202.154
@@ -102308,7 +96535,6 @@
  23.254.226.235
  23.254.226.60
  23.254.227.105
-23.254.227.115
  23.254.227.92
  23.254.228.35
  23.254.228.86
@@ -102321,12 +96547,8 @@
  23.254.250.11
  23.254.253.127
  23.254.4.39
-23.254.47.107
  23.254.47.136
-23.254.47.176
-23.254.47.48
-23.254.47.82
-23.254.47.87
+23.254.47.83
  23.254.5.121
  23.254.5.44
  23.254.5.64
@@ -102336,9 +96558,7 @@
  23.254.56.73
  23.254.6.55
  23.254.68.54
-23.254.82.237
-23.254.82.81
-23.254.82.85
+23.254.82.234
  23.254.83.68
  23.254.87.196
  23.254.89.142
@@ -102350,7 +96570,6 @@
  23.27.194.46
  23.27.65.146
  23.28.102.158
-23.28.205.97
  23.28.50.172
  23.28.9.218
  23.29.80.56
@@ -102358,8 +96577,8 @@
  23.4.43.27
  23.4buyuklergazete.com
  23.80.147.25
-23.80.149.173
  23.81.140.15
+23.81.140.24
  23.81.140.41
  23.81.179.100
  23.81.179.101
@@ -102392,6 +96611,7 @@
  23.81.246.83
  23.81.27.114
  23.82.16.207
+23.82.28.74
  23.82.29.215
  23.82.29.51
  23.82.44.69
@@ -102417,6 +96637,7 @@
  23.90.29.110
  23.90.29.149
  23.90.29.167
+23.90.29.32
  23.90.29.57
  23.90.29.59
  23.90.29.80
@@ -102439,7 +96660,6 @@
  23.90.40.111
  23.90.43.13
  23.90.43.16
-23.90.43.237
  23.91.198.109
  23.91.240.148
  23.91.66.183
@@ -102450,6 +96670,7 @@
  23.92.127.10
  23.92.127.34
  23.92.127.42
+23.92.127.44
  23.92.139.107
  23.92.16.44
  23.92.17.46
@@ -102460,10 +96681,11 @@
  23.92.221.88
  23.92.30.115
  23.92.30.164
-23.92.36.57
  23.92.9.70
  23.92.9.72
  23.92.9.90
+23.94.103.104
+23.94.103.123
  23.94.103.138
  23.94.103.43
  23.94.103.61
@@ -102488,7 +96710,6 @@
  23.94.183.113
  23.94.183.123
  23.94.183.20
-23.94.185.202
  23.94.186.11
  23.94.186.181
  23.94.187.130
@@ -102501,7 +96722,6 @@
  23.94.204.102
  23.94.206.177
  23.94.206.186
-23.94.21.139
  23.94.22.122
  23.94.22.126
  23.94.221.128
@@ -102512,7 +96732,6 @@
  23.94.247.10
  23.94.29.137
  23.94.29.34
-23.94.31.176
  23.94.31.250
  23.94.37.47
  23.94.4.157
@@ -102521,19 +96740,15 @@
  23.94.4.214
  23.94.43.186
  23.94.47.110
-23.94.47.112
  23.94.62.134
-23.94.7.104
  23.94.7.144
  23.94.75.200
  23.94.75.214
  23.94.8.6
-23.94.82.179
  23.94.84.99
  23.94.87.249
  23.94.93.171
  23.94.93.183
-23.94.93.207
  23.94.93.208
  23.94.94.135
  23.94.99.25
@@ -102541,6 +96756,7 @@
  23.95.102.146
  23.95.102.185
  23.95.103.49
+23.95.107.12
  23.95.11.48
  23.95.112.62
  23.95.117.72
@@ -102550,7 +96766,6 @@
  23.95.132.3
  23.95.182.165
  23.95.182.179
-23.95.182.186
  23.95.182.62
  23.95.185.219
  23.95.186.166
@@ -102568,7 +96783,6 @@
  23.95.220.148
  23.95.220.169
  23.95.221.126
-23.95.222.106
  23.95.225.112
  23.95.226.107
  23.95.226.153
@@ -102576,50 +96790,39 @@
  23.95.230.161
  23.95.231.200
  23.95.232.251
-23.95.234.117
  23.95.237.134
  23.95.238.128
  23.95.239.106
  23.95.239.112
  23.95.25.106
  23.95.254.128
+23.95.254.160
  23.95.55.211
-23.95.80.80
-23.95.85.68
+23.95.7.98
  23.95.85.74
  23.95.89.71
  23.95.89.78
  23.95.89.93
  23.95.9.10
  23.95.9.135
-23.95.9.142
  23.95.9.144
-23.95.96.56
-23.95.96.84
-23.95.97.105
  23.95.97.122
  23.95.97.124
  23.95.97.208
  23.96.21.141
  23.96.238.214
-23.96.238.71
  23.96.24.82
-23.96.246.84
  23.96.38.43
  23.96.53.62
  23.96.54.209
  23.96.58.131
  23.96.97.232
-23.96.99.136
  23.97.100.236
  23.97.180.45
  23.97.193.163
  23.98.134.62
-23.98.144.214
  23.98.191.127
  23.98.216.241
-23.98.32.208
-23.98.71.97
  23.99.10.223
  23.99.110.151
  23.99.128.21
@@ -102685,6 +96888,7 @@
  24.104.193.64
  24.105.202.216
  24.106.226.216
+24.107.212.83
  24.107.51.96
  24.108.220.229
  24.108.53.136
@@ -102729,19 +96933,18 @@
  24.123.37.67
  24.125.254.207
  24.126.152.6
-24.126.161.211
-24.126.164.145
  24.126.7.19
  24.127.14.110
  24.127.172.238
+24.127.250.222
  24.128.200.35
  24.129.235.125
  24.13.121.112
+24.130.199.58
  24.132.126.238
  24.132.248.43
  24.132.31.29
  24.132.66.15
-24.133.248.191
  24.135.207.56
  24.135.24.19
  24.135.69.146
@@ -102751,13 +96954,12 @@
  24.139.143.226
  24.139.244.238
  24.14.211.163
+24.141.166.152
  24.141.34.166
  24.141.50.241
  24.142.165.126
  24.142.189.78
  24.142.31.30
-24.142.34.181
-24.142.35.133
  24.143.230.154
  24.143.47.62
  24.143.75.66
@@ -102767,45 +96969,45 @@
  24.146.218.46
  24.146.26.34
  24.147.10.145
+24.147.207.2
  24.148.117.35
+24.148.52.186
  24.148.98.177
+24.150.2.164
+24.151.228.186
  24.152.102.226
  24.152.235.88
  24.152.240.209
  24.152.30.57
  24.153.190.114
  24.153.205.22
-24.153.41.161
-24.154.48.59
  24.155.196.246
  24.156.1.90
  24.157.130.222
-24.157.240.106
  24.157.244.110
  24.158.135.49
  24.159.15.203
  24.159.53.104
-24.16.139.106
+24.160.144.208
  24.160.150.173
+24.161.69.220
  24.162.186.173
  24.162.48.4
  24.164.79.147
  24.165.208.33
  24.165.46.50
-24.165.48.169
  24.167.210.124
  24.167.248.109
  24.167.96.213
  24.168.103.68
  24.17.132.34
  24.17.248.42
-24.17.53.49
  24.170.241.241
-24.171.74.112
  24.172.15.26
  24.172.15.58
  24.172.34.114
  24.172.79.6
+24.173.125.67
  24.173.166.166
  24.173.72.38
  24.174.198.82
@@ -102813,18 +97015,18 @@
  24.176.206.12
  24.176.206.219
  24.176.239.113
-24.176.52.62
  24.177.106.85
  24.178.76.242
  24.178.90.49
  24.178.93.162
  24.179.112.4
  24.179.13.119
-24.18.146.51
+24.179.208.85
  24.18.90.2
  24.181.205.130
  24.181.205.134
  24.181.67.58
+24.183.134.58
  24.184.0.146
  24.184.1.41
  24.184.166.137
@@ -102835,6 +97037,7 @@
  24.185.157.190
  24.185.159.118
  24.185.159.69
+24.185.62.76
  24.186.197.44
  24.187.103.196
  24.187.199.142
@@ -102848,9 +97051,12 @@
  24.189.192.224
  24.189.212.233
  24.19.9.253
+24.191.114.63
  24.192.185.142
  24.192.191.109
+24.193.158.60
  24.193.223.117
+24.193.242.9
  24.193.65.105
  24.193.76.156
  24.196.138.163
@@ -102858,7 +97064,6 @@
  24.196.88.234
  24.2.154.151
  24.2.160.242
-24.2.227.169
  24.2.249.57
  24.200.189.126
  24.200.190.39
@@ -102875,7 +97080,6 @@
  24.205.187.108
  24.205.215.192
  24.205.235.27
-24.206.39.166
  24.206.7.125
  24.207.205.152
  24.207.45.12
@@ -102886,6 +97090,7 @@
  24.211.219.0
  24.212.121.86
  24.212.126.173
+24.212.17.224
  24.212.20.211
  24.212.222.198
  24.212.249.164
@@ -102897,7 +97102,6 @@
  24.214.171.249
  24.214.210.83
  24.216.17.186
-24.216.217.209
  24.217.140.142
  24.218.231.49
  24.219.210.105
@@ -102906,7 +97110,6 @@
  24.220.5.235
  24.220.66.23
  24.220.85.125
-24.221.19.31
  24.222.118.75
  24.222.194.107
  24.222.200.71
@@ -102921,7 +97124,6 @@
  24.228.109.47
  24.228.123.191
  24.228.187.136
-24.229.161.228
  24.23.133.203
  24.23.184.220
  24.231.36.167
@@ -102931,13 +97133,11 @@
  24.231.78.55
  24.231.81.20
  24.232.107.186
-24.232.14.8
  24.232.177.8
  24.232.228.233
  24.232.249.19
  24.233.245.188
  24.234.119.227
-24.234.119.228
  24.234.197.4
  24.234.214.120
  24.234.50.44
@@ -102945,13 +97145,12 @@
  24.234.75.185bin.sh
  24.235.35.241
  24.235.62.14
+24.236.111.248
  24.237.101.250
-24.237.129.29
  24.237.70.53
  24.238.18.58
  24.238.80.114
  24.239.26.37
-24.24.211.133
  24.240.49.117
  24.240.96.140
  24.241.102.26
@@ -102976,9 +97175,10 @@
  24.251.77.254
  24.252.1.231
  24.252.140.29
+24.252.18.62
  24.253.114.10
  24.253.146.50
-24.253.147.57
+24.253.151.30
  24.254.38.127
  24.255.192.211
  24.26.156.42
@@ -102990,7 +97190,6 @@
  24.34.252.33
  24.34.253.59
  24.34.61.18
-24.34.92.168
  24.35.195.174
  24.36.11.130
  24.36.161.180
@@ -103002,6 +97201,7 @@
  24.37.80.177
  24.37.80.178
  24.37.80.190
+24.37.85.238
  24.38.148.54
  24.39.150.166
  24.39.154.236
@@ -103014,9 +97214,8 @@
  24.42.28.39
  24.43.32.186
  24.43.99.75
-24.44.184.238
-24.45.249.94
  24.46.101.89
+24.46.108.128
  24.46.183.117
  24.46.96.100
  24.47.6.179
@@ -103031,10 +97230,8 @@
  24.51.91.113
  24.52.144.19
  24.52.201.155
-24.52.247.226
  24.52.248.148
  24.53.106.200
-24.53.16.121
  24.53.163.10
  24.53.245.34
  24.53.34.86
@@ -103044,13 +97241,10 @@
  24.55.153.205
  24.55.19.82
  24.56.242.244
-24.56.244.198
-24.56.250.54
  24.57.192.80
  24.57.227.242
-24.57.80.35
+24.57.243.108
  24.6.239.153
-24.6.253.61
  24.6.92.181
  24.60.104.154
  24.60.139.217
@@ -103058,7 +97252,6 @@
  24.63.194.252
  24.64.164.229
  24.64.86.246
-24.65.36.217
  24.65.65.200
  24.66.13.157
  24.66.130.44
@@ -103068,11 +97261,12 @@
  24.67.152.136
  24.67.21.40
  24.68.94.168
+24.69.166.70
  24.7.125.43
-24.7.248.54
  24.70.112.215
  24.70.200.144
  24.70.202.165
+24.70.33.139
  24.70.96.78
  24.72.199.137
  24.72.80.84
@@ -103080,7 +97274,6 @@
  24.76.213.10
  24.76.219.97
  24.76.36.70
-24.77.162.79
  24.78.42.204
  24.78.43.239
  24.8.136.37
@@ -103090,6 +97283,7 @@
  24.80.79.107
  24.84.129.61
  24.84.207.249
+24.85.120.181
  24.86.185.80
  24.87.71.106
  24.88.70.74
@@ -103097,7 +97291,6 @@
  24.89.71.20
  24.9.219.33
  24.90.125.46
-24.90.143.249
  24.90.234.200
  24.90.240.65
  24.90.33.149
@@ -103106,7 +97299,6 @@
  24.92.187.245
  24.93.145.62
  24.93.234.75
-24.95.77.207
  24.96.125.57
  24.96.173.47
  24.96.226.22
@@ -103237,7 +97429,6 @@
  27.100.163.200
  27.100.172.24
  27.100.224.209
-27.100.36.49
  27.102.102.139
  27.102.107.235
  27.102.114.111
@@ -103259,9 +97450,9 @@
  27.102.70.194
  27.102.70.210
  27.102.70.211
-27.104.135.174
  27.104.149.83
  27.104.157.167
+27.104.178.179
  27.104.223.71
  27.104.235.24
  27.104.250.41
@@ -103283,7 +97474,6 @@
  27.106.12.218
  27.106.84.162
  27.106.84.186
-27.106.89.92
  27.109.115.130
  27.109.115.136
  27.109.115.138
@@ -103308,20 +97498,17 @@
  27.113.68.229
  27.113.91.102
  27.114.134.46
+27.114.137.143
  27.114.148.200
  27.114.9.93
  27.115.124.10
  27.115.124.74
  27.115.124.75
  27.115.124.9
-27.115.15.8
  27.115.209.134
-27.115.21.30
  27.115.244.198
  27.115.252.189
  27.115.50.114
-27.115.51.162
-27.115.62.134
  27.116.194.14
  27.116.48.102
  27.116.51.119
@@ -103337,7 +97524,6 @@
  27.118.96.112
  27.120.109.165
  27.121.109.247
-27.121.190.62
  27.122.56.147
  27.122.59.10
  27.122.59.100
@@ -103355,7 +97541,7 @@
  27.124.85.149
  27.125.136.116
  27.125.140.2
-27.125.241.70
+27.126.156.2
  27.126.158.136
  27.126.179.44
  27.126.179.46
@@ -103363,15 +97549,12 @@
  27.127.187.136
  27.128.162.112
  27.128.165.131
-27.128.168.12
  27.128.168.225
-27.128.171.69
  27.128.173.81
  27.128.174.240
  27.128.176.144
  27.128.180.42
  27.128.183.162
-27.128.187.131
  27.128.191.13
  27.128.191.36
  27.128.191.38
@@ -103379,17 +97562,11 @@
  27.128.191.5
  27.128.201.88
  27.128.204.66
-27.128.229.64
-27.128.232.67
  27.128.233.104
-27.128.233.3
  27.128.236.107
  27.128.236.189
-27.128.238.14
  27.128.243.112
-27.128.243.230
  27.128.244.13
-27.128.247.123
  27.13.27.30
  27.13.97.223
  27.13.99.65
@@ -103400,12 +97577,10 @@
  27.136.65.242
  27.14.208.133
  27.14.210.18
-27.14.210.92
  27.14.211.205
  27.14.81.28
  27.14.84.103
  27.142.132.247
-27.142.241.233
  27.145.130.154
  27.145.61.39
  27.145.62.186
@@ -103427,26 +97602,20 @@
  27.147.249.202
  27.147.48.92
  27.147.54.83
-27.148.136.57
  27.148.190.100
-27.148.193.78
  27.148.211.136
  27.148.211.247
  27.15.24.183
  27.15.25.91
  27.15.82.233
-27.150.169.223
  27.150.175.150
  27.150.175.28
  27.150.182.230
-27.150.184.25
  27.150.22.155
-27.150.22.44
  27.151.0.160
  27.151.115.81
  27.151.4.43
  27.151.6.109
-27.153.182.178
  27.153.254.70
  27.154.225.186
  27.154.225.194
@@ -103454,13 +97623,10 @@
  27.154.242.142
  27.154.32.202
  27.154.34.146
-27.154.55.58
-27.154.58.154
  27.154.59.202
  27.154.66.135
  27.154.67.164
  27.154.68.94
-27.155.100.58
  27.155.101.173
  27.155.101.197
  27.155.105.208
@@ -103468,32 +97634,30 @@
  27.155.54.46
  27.155.54.60
  27.155.55.141
-27.155.65.3
  27.155.83.174
  27.155.88.231
  27.155.97.12
-27.155.99.122
-27.156.220.79
-27.156.222.254
  27.156.248.78
  27.156.4.11
  27.156.4.179
  27.156.6.147
  27.157.18.12
+27.157.18.13
+27.157.18.154
+27.157.18.25
  27.157.18.43
-27.157.18.58
  27.157.19.235
  27.157.247.114
  27.157.90.20
+27.157.90.233
  27.158.161.91
-27.158.214.185
  27.158.48.146
  27.158.57.149
+27.159.75.100
  27.159.82.254
  27.17.11.78
  27.17.111.163
  27.17.3.90
-27.17.7.70
  27.17.8.58
  27.184.123.85
  27.184.140.61
@@ -103504,31 +97668,30 @@
  27.185.19.172
  27.187.248.234
  27.187.249.35
-27.187.251.150
  27.188.61.75
  27.188.62.55
  27.188.77.75
  27.19.108.61
  27.19.111.252
  27.19.197.93
-27.190.194.112
-27.191.198.164
  27.191.210.15
  27.191.234.199
  27.191.234.69
  27.192.103.145
+27.192.13.232
  27.192.137.78
  27.192.185.106
  27.192.246.139
+27.192.254.51
  27.193.105.154
  27.193.106.206bin.sh
  27.193.138.162
  27.193.139.129
  27.193.158.32
+27.193.178.178
  27.193.189.201
  27.193.201.33
  27.193.21.217bin.sh
-27.193.211.199
  27.193.215.70
  27.193.232.155
  27.193.233.48
@@ -103537,6 +97700,7 @@
  27.193.250.240
  27.193.250.240bin.sh
  27.193.253.146
+27.193.28.195
  27.193.36.215
  27.193.44.80
  27.193.47.17
@@ -103545,7 +97709,6 @@
  27.193.89.119
  27.193.90.22
  27.193.92.147
-27.193.92.159
  27.194.102.213
  27.194.104.150
  27.194.11.76
@@ -103555,7 +97718,6 @@
  27.194.134.4
  27.194.143.157
  27.194.143.216
-27.194.149.176
  27.194.151.14
  27.194.151.51
  27.194.153.29
@@ -103565,6 +97727,7 @@
  27.194.158.134
  27.194.16.149
  27.194.164.63
+27.194.188.39
  27.194.192.37
  27.194.209.90
  27.194.232.197
@@ -103575,8 +97738,6 @@
  27.194.252.247
  27.194.26.98
  27.194.36.216
-27.194.38.160
-27.194.46.222
  27.194.65.197
  27.194.65.75
  27.194.67.99
@@ -103601,12 +97762,12 @@
  27.198.134.230
  27.198.153.92
  27.198.16.19
+27.198.27.119
  27.198.33.255
  27.198.51.21
  27.198.66.231
  27.199.131.151
  27.199.170.223
-27.199.198.206
  27.2.121.170
  27.2.166.34
  27.2.166.35
@@ -103634,6 +97795,7 @@
  27.201.110.238
  27.201.118.119
  27.201.118.95
+27.201.119.85
  27.201.143.17
  27.201.163.113
  27.201.187.210
@@ -103643,11 +97805,10 @@
  27.201.242.98
  27.201.244.14
  27.201.244.156
-27.201.246.70
+27.201.252.29
  27.201.97.232
-27.202.10.117
+27.201.99.201
  27.202.101.28
-27.202.103.209
  27.202.135.34
  27.202.137.28
  27.202.142.222
@@ -103662,7 +97823,6 @@
  27.202.226.121
  27.202.227.184
  27.202.243.37
-27.202.25.249
  27.202.27.240
  27.202.29.116
  27.202.34.3
@@ -103673,7 +97833,6 @@
  27.202.48.204
  27.202.48.62
  27.202.52.95
-27.202.60.70
  27.202.76.83
  27.203.115.176
  27.203.116.215
@@ -103689,6 +97848,7 @@
  27.203.231.214
  27.203.25.103
  27.203.25.103bin.sh
+27.203.25.110
  27.203.42.20
  27.203.42.58
  27.203.5.143
@@ -103705,7 +97865,6 @@
  27.204.253.12
  27.204.254.155
  27.204.254.72
-27.204.54.225
  27.205.101.58
  27.205.156.106
  27.205.171.132
@@ -103718,6 +97877,7 @@
  27.206.175.85
  27.206.179.194
  27.206.186.66
+27.206.187.235
  27.206.187.53
  27.206.191.191
  27.206.201.175
@@ -103729,14 +97889,12 @@
  27.207.136.97
  27.207.141.126
  27.207.180.93
-27.207.185.167
  27.207.192.7
  27.207.193.26
  27.207.197.49
  27.207.197.49bin.sh
  27.207.199.222
  27.207.202.222
-27.207.218.36
  27.207.24.78
  27.207.249.100
  27.207.251.64
@@ -103754,10 +97912,10 @@
  27.208.11.250
  27.208.145.149
  27.208.147.158
-27.208.149.129
  27.208.150.161
  27.208.151.121
  27.208.155.48
+27.208.161.135
  27.208.163.180
  27.208.168.196
  27.208.200.128
@@ -103769,23 +97927,21 @@
  27.209.126.200
  27.209.128.113
  27.209.150.20
-27.209.16.198
  27.209.69.11
  27.209.80.233
-27.21.170.55
  27.210.10.133
  27.210.101.231
  27.210.110.103
  27.210.114.170bin.sh
  27.210.131.117
  27.210.134.69
+27.210.137.63
  27.210.147.237
  27.210.15.89
  27.210.155.54
  27.210.16.225
  27.210.161.2
  27.210.173.204
-27.210.193.179
  27.210.236.134
  27.210.246.189
  27.210.255.236
@@ -103796,7 +97952,6 @@
  27.210.41.20
  27.210.42.130
  27.210.42.194
-27.210.43.123
  27.210.55.84
  27.210.75.98
  27.210.82.136
@@ -103804,17 +97959,14 @@
  27.210.92.32
  27.210.93.242
  27.211.128.186
-27.211.134.98
  27.211.195.252
  27.211.206.15
-27.211.221.190
-27.211.227.58
  27.211.62.203
  27.211.90.171
-27.212.38.5
  27.213.1.108
  27.213.109.190
  27.213.110.83
+27.213.111.197
  27.213.112.131
  27.213.137.14
  27.213.148.114
@@ -103847,6 +97999,7 @@
  27.214.159.219
  27.214.6.133
  27.214.6.159
+27.215.122.11
  27.215.122.212
  27.215.127.174
  27.215.140.240
@@ -103854,13 +98007,12 @@
  27.215.147.64
  27.215.148.27
  27.215.160.253
+27.215.163.99
  27.215.164.194
  27.215.168.29
-27.215.170.201
  27.215.176.224
  27.215.177.142
  27.215.180.100
-27.215.183.188
  27.215.191.88
  27.215.2.23
  27.215.201.62
@@ -103868,18 +98020,17 @@
  27.215.213.199
  27.215.224.48
  27.215.228.253
+27.215.232.117
  27.215.232.194
  27.215.234.177
-27.215.240.46
  27.215.247.244
  27.215.250.146
  27.215.255.209
-27.215.34.83
  27.215.35.102
  27.215.35.115
+27.215.37.226
  27.215.38.137
  27.215.38.186
-27.215.38.228
  27.215.50.156
  27.215.54.234
  27.215.60.1
@@ -103887,13 +98038,11 @@
  27.215.64.28
  27.215.68.87
  27.215.76.18
-27.215.81.0
  27.215.83.51
  27.215.83.51bin.sh
  27.215.88.5
  27.215.96.1
  27.215.98.253
-27.216.107.231
  27.216.120.210
  27.216.123.208
  27.216.123.241
@@ -103903,7 +98052,6 @@
  27.216.168.43
  27.216.171.0
  27.216.174.156
-27.216.174.190
  27.216.186.136
  27.216.214.166
  27.216.214.38
@@ -103929,6 +98077,7 @@
  27.217.136.68bin.sh
  27.217.138.46
  27.217.139.169
+27.217.160.161
  27.217.162.11
  27.217.163.26
  27.217.172.123
@@ -103944,6 +98093,7 @@
  27.217.5.237
  27.217.54.35
  27.217.55.177
+27.217.66.91
  27.217.88.78
  27.217.92.245
  27.218.125.193
@@ -103953,25 +98103,22 @@
  27.219.109.50
  27.219.124.153
  27.219.126.249
-27.219.131.37
  27.219.136.113
  27.219.136.254
  27.219.137.38
  27.219.137.38bin.sh
  27.219.138.112
  27.219.138.234
-27.219.139.68
  27.219.146.237
  27.219.152.41
  27.219.16.15
  27.219.174.132
-27.219.174.15
  27.219.178.191
  27.219.178.44
-27.219.179.250
-27.219.179.47
+27.219.180.16
  27.219.184.240
  27.219.184.57
+27.219.196.101
  27.219.199.118
  27.219.254.146
  27.219.42.130
@@ -103983,34 +98130,35 @@
  27.219.82.177
  27.219.83.50
  27.219.9.39
+27.219.93.222
  27.22.104.11
-27.22.251.73
-27.220.139.243
  27.220.14.133
  27.220.158.71
  27.220.178.44
  27.220.190.99
+27.220.207.43
  27.220.253.123
  27.220.254.154
-27.220.80.180
  27.220.89.168
  27.220.94.247
  27.220.95.25
  27.221.109.116
  27.221.163.102
+27.221.166.106
+27.221.218.80
  27.221.25.235
  27.221.69.33
  27.221.75.49
-27.221.97.3
-27.221.97.4
  27.222.108.194
  27.222.142.26
  27.222.143.116
  27.222.242.112
  27.222.251.8
  27.222.51.3
+27.222.51.64
  27.222.52.124
  27.222.54.39
+27.222.54.98
  27.222.60.154
  27.222.61.198
  27.222.76.194
@@ -104025,8 +98173,10 @@
  27.223.203.99
  27.223.226.76
  27.223.230.215
+27.223.247.140
  27.223.254.218
  27.223.50.187
+27.223.69.190
  27.223.77.42
  27.223.78.162
  27.223.78.163
@@ -104053,7 +98203,6 @@
  27.254.130.67
  27.254.137.144
  27.254.172.190
-27.254.206.238
  27.254.34.177
  27.254.34.181
  27.254.38.122
@@ -104069,11 +98218,11 @@
  27.255.235.39
  27.255.239.87
  27.255.246.97
-27.255.64.44
+27.255.58.6
  27.255.64.7
  27.255.65.107
-27.255.75.18
  27.255.75.6
+27.255.75.7
  27.255.77.10
  27.255.77.145
  27.255.77.182
@@ -104107,12 +98256,11 @@
  27.33.75.41
  27.33.76.86
  27.34.161.42
+27.34.20.31
  27.34.20.87
  27.34.251.60
-27.34.29.216
  27.34.4.41
  27.34.48.243
-27.34.68.43
  27.35.100.245
  27.35.100.31
  27.35.104.17
@@ -104128,16 +98276,18 @@
  27.35.127.129
  27.35.129.198
  27.35.144.79
+27.35.145.43
+27.35.154.42
  27.35.155.99
  27.35.156.47
  27.35.160.16
  27.35.171.58
  27.35.172.208
  27.35.173.95
+27.35.173.97
  27.35.190.72
  27.35.194.36
  27.35.197.103
-27.35.197.87
  27.35.199.113
  27.35.200.87
  27.35.211.19
@@ -104151,7 +98301,6 @@
  27.35.217.60
  27.35.217.64
  27.35.218.8
-27.35.219.33
  27.35.222.38
  27.35.228.116
  27.35.228.134
@@ -104167,10 +98316,12 @@
  27.35.254.49
  27.35.254.60
  27.35.254.69
+27.35.38.56
  27.35.38.71
  27.35.40.17
  27.35.40.195
  27.35.50.143
+27.35.50.172
  27.35.50.238
  27.35.50.53
  27.35.50.93
@@ -104179,9 +98330,12 @@
  27.35.74.114
  27.35.98.62
  27.36.118.2
-27.37.8.232
+27.36.68.202
  27.37.81.208
-27.41.141.182
+27.40.82.129
+27.41.152.103
+27.41.153.226
+27.41.154.235
  27.41.157.5
  27.41.158.204
  27.41.179.202
@@ -104189,27 +98343,22 @@
  27.41.182.169
  27.41.187.171
  27.41.204.88
-27.41.205.121
  27.41.206.175
-27.41.217.33
  27.41.218.40
-27.41.97.172
-27.43.116.96
+27.42.173.235
+27.43.122.184
  27.43.186.158
  27.48.138.8
  27.49.160.7
  27.49.160.9
  27.49.232.9
  27.5.32.191
-27.5.43.108
  27.50.162.159
  27.50.164.114
-27.50.169.167
  27.50.169.198
  27.50.169.201
  27.50.169.205
  27.50.169.211
-27.50.175.43
  27.50.175.63
  27.50.18.42
  27.50.21.157
@@ -104229,12 +98378,11 @@
  27.54.94.226
  27.56.186.197
  27.57.15.217
-27.58.153.121
  27.6.102.89
  27.6.104.60bin.sh
  27.6.207.11
  27.6.30.211
-27.60.66.151
+27.63.189.119
  27.64.120.167
  27.64.16.204
  27.64.163.17
@@ -104271,12 +98419,8 @@
  27.7.143.136
  27.70.174.61
  27.70.215.167
-27.70.222.179
  27.70.227.42
-27.71.227.123
-27.71.227.197
  27.71.228.25
-27.71.229.116
  27.71.229.76
  27.71.231.25
  27.71.231.81
@@ -104288,7 +98432,6 @@
  27.72.123.31
  27.72.146.175
  27.72.19.127
-27.72.195.145
  27.72.240.214
  27.72.29.159
  27.72.42.251
@@ -104311,10 +98454,10 @@
  27.74.127.150
  27.74.193.44
  27.74.227.13
+27.74.241.172
  27.74.247.135
  27.74.247.140
  27.74.53.82
-27.74.71.36
  27.74.8.99
  27.74.89.232
  27.75.106.247
@@ -104352,6 +98495,7 @@
  27.76.8.230
  27.77.16.177
  27.77.185.57
+27.77.21.207
  27.77.210.207
  27.77.220.82
  27.77.228.173
@@ -104359,9 +98503,7 @@
  27.77.236.97
  27.77.255.197
  27.77.85.74
-27.78.12.22
  27.78.12.26
-27.78.14.83
  27.78.149.60
  27.78.168.99
  27.78.177.107
@@ -104370,13 +98512,13 @@
  27.78.243.247
  27.78.251.63
  27.78.34.80
+27.78.81.252
  27.79.135.57
  27.79.153.244
  27.79.194.234
  27.79.200.243
  27.79.208.40
  27.79.214.96
-27.79.215.199
  27.79.215.81
  27.79.222.119
  27.79.228.162
@@ -104386,7 +98528,6 @@
  27.8.103.35
  27.8.108.167
  27.8.112.103
-27.8.231.161
  27.8.234.12
  27.8.235.240
  27.8.237.38
@@ -104398,9 +98539,8 @@
  27.9.124.61
  27.9.139.21
  27.9.23.105
-27.92.160.148
  27.96.239.48
-27.97.190.204
+27.98.238.251
  272101.com
  27353.join78.ga
  2746.31cf4fdae.com
@@ -104501,6 +98641,7 @@
  2dehands.controle-bevestiging.online
  2dehandsbancontact.net
  2dehanscorona.ootoyasushifood.com
+2dgroupen.com
  2dnfsf.cn
  2drive.us
  2dspoek.s3-ap-southeast-1.amazonaws.com
@@ -104654,22 +98795,17 @@
  3.0.172.253
  3.0.178.55
  3.0.22.9
-3.0.52.76
+3.0.61.153
  3.0.91.33
  3.1.101.22
  3.1.103.102
-3.1.201.101
  3.1.201.76
-3.1.203.33
  3.1.211.101
  3.1.220.100
  3.1.255.152
-3.1.5.37
  3.1.8.108
-3.1.8.31
  3.1.81.158
  3.10.70.38
-3.101.144.240
  3.101.21.147
  3.101.67.35
  3.104.54.134
@@ -104682,7 +98818,6 @@
  3.112.222.89
  3.112.50.156
  3.112.61.151
-3.112.95.215
  3.113.172.125
  3.113.172.54
  3.113.239.72
@@ -104691,7 +98826,6 @@
  3.114.77.240
  3.115.12.116
  3.115.164.24
-3.115.20.188
  3.12.102.171
  3.120.112.0
  3.120.158.102
@@ -104716,6 +98850,7 @@
  3.124.5.37
  3.124.63.44
  3.124.65.19
+3.125.115.43
  3.125.6.62
  3.125.62.133
  3.126.184.249
@@ -104738,44 +98873,39 @@
  3.128.229.144
  3.128.95.81
  3.129.10.250
+3.129.21.170
  3.129.43.236
  3.129.70.5
+3.129.71.0
  3.130.237.238
  3.131.13.61
  3.131.142.208
  3.131.151.23
  3.131.202.18
-3.131.37.19
-3.131.96.114
  3.132.153.25
  3.132.225.116
+3.132.39.66
  3.133.154.216
  3.133.86.139
  3.133.88.244
  3.134.245.141
+3.134.246.118
  3.134.246.127
  3.134.91.16
  3.135.154.33
  3.135.201.40
  3.135.212.203
  3.135.219.81
-3.136.2.192
  3.137.162.194
  3.137.175.120
  3.137.195.133
  3.138.110.36
  3.138.122.100
-3.138.139.36
-3.138.182.209
  3.138.197.89
-3.138.216.171
-3.139.34.244
  3.14.130.87
  3.14.168.201
  3.14.244.95
  3.14.246.193
-3.14.29.218
-3.14.87.136
  3.15.140.156
  3.15.18.39
  3.15.31.212
@@ -104785,7 +98915,6 @@
  3.15.68.183
  3.16.1.181
  3.16.10.26
-3.16.107.117
  3.16.118.136
  3.16.128.12
  3.16.129.75
@@ -104806,11 +98935,10 @@
  3.18.101.80
  3.18.107.11
  3.18.213.211
-3.19.142.178
  3.19.227.221
  3.19.30.176
-3.19.53.50
  3.19.56.156
+3.19.59.167
  3.19.75.173
  3.20.225.12
  3.208.138.203
@@ -104818,18 +98946,15 @@
  3.208.33.179
  3.208.87.85
  3.209.12.198
-3.209.180.155
  3.21.232.168
-3.21.236.235
  3.21.24.45
  3.21.43.213
  3.21.92.74
  3.210.177.194
-3.211.173.31
  3.211.51.136
+3.215.117.7
  3.219.45.92
  3.219.58.63
-3.22.10.226
  3.22.149.192
  3.22.198.63
  3.22.25.171
@@ -104842,24 +98967,24 @@
  3.227.11.183
  3.227.15.164
  3.228.87.114
-3.23.116.172
  3.23.227.175
  3.23.55.66
+3.23.63.80
  3.23.85.64
  3.230.162.30
  3.231.220.144
  3.231.24.151
  3.232.243.7
-3.233.127.244
  3.233.220.90
-3.233.234.238
  3.234.139.193
  3.235.183.241
+3.235.183.74
  3.235.222.163
  3.235.228.195
-3.235.63.122
  3.235.63.145
  3.236.122.240
+3.236.136.203
+3.236.149.36
  3.236.226.212
  3.236.45.91
  3.237.102.80
@@ -104869,6 +98994,7 @@
  3.237.65.243
  3.238.130.155
  3.238.24.138
+3.238.38.153
  3.248.223.135
  3.25.130.248
  3.25.30.128
@@ -104888,7 +99014,6 @@
  3.34.200.165
  3.34.252.168
  3.34.40.146
-3.34.48.111
  3.34.59.49
  3.34.96.195
  3.35.120.212
@@ -104904,27 +99029,23 @@
  3.35.36.1
  3.35.47.140
  3.35.48.144
-3.6.203.189
  3.6.206.209
  3.6.87.154
-3.6.88.250
  3.7.190.231
-3.7.233.194
-3.7.91.177
-3.7.98.154
  3.8.101.127
  3.8.101.76
  3.8.133.2
-3.8.135.5
  3.8.165.235
  3.8.17.195
  3.8.29.239
  3.8.38.104
  3.8.52.65
  3.8.85.74
+3.8.86.93
  3.8.9.247
  3.80.166.95
  3.81.144.22
+3.81.167.220
  3.81.208.241
  3.81.6.97
  3.81.67.195
@@ -104947,7 +99068,7 @@
  3.84.95.119
  3.85.100.29
  3.86.194.104
-3.86.219.241
+3.86.212.242
  3.86.86.133
  3.87.139.249
  3.87.158.26
@@ -104962,10 +99083,8 @@
  3.90.83.73
  3.91.106.244
  3.91.236.72
-3.91.253.60
  3.91.73.60
  3.92.233.209
-3.92.235.70
  3.93.2.251
  3.93.244.52
  3.94.249.60
@@ -105040,8 +99159,6 @@
  31.124.173.141
  31.124.178.150
  31.124.178.246
-31.124.19.204
-31.125.100.24
  31.127.117.54
  31.127.118.68
  31.127.69.159
@@ -105055,7 +99172,6 @@
  31.129.248.51
  31.129.253.30
  31.129.253.90
-31.129.68.164
  31.129.82.101
  31.13.115.23
  31.13.137.65
@@ -105095,13 +99211,15 @@
  31.135.65.140
  31.135.77.117
  31.135.91.9
-31.135.93.56
+31.14.126.51
  31.14.136.210
  31.14.141.155
  31.14.201.156
+31.14.252.74
  31.14.40.154
  31.14.40.19
  31.14.57.68
+31.145.138.145
  31.145.144.162
  31.145.166.27
  31.145.166.28
@@ -105130,8 +99248,8 @@
  31.146.249.177
  31.146.249.198
  31.147.253.49
-31.148.122.251
  31.148.127.91
+31.148.168.18
  31.148.219.131
  31.148.219.206
  31.148.219.227
@@ -105145,16 +99263,16 @@
  31.15.89.51
  31.151.28.39
  31.153.101.140
+31.154.174.126
  31.154.220.67
  31.154.74.110
-31.154.9.174
  31.156.118.156
  31.156.165.147
  31.156.74.163
+31.156.78.210
  31.156.96.65
  31.16.158.132
  31.16.176.69
-31.16.185.139
  31.16.217.18
  31.16.91.237
  31.160.68.193
@@ -105175,9 +99293,10 @@
  31.163.131.134
  31.163.131.19
  31.163.131.247
+31.163.131.76
  31.163.131.78
  31.163.132.153
-31.163.132.180
+31.163.132.158
  31.163.132.24
  31.163.132.250
  31.163.132.97
@@ -105203,6 +99322,7 @@
  31.163.137.57
  31.163.137.70
  31.163.139.100
+31.163.139.18
  31.163.139.229
  31.163.139.241
  31.163.140.144
@@ -105219,9 +99339,9 @@
  31.163.144.182
  31.163.144.239
  31.163.144.4
-31.163.144.93
  31.163.145.101
  31.163.145.48
+31.163.146.207
  31.163.146.62
  31.163.147.205
  31.163.148.147
@@ -105232,12 +99352,12 @@
  31.163.151.164
  31.163.151.169
  31.163.151.245
+31.163.151.93
  31.163.152.174
  31.163.152.50
  31.163.152.75
  31.163.153.152
  31.163.153.166
-31.163.153.182
  31.163.153.195
  31.163.154.111
  31.163.154.131
@@ -105245,6 +99365,7 @@
  31.163.155.26
  31.163.155.3
  31.163.155.54
+31.163.155.91
  31.163.156.193
  31.163.157.99
  31.163.158.203
@@ -105253,6 +99374,7 @@
  31.163.161.44
  31.163.161.80
  31.163.162.164
+31.163.162.17
  31.163.162.174
  31.163.162.191
  31.163.162.28
@@ -105261,7 +99383,6 @@
  31.163.163.76
  31.163.163.96
  31.163.164.80
-31.163.165.132
  31.163.165.226
  31.163.165.38
  31.163.165.8
@@ -105290,10 +99411,7 @@
  31.163.175.211
  31.163.175.27
  31.163.175.28
-31.163.175.67
-31.163.175.91
  31.163.176.158
-31.163.176.238
  31.163.177.36
  31.163.178.194
  31.163.179.117
@@ -105333,30 +99451,28 @@
  31.163.191.111
  31.163.198.162
  31.163.202.55
-31.163.203.54
-31.163.204.171
+31.163.204.134
  31.163.213.124
  31.163.215.12
  31.163.223.161
  31.163.243.2
  31.163.249.105
  31.163.249.229
-31.163.94.225
-31.166.141.51
  31.166.43.122
  31.167.11.121
-31.167.118.17
  31.167.134.193
  31.167.134.252
  31.167.14.111
+31.167.16.186
  31.167.167.218
  31.167.170.223
  31.167.18.162
+31.167.181.96
  31.167.186.69
+31.167.192.250
  31.167.247.42
  31.167.35.161
  31.167.80.7
-31.167.9.2
  31.168.120.3
  31.168.123.65
  31.168.137.245
@@ -105366,14 +99482,15 @@
  31.168.179.55
  31.168.179.83
  31.168.184.59
+31.168.202.138
  31.168.213.1
  31.168.216.101
  31.168.216.132
+31.168.219.28
  31.168.244.81
  31.168.247.24
  31.168.249.37
  31.168.28.180
-31.168.34.110
  31.168.34.130
  31.168.63.146
  31.168.63.203
@@ -105389,19 +99506,15 @@
  31.170.173.73
  31.170.185.182
  31.170.49.26
-31.170.51.102
  31.170.58.171
+31.170.60.7
  31.170.61.208
  31.170.62.10
  31.170.62.212
  31.170.62.227
-31.170.62.233
-31.170.62.247
  31.170.62.252
  31.171.108.141
  31.171.115.201
-31.171.152.100
-31.171.192.228
  31.171.197.41
  31.171.197.46
  31.171.198.145
@@ -105426,11 +99539,9 @@
  31.173.246.95
  31.173.94.93
  31.176.147.141
-31.176.163.226
  31.176.164.36
-31.176.166.104
+31.176.183.73
  31.176.188.36
-31.176.241.250
  31.176.242.101
  31.176.251.131
  31.178.150.200
@@ -105444,18 +99555,17 @@
  31.179.233.207
  31.179.247.161
  31.18.102.251
-31.18.74.117
-31.180.135.96
+31.18.122.117
+31.18.73.104
  31.180.142.26
  31.180.146.148
  31.180.234.41
+31.181.193.209
  31.182.12.3
  31.182.13.17
  31.182.144.36
  31.182.255.85
  31.182.57.86
-31.183.154.232
-31.184.141.73
  31.184.177.6
  31.184.195.114
  31.184.198.75
@@ -105475,7 +99585,6 @@
  31.186.27.203
  31.186.48.172
  31.186.53.122
-31.19.224.198
  31.192.105.16
  31.192.128.22
  31.192.131.132
@@ -105503,7 +99612,6 @@
  31.203.250.221
  31.204.155.160
  31.204.180.44
-31.206.11.112
  31.206.34.67
  31.206.38.36
  31.206.38.40
@@ -105516,7 +99624,6 @@
  31.207.169.39
  31.207.33.100
  31.207.33.153
-31.207.35.68
  31.207.44.34
  31.207.47.33
  31.207.47.34
@@ -105544,7 +99651,6 @@
  31.208.43.188
  31.208.43.225
  31.209.104.231
-31.209.209.162
  31.209.21.17
  31.209.223.149
  31.209.96.173
@@ -105600,7 +99706,6 @@
  31.220.40.239
  31.220.40.240
  31.220.40.241
-31.220.41.57
  31.220.41.79
  31.220.42.43
  31.220.42.47
@@ -105616,17 +99721,17 @@
  31.220.55.120
  31.220.60.222
  31.220.63.23
-31.221.81.222
  31.221.95.5
  31.222.127.72
  31.222.129.14
  31.222.6.26
  31.222.6.42
  31.222.7.133
+31.223.155.71
+31.223.155.90
  31.223.16.149
  31.223.210.82
  31.223.33.10
-31.223.7.171
  31.24.176.249
  31.24.186.216
  31.24.200.23
@@ -105637,8 +99742,6 @@
  31.25.136.18
  31.25.241.224
  31.25.91.216
-31.27.20.113
-31.27.216.108
  31.27.254.187
  31.28.0.203
  31.28.10.74
@@ -105649,10 +99752,7 @@
  31.28.163.52
  31.28.166.83
  31.28.212.135
-31.28.228.252
  31.28.241.117
-31.28.8.125
-31.28.8.163
  31.28.99.25
  31.29.212.240
  31.29.44.80
@@ -105664,43 +99764,53 @@
  31.3.232.109
  31.3.242.140
  31.30.119.23
+31.31.115.17
  31.31.115.245
-31.31.6.208
  31.31.72.24
  31.31.72.43
  31.31.74.47
  31.31.76.95
  31.31.77.107
-31.35.87.134
-31.36.181.181
  31.39.181.228
  31.40.1.60
  31.40.135.67
  31.40.208.108
  31.40.208.118
+31.40.208.148
+31.40.208.156
  31.40.208.158
+31.40.208.166
+31.40.208.178
  31.40.208.194
  31.40.208.220
  31.40.208.248
  31.40.208.31
  31.40.208.40
+31.40.208.49
+31.40.208.62
  31.40.209.130
+31.40.209.138
  31.40.209.149
  31.40.209.158
+31.40.209.161
  31.40.209.182
-31.40.209.215
+31.40.209.203
+31.40.209.252
+31.40.209.26
  31.40.209.33
  31.40.209.59
  31.40.209.74
  31.40.211.122
+31.40.252.102
+31.40.252.110
  31.40.252.117
  31.40.252.120
+31.40.252.14
  31.40.252.174
  31.40.252.178
  31.40.252.191
  31.40.252.198
  31.40.252.214
-31.40.252.229
  31.40.252.236
  31.40.252.243
  31.40.252.250
@@ -105709,39 +99819,51 @@
  31.40.252.33
  31.40.252.65
  31.40.252.83
+31.40.252.91
  31.40.253.149
+31.40.253.166
+31.40.253.168
  31.40.253.184
  31.40.253.186
  31.40.253.187
+31.40.253.189
  31.40.253.190
  31.40.253.196
  31.40.253.224
+31.40.253.23
  31.40.253.252
  31.40.253.36
  31.40.253.39
  31.40.253.81
  31.40.253.83
+31.40.254.102
  31.40.254.133
  31.40.254.146
+31.40.254.174
  31.40.254.183
  31.40.254.185
  31.40.254.207
  31.40.254.208
+31.40.254.211
  31.40.254.218
  31.40.254.246
-31.40.254.26
  31.40.254.31
  31.40.254.36
  31.40.254.46
+31.40.254.51
+31.40.254.53
+31.40.254.56
  31.40.254.65
  31.40.254.72
  31.40.254.88
  31.40.255.103
  31.40.255.143
+31.40.255.155
  31.40.255.192
  31.40.255.205
  31.40.255.216
  31.40.255.22
+31.40.255.33
  31.40.255.82
  31.40.255.91
  31.40.48.112
@@ -105756,12 +99878,10 @@
  31.41.89.237
  31.41.92.154
  31.41.93.230
-31.42.11.180
  31.42.165.227
  31.42.186.147
  31.42.254.24
  31.42.91.131
-31.43.1.233
  31.43.122.180
  31.43.127.71
  31.43.140.190
@@ -105777,15 +99897,12 @@
  31.44.184.50
  31.44.248.244
  31.44.82.203
-31.44.85.94
  31.45.240.114
  31.45.240.154
  31.45.7.129
-31.46.132.6
  31.46.151.100
  31.46.16.91
  31.46.247.157
-31.46.249.16
  31.46.32.20
  31.46.81.199
  31.47.103.73
@@ -105809,6 +99926,7 @@
  31.51.35.147
  31.53.18.65
  31.53.222.46
+31.53.86.208
  31.54.18.237
  31.54.202.133
  31.54.210.21
@@ -105816,11 +99934,11 @@
  31.6.108.83
  31.6.11.173
  31.6.126.112
+31.6.127.52
  31.6.18.174
  31.6.21.46
  31.6.3.48
  31.6.71.218
-31.60.114.191
  31.7.185.28
  31.7.3.57
  31.7.59.204
@@ -105833,6 +99951,7 @@
  31.7.83.32
  31.8.89.161
  31.8.99.2
+31.9.220.218
  310051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  31105.ldayl.com
  311389119816825-dot-vui-egd-lhs.appspot.com
@@ -105886,7 +100005,6 @@
  3320p9.us-south.cf.appdomain.cloud
  332597.com
  33284nuvl6i8.us-south.cf.appdomain.cloud
-3333333333333333333certificatedpagesnvitationeam162024541112020.advanced-enable-certificated-pages-0636346436624655020.my.id
  3334444mij.000webhostapp.com
  33348.url.789msw.com
  334.tenstarrealtor.com
@@ -105919,36 +100037,39 @@
  33smbzj2p5b1.us-south.cf.appdomain.cloud
  33tang.com
  34.101.103.184
+34.101.110.211
  34.101.129.24
+34.101.132.198
  34.101.179.157
  34.101.186.204
  34.101.229.34
  34.101.245.236
  34.101.247.157
+34.101.65.231
  34.102.136.180
  34.105.119.151
  34.105.135.65
  34.105.139.99
+34.105.15.163
  34.105.158.154
  34.105.204.108
  34.105.219.235
  34.105.225.215
  34.105.241.167
  34.105.92.154
-34.106.113.236
+34.106.139.46
  34.106.151.6
  34.106.199.158
  34.106.217.38
  34.106.53.91
  34.106.58.234
  34.106.62.115
-34.106.93.46
-34.107.100.246
+34.106.78.170
  34.107.101.26
  34.107.22.206
  34.107.23.120
-34.107.31.61
  34.107.49.174
+34.121.120.20
  34.121.191.59
  34.121.220.45
  34.121.56.218
@@ -105956,27 +100077,27 @@
  34.122.121.188
  34.122.136.24
  34.122.143.82
+34.122.17.53
  34.122.32.203
-34.122.61.80
-34.122.64.205
  34.122.90.156
  34.123.129.183
  34.123.204.180
  34.123.41.205
  34.123.61.24
+34.123.84.183
  34.123.86.124
  34.125.126.33
  34.125.135.83
  34.125.14.221
-34.125.158.46
-34.125.174.191
-34.125.177.139
  34.125.183.133
  34.125.190.73
  34.125.195.215
+34.125.21.82
  34.125.250.245
+34.125.47.186
+34.125.63.10
  34.125.77.92
-34.125.89.31
+34.125.88.170
  34.125.91.37
  34.126.102.165
  34.126.107.179
@@ -105996,7 +100117,6 @@
  34.193.210.27
  34.193.35.86
  34.193.38.172
-34.194.12.146
  34.194.51.115
  34.195.157.48
  34.195.230.31
@@ -106014,10 +100134,8 @@
  34.200.228.249
  34.200.233.232
  34.200.239.206
-34.201.10.87
  34.201.115.218
  34.201.153.104
-34.201.171.216
  34.201.209.180
  34.201.229.41
  34.201.38.1
@@ -106049,7 +100167,6 @@
  34.206.190.120
  34.206.33.115
  34.206.4.227
-34.207.108.27
  34.207.112.44
  34.207.126.52
  34.207.135.186
@@ -106091,7 +100208,6 @@
  34.209.59.3
  34.209.64.246
  34.209.73.158
-34.209.85.10
  34.209.91.127
  34.209.95.213
  34.210.103.45
@@ -106116,7 +100232,6 @@
  34.211.164.172
  34.211.224.20
  34.211.249.140
-34.211.45.59
  34.211.45.83
  34.211.46.6
  34.211.65.11
@@ -106170,7 +100285,6 @@
  34.215.73.99
  34.216.124.250
  34.216.162.155
-34.216.163.75
  34.216.170.8
  34.216.202.234
  34.216.213.160
@@ -106190,8 +100304,6 @@
  34.218.77.246
  34.219.138.21
  34.219.154.16
-34.219.185.136
-34.219.199.249
  34.219.202.152
  34.219.204.22
  34.219.21.171
@@ -106200,13 +100312,10 @@
  34.219.240.62
  34.219.51.19
  34.220.102.44
-34.220.12.246
-34.220.127.213
  34.220.136.119
  34.220.144.124
  34.220.150.137
  34.220.162.40
-34.220.2.125
  34.220.232.128
  34.220.232.238
  34.220.235.52
@@ -106223,12 +100332,11 @@
  34.221.107.204
  34.221.179.213
  34.221.211.184
-34.221.229.176
-34.221.240.171
  34.221.241.181
  34.221.250.46
  34.221.26.152
  34.221.48.44
+34.221.55.39
  34.221.99.196
  34.221.99.7
  34.222.116.184
@@ -106248,7 +100356,6 @@
  34.223.60.188
  34.224.101.250
  34.224.169.11
-34.225.109.181
  34.226.118.117
  34.226.136.24
  34.226.139.65
@@ -106284,7 +100391,6 @@
  34.228.43.110
  34.228.44.213
  34.228.7.21
-34.228.85.116
  34.229.105.200
  34.229.113.79
  34.229.116.12
@@ -106317,6 +100423,7 @@
  34.231.21.96
  34.231.234.150
  34.232.106.159
+34.232.120.177
  34.232.63.88
  34.234.208.165
  34.234.63.156
@@ -106336,7 +100443,6 @@
  34.236.169.124
  34.236.242.177
  34.236.44.64
-34.236.8.245
  34.236.86.59
  34.237.15.134
  34.237.243.198
@@ -106346,7 +100452,6 @@
  34.238.153.76
  34.238.174.178
  34.238.193.141
-34.238.217.74
  34.238.39.172
  34.238.58.137
  34.239.0.159
@@ -106357,9 +100462,9 @@
  34.239.137.1
  34.239.142.43
  34.239.143.202
-34.239.187.93
  34.239.251.172
  34.239.97.88
+34.239.99.68
  34.240.146.14
  34.240.187.228
  34.240.91.216
@@ -106403,7 +100508,6 @@
  34.245.86.204
  34.246.144.143
  34.246.17.210
-34.246.222.68
  34.247.70.39
  34.247.86.108
  34.247.90.66
@@ -106457,17 +100561,15 @@
  34.255.135.131
  34.255.158.175
  34.255.9.223
+34.64.141.103
  34.64.151.153
-34.64.191.193
  34.64.218.102
  34.64.81.52
-34.64.93.254
  34.65.10.107
  34.65.148.162
  34.65.212.13
  34.65.215.160
  34.65.228.232
-34.66.101.36
  34.66.121.187
  34.66.208.65
  34.66.64.18
@@ -106482,10 +100584,10 @@
  34.68.180.110
  34.68.243.140
  34.68.38.190
+34.68.53.141
  34.69.104.28
  34.69.69.205
  34.70.109.189
-34.70.123.96
  34.70.138.19
  34.70.156.66
  34.70.198.5
@@ -106494,15 +100596,12 @@
  34.70.30.23
  34.70.49.158
  34.70.66.188
-34.70.89.32
  34.71.121.125
-34.71.187.254
  34.71.206.168
  34.71.210.159
  34.71.41.157
  34.71.54.212
  34.71.69.147
-34.71.74.7
  34.72.10.216
  34.72.134.217
  34.72.156.130
@@ -106510,36 +100609,29 @@
  34.72.183.48
  34.72.77.172
  34.72.85.73
+34.73.10.30
  34.73.101.96
  34.73.136.216
-34.73.144.77
-34.73.15.205
  34.73.222.92
+34.73.237.110
  34.73.24.17
-34.73.39.215
-34.73.40.158
  34.73.71.43
  34.73.81.215
  34.74.178.229
+34.74.178.245
  34.74.234.2
-34.74.240.5
+34.74.252.206
  34.74.26.21
  34.74.46.5
-34.75.125.212
  34.75.201.170
  34.75.240.129
  34.75.68.101
-34.77.127.43
-34.77.146.180
-34.77.244.210
-34.77.39.221
  34.77.55.50
  34.77.93.233
  34.78.14.25
  34.78.158.249
  34.78.159.8
  34.78.180.55
-34.78.227.15
  34.78.253.111
  34.78.48.104
  34.80.1.221
@@ -106558,12 +100650,10 @@
  34.80.4.40
  34.80.46.252
  34.80.90.118
-34.82.137.228
+34.82.103.75
  34.82.170.246
  34.82.195.26
-34.82.202.253
  34.82.203.253
-34.82.254.168
  34.82.27.159
  34.82.50.40
  34.82.60.66
@@ -106589,9 +100679,7 @@
  34.85.110.139
  34.85.117.175
  34.85.119.133
-34.85.15.47
  34.85.35.125
-34.85.44.150
  34.85.54.249
  34.85.61.87
  34.85.92.112
@@ -106601,20 +100689,19 @@
  34.86.205.89
  34.86.217.40
  34.86.22.137
-34.86.224.116
+34.86.228.49
  34.86.235.185
  34.86.46.35
  34.86.48.176
+34.86.8.132
  34.86.80.233
  34.86.94.66
-34.87.111.62
  34.87.112.13
  34.87.118.63
  34.87.141.31
  34.87.145.202
  34.87.155.114
  34.87.160.111
-34.87.167.186
  34.87.168.12
  34.87.171.184
  34.87.179.234
@@ -106628,32 +100715,30 @@
  34.87.242.193
  34.87.251.211
  34.87.40.17
-34.87.52.86
  34.87.53.100
  34.87.61.90
  34.87.70.59
  34.87.75.75
  34.87.88.54
  34.87.93.125
+34.89.113.184
  34.89.12.239
  34.89.120.156
  34.89.198.213
  34.89.199.188
  34.89.202.206
-34.89.215.144
-34.89.22.34
  34.89.228.34
  34.89.78.76
  34.89.86.67
  34.90.104.47
  34.90.113.143
+34.90.160.87
  34.90.172.65
  34.90.201.229
  34.90.45.51
  34.91.117.125
  34.91.126.242
  34.91.127.26
-34.91.150.112
  34.91.188.86
  34.91.195.229
  34.91.215.174
@@ -106666,27 +100751,20 @@
  34.92.164.48
  34.92.180.116
  34.92.202.36
-34.92.205.78
-34.92.209.215
  34.92.215.155
+34.92.219.178
  34.92.220.58
  34.92.222.132
-34.92.230.5
+34.92.241.255
+34.92.247.201
  34.92.250.26
-34.92.29.1
  34.92.29.25
-34.92.4.205
  34.92.57.239
  34.92.64.66
-34.92.68.172
-34.92.81.40
  34.92.87.60
+34.92.95.72
  34.93.0.165
-34.93.121.248
-34.93.122.78
  34.93.139.67
-34.93.149.4
-34.93.180.245
  34.93.204.215
  34.93.209.156
  34.93.211.102
@@ -106696,21 +100774,23 @@
  34.93.233.33
  34.93.237.166
  34.94.116.170
+34.94.137.151
  34.94.148.132
  34.94.188.208
+34.94.246.254
  34.94.246.70
  34.94.255.160
  34.94.29.47
-34.94.63.212
+34.94.30.169
  34.94.90.131
  34.94.93.161
  34.95.136.147
  34.95.140.129
  34.95.140.85
-34.95.149.149
+34.95.148.137
  34.95.155.154
+34.95.165.1
  34.95.167.94
-34.95.168.220
  34.95.183.86
  34.95.224.146
  34.95.254.204
@@ -106720,24 +100800,23 @@
  34.95.47.43
  34.95.48.40
  34.95.50.131
-34.95.55.52
  34.95.61.189
  34.96.107.204
-34.96.131.92
  34.96.145.46
  34.96.160.228
  34.96.179.10
  34.96.182.63
  34.96.185.33
  34.96.196.81
-34.96.206.236
  34.96.233.167
  34.96.248.115
  34.97.114.213
  34.97.13.87
  34.97.142.205
  34.97.176.217
+34.97.246.8
  34.97.78.39
+34.97.79.59
  34.97.86.22
  3401984-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  341185160.embeddedsw.org
@@ -106777,9 +100856,7 @@
  35-23-4532-34.com
  35-40konkatsu.net
  35.0.127.52
-35.129.216.86
  35.129.242.115
-35.129.93.60
  35.130.112.58
  35.130.122.122
  35.131.161.166
@@ -106789,7 +100866,6 @@
  35.141.98.170
  35.142.170.32
  35.142.195.99
-35.142.31.35
  35.143.99.174
  35.153.133.181
  35.153.167.247
@@ -106801,7 +100877,6 @@
  35.154.183.151
  35.154.188.207
  35.154.255.215
-35.154.30.244
  35.154.52.189
  35.154.62.240
  35.154.66.71
@@ -106833,9 +100908,9 @@
  35.157.238.171
  35.157.244.128
  35.157.25.9
+35.157.57.27
  35.157.66.43
  35.158.109.213
-35.158.160.121
  35.158.169.39
  35.158.185.217
  35.158.226.16
@@ -106884,7 +100959,6 @@
  35.162.85.112
  35.163.116.38
  35.163.123.239
-35.163.176.184
  35.163.217.119
  35.163.229.162
  35.163.233.41
@@ -106960,9 +101034,7 @@
  35.171.118.126
  35.171.155.11
  35.171.2.177
-35.171.28.189
  35.171.84.56
-35.172.116.1
  35.172.12.3
  35.172.14.232
  35.172.15.43
@@ -106975,6 +101047,7 @@
  35.173.221.11
  35.174.9.142
  35.175.179.11
+35.175.179.123
  35.175.184.240
  35.175.224.31
  35.175.55.104
@@ -107152,7 +101225,6 @@
  35.185.238.41
  35.185.246.46
  35.185.30.133
-35.185.40.110
  35.185.59.105
  35.185.6.49
  35.185.66.104
@@ -107165,6 +101237,7 @@
  35.186.151.74
  35.186.228.86
  35.187.108.126
+35.187.177.230
  35.187.2.55
  35.187.215.145
  35.187.223.176
@@ -107182,14 +101255,11 @@
  35.188.134.17
  35.188.14.97
  35.188.153.75
-35.188.166.245
-35.188.182.88
  35.188.191.27
  35.188.194.225
  35.188.205.223
  35.188.207.69
  35.188.236.209
-35.188.242.129
  35.188.26.12
  35.188.27.88
  35.188.29.36
@@ -107199,25 +101269,27 @@
  35.188.62.19
  35.188.86.127
  35.188.91.164
+35.189.17.69
  35.189.172.158
  35.189.178.95
  35.189.207.156
+35.189.223.35
  35.189.254.229
+35.189.27.73
  35.189.36.245
  35.189.37.238
-35.189.40.4
+35.189.76.12
  35.189.8.149
  35.189.84.191
  35.190.165.76
  35.190.168.211
+35.190.200.254
  35.192.113.118
  35.192.131.204
  35.192.132.255
  35.192.133.155
-35.192.156.59
  35.192.158.158
  35.192.16.224
-35.192.164.77
  35.192.17.244
  35.192.178.18
  35.192.219.160
@@ -107230,15 +101302,14 @@
  35.192.78.91
  35.192.88.64
  35.193.10.18
-35.193.134.10
  35.193.206.253
  35.193.216.14
  35.193.226.32
  35.193.243.70
-35.193.25.198
  35.193.26.216
  35.193.28.32
  35.193.33.159
+35.193.84.235
  35.193.98.172
  35.194.106.190
  35.194.111.42
@@ -107246,10 +101317,9 @@
  35.194.136.34
  35.194.150.24
  35.194.161.52
-35.194.178.89
+35.194.166.171
  35.194.190.162
  35.194.195.58
-35.194.198.183
  35.194.205.20
  35.194.205.255
  35.194.213.138
@@ -107261,7 +101331,6 @@
  35.194.4.89
  35.194.47.41
  35.194.49.225
-35.194.64.202
  35.194.65.252
  35.194.66.49
  35.194.76.3
@@ -107275,7 +101344,6 @@
  35.195.25.89
  35.195.30.252
  35.195.64.76
-35.195.86.207
  35.196.154.26
  35.196.186.81
  35.196.190.215
@@ -107287,7 +101355,6 @@
  35.196.35.82
  35.196.37.206
  35.196.70.139
-35.196.8.137
  35.196.89.175
  35.196.96.221
  35.197.124.137
@@ -107308,6 +101375,7 @@
  35.198.203.184
  35.198.204.244
  35.198.231.35
+35.198.238.242
  35.198.245.58
  35.198.246.84
  35.198.255.208
@@ -107315,6 +101383,7 @@
  35.198.49.11
  35.199.10.191
  35.199.100.152
+35.199.107.158
  35.199.111.145
  35.199.117.232
  35.199.29.36
@@ -107322,21 +101391,18 @@
  35.199.38.2
  35.199.40.199
  35.199.41.83
-35.199.82.233
  35.199.84.117
  35.199.85.150
  35.199.86.139
+35.199.88.255
  35.200.104.65
  35.200.114.187
  35.200.125.96
  35.200.139.168
  35.200.144.25
-35.200.145.32
  35.200.15.166
  35.200.16.180
-35.200.165.32
  35.200.168.65
-35.200.183.13
  35.200.185.127
  35.200.187.235
  35.200.187.49
@@ -107346,7 +101412,6 @@
  35.200.241.227
  35.200.252.133
  35.200.27.172
-35.200.60.134
  35.200.63.203
  35.200.71.247
  35.200.75.228
@@ -107356,7 +101421,6 @@
  35.201.11.31
  35.201.121.112
  35.201.13.82
-35.201.140.93
  35.201.153.139
  35.201.177.100
  35.201.193.137
@@ -107364,7 +101428,6 @@
  35.201.200.26
  35.201.227.227
  35.201.238.69
-35.201.28.15
  35.201.6.112
  35.201.7.175
  35.202.152.16
@@ -107379,6 +101442,7 @@
  35.202.72.149
  35.202.74.190
  35.202.80.94
+35.203.10.112
  35.203.100.41
  35.203.115.90
  35.203.15.57
@@ -107386,9 +101450,10 @@
  35.203.176.10
  35.203.181.190
  35.203.2.131
-35.203.38.167
  35.203.4.36
  35.203.41.106
+35.203.49.27
+35.203.55.159
  35.203.66.248
  35.203.68.135
  35.203.7.188
@@ -107396,18 +101461,19 @@
  35.203.90.175
  35.203.92.223
  35.204.1.184
-35.204.148.118
+35.204.114.205
+35.204.130.14
+35.204.137.151
  35.204.152.99
  35.204.191.150
  35.204.2.48
  35.204.212.152
  35.204.228.98
  35.204.31.217
-35.204.70.38
  35.204.91.115
  35.205.16.98
  35.205.22.29
-35.205.88.142
+35.205.83.203
  35.206.125.120
  35.207.1.8
  35.207.22.185
@@ -107415,38 +101481,39 @@
  35.207.8.221
  35.207.9.24
  35.208.14.82
-35.208.78.118
-35.209.128.174
  35.209.158.181
  35.209.182.232
  35.209.209.15
  35.209.51.212
  35.209.9.189
+35.211.127.27
  35.211.2.103
-35.211.51.221
+35.211.60.241
  35.211.9.3
  35.212.128.88
  35.212.163.36
-35.212.168.144
  35.212.237.223
+35.212.237.228
  35.212.238.207
  35.213.18.190
+35.214.21.4
  35.214.216.61
  35.215.2.174
  35.217.10.60
-35.220.136.127
  35.220.138.138
  35.220.144.111
  35.220.147.109
  35.220.155.26
  35.220.177.255
+35.220.179.119
  35.220.179.171
  35.220.199.212
+35.220.201.230
  35.220.202.33
  35.220.209.206
  35.220.212.29
  35.220.221.203
-35.220.240.149
+35.220.229.241
  35.220.253.166
  35.220.253.31
  35.221.114.222
@@ -107454,7 +101521,6 @@
  35.221.128.246
  35.221.158.174
  35.221.158.20
-35.221.168.3
  35.221.182.110
  35.221.196.29
  35.221.214.98
@@ -107465,53 +101531,43 @@
  35.221.254.120
  35.221.34.129
  35.222.103.143
-35.222.18.184
+35.222.67.194
  35.223.101.235
  35.223.139.109
  35.223.16.227
  35.223.167.122
+35.223.191.160
  35.223.249.176
  35.223.255.227
  35.224.1.26
  35.224.107.234
-35.224.108.132
-35.224.108.63
-35.224.121.138
  35.224.132.48
  35.224.144.160
  35.224.160.36
  35.224.161.45
-35.224.174.238
  35.224.193.51
  35.224.196.254
-35.224.204.56
-35.224.216.78
  35.224.221.202
  35.224.236.133
  35.224.248.68
  35.224.52.15
-35.224.93.149
  35.225.1.225
  35.225.107.161
  35.225.122.10
-35.225.127.48
  35.225.15.12
  35.225.173.185
  35.225.181.213
  35.225.191.140
-35.225.67.74
-35.225.76.119
  35.226.120.32
-35.226.127.38
  35.226.132.241
  35.226.14.224
  35.226.165.7
  35.226.172.128
  35.226.204.126
  35.226.232.224
+35.226.26.192
  35.226.50.174
  35.226.53.239
-35.226.60.77
  35.226.8.173
  35.226.81.181
  35.227.169.57
@@ -107529,14 +101585,17 @@
  35.228.173.101
  35.228.175.228
  35.228.19.163
+35.228.2.58
  35.228.210.96
  35.228.212.136
  35.228.237.149
  35.228.239.128
+35.228.24.69
  35.228.243.135
  35.228.246.186
  35.228.251.146
  35.228.71.136
+35.228.95.22
  35.229.108.202
  35.229.113.53
  35.229.123.111
@@ -107551,6 +101610,7 @@
  35.229.237.193
  35.229.246.203
  35.229.67.34
+35.229.68.5
  35.229.74.10
  35.230.132.134
  35.230.144.181
@@ -107563,12 +101623,12 @@
  35.230.88.52
  35.231.100.231
  35.231.106.59
+35.231.113.167
  35.231.140.212
  35.231.154.254
  35.231.179.223
  35.231.190.134
  35.231.20.10
-35.231.21.82
  35.231.211.161
  35.231.217.24
  35.231.223.140
@@ -107576,6 +101636,8 @@
  35.231.58.133
  35.231.88.244
  35.231.89.204
+35.232.138.65
+35.232.191.250
  35.232.213.202
  35.232.22.47
  35.232.228.59
@@ -107583,13 +101645,10 @@
  35.232.5.209
  35.232.52.162
  35.233.135.40
-35.233.149.129
  35.233.226.183
  35.233.235.80
  35.233.247.2
-35.233.86.50
  35.234.129.25
-35.234.136.100
  35.234.19.151
  35.234.52.44
  35.234.56.44
@@ -107598,11 +101657,13 @@
  35.235.107.110
  35.235.115.241
  35.235.84.44
+35.235.96.109
  35.236.118.211
+35.236.12.131
  35.236.125.18
  35.236.139.60
-35.236.145.244
  35.236.147.169
+35.236.147.87
  35.236.152.31
  35.236.160.131
  35.236.164.193
@@ -107617,11 +101678,8 @@
  35.236.68.211
  35.236.69.54
  35.236.94.232
-35.236.97.198
-35.237.108.133
  35.237.109.49
  35.237.11.177
-35.237.11.94
  35.237.128.40
  35.237.144.170
  35.237.208.95
@@ -107646,15 +101704,11 @@
  35.239.229.191
  35.239.42.76
  35.239.60.149
-35.239.78.81
-35.240.113.226
-35.240.133.86
  35.240.140.43
  35.240.155.89
  35.240.189.61
  35.240.196.72
  35.240.198.42
-35.240.200.223
  35.240.206.47
  35.240.218.174
  35.240.219.112
@@ -107670,55 +101724,51 @@
  35.241.66.61
  35.241.72.130
  35.242.148.200
-35.243.115.66
  35.243.174.84
  35.243.70.255
  35.243.80.4
-35.243.88.162
  35.243.99.49
  35.244.103.240
+35.244.103.242
  35.244.108.75
  35.244.120.134
  35.244.234.195
  35.244.25.124
-35.244.31.55
-35.244.47.234
  35.244.67.121
  35.244.92.76
-35.245.106.61
  35.245.113.177
  35.245.148.20
  35.245.173.118
  35.245.175.76
  35.245.186.117
  35.245.193.166
+35.245.230.216
  35.245.33.180
  35.245.48.156
  35.245.67.98
+35.246.132.82
  35.246.175.1
  35.246.181.234
  35.246.199.30
  35.246.206.89
+35.246.23.1
  35.246.242.183
  35.246.247.7
-35.246.31.140
  35.246.85.107
  35.246.90.134
  35.246.98.61
-35.247.111.163
  35.247.128.200
+35.247.138.101
  35.247.143.184
  35.247.149.160
  35.247.154.79
  35.247.160.19
-35.247.170.138
  35.247.171.81
  35.247.174.143
  35.247.175.47
  35.247.237.194
  35.247.241.173
  35.247.248.136
-35.247.248.24
  35.247.42.6
  35.247.43.218
  35.247.57.31
@@ -107746,7 +101796,6 @@
  36.103.223.40
  36.103.226.156
  36.103.241.148
-36.103.245.30
  36.104.144.251
  36.104.145.203
  36.105.15.120
@@ -107754,15 +101803,12 @@
  36.105.57.50
  36.107.129.163
  36.107.137.193
-36.107.231.56
  36.107.232.206
  36.107.233.232
  36.107.235.83
  36.107.236.145
  36.107.26.26
  36.107.75.55
-36.108.168.81
-36.108.170.241
  36.108.172.58
  36.109.133.37
  36.109.134.42
@@ -107772,7 +101818,6 @@
  36.110.110.34
  36.110.111.51
  36.110.142.239
-36.110.172.128
  36.110.182.30
  36.110.197.131
  36.110.197.202
@@ -107785,53 +101830,35 @@
  36.110.29.74
  36.110.3.51
  36.110.41.66
-36.110.50.254
  36.110.59.242
-36.110.68.138
  36.111.145.226
-36.111.146.209
  36.111.150.124
  36.111.150.54
  36.111.152.132
  36.111.160.189
+36.111.175.239
  36.111.177.64
  36.111.181.248
-36.111.182.123
  36.111.182.126
-36.111.182.128
  36.111.182.133
-36.111.182.35
  36.111.182.36
  36.111.182.37
-36.111.182.39
-36.111.182.47
-36.111.182.48
  36.111.182.49
-36.111.182.50
-36.111.182.51
-36.111.182.52
  36.111.195.5
  36.111.33.173
  36.111.33.70
-36.111.47.193
  36.112.101.130
-36.112.104.194
-36.112.108.195
  36.112.118.150
-36.112.118.154
  36.112.118.158
  36.112.118.174
  36.112.118.182
  36.112.128.193
  36.112.128.203
-36.112.128.52
  36.112.131.191
  36.112.133.220
  36.112.134.215
  36.112.136.33
  36.112.136.89
-36.112.137.55
-36.112.139.227
  36.112.139.24
  36.112.144.50
  36.112.144.51
@@ -107846,15 +101873,15 @@
  36.112.74.3
  36.129.8.224
  36.129.8.250
+36.133.0.37
  36.133.10.195
  36.133.10.222
  36.133.106.73
+36.133.107.74
  36.133.109.2
  36.133.109.23
  36.133.112.61
-36.133.121.12
  36.133.121.14
-36.133.121.19
  36.133.13.122
  36.133.131.151
  36.133.131.165
@@ -107864,52 +101891,51 @@
  36.133.141.236
  36.133.179.103
  36.133.193.13
+36.133.195.176
  36.133.198.58
+36.133.2.127
  36.133.2.177
  36.133.20.64
  36.133.214.100
  36.133.28.151
-36.133.28.50
-36.133.34.223
  36.133.38.134
-36.133.38.89
  36.133.40.103
  36.133.40.2
  36.133.40.45
  36.133.45.95
  36.133.5.142
  36.133.5.157
-36.133.5.170
  36.133.5.228
  36.133.5.26
  36.133.62.154
+36.133.74.141
+36.133.84.2
  36.133.97.79
  36.133.97.82
  36.134.20.73
  36.134.27.32
+36.134.38.147
  36.134.42.207
  36.134.54.40
-36.134.6.108
  36.134.69.10
+36.134.69.12
  36.134.69.253
  36.134.7.238
  36.134.71.18
  36.134.74.5
  36.134.75.7
-36.135.1.7
+36.134.79.80
+36.148.1.36
+36.148.1.75
  36.148.16.233
-36.148.18.226
  36.148.23.22
  36.148.28.197
-36.148.9.111
  36.152.102.254
  36.152.209.68
  36.152.214.226
-36.152.32.85
  36.152.32.87
  36.152.38.149
  36.152.65.134
-36.153.0.228
  36.153.205.142
  36.153.21.30
  36.153.231.18
@@ -107921,7 +101947,6 @@
  36.154.110.46
  36.154.117.210
  36.154.142.242
-36.154.171.130
  36.154.210.165
  36.154.210.166
  36.154.210.167
@@ -107934,26 +101959,20 @@
  36.154.8.103
  36.154.8.46
  36.154.8.5
-36.155.112.131
-36.155.113.199
  36.155.115.227
-36.155.115.72
-36.155.115.95
  36.155.117.36
  36.155.9.133
  36.156.139.75
  36.156.144.165
  36.156.145.68
  36.156.153.112
-36.156.155.192
-36.156.157.227
-36.156.158.207
  36.156.66.147
  36.159.106.69
  36.170.39.82
  36.170.52.254
  36.184.17.228
  36.184.19.245
+36.187.96.40
  36.189.253.226
  36.22.178.114
  36.22.187.34
@@ -107961,7 +101980,6 @@
  36.224.85.173
  36.225.101.38
  36.225.45.226
-36.225.8.210
  36.226.176.120
  36.226.20.161
  36.226.252.130
@@ -107974,12 +101992,11 @@
  36.227.152.186
  36.227.171.220
  36.227.238.40
+36.227.55.94
  36.227.73.116
  36.228.105.157
-36.228.42.145
  36.228.53.67
  36.228.56.237
-36.228.94.193
  36.229.113.162
  36.229.115.182
  36.229.162.230
@@ -107991,7 +102008,6 @@
  36.230.164.55
  36.230.193.172
  36.230.247.206
-36.230.247.96
  36.230.73.61
  36.230.81.186
  36.230.84.133
@@ -108017,7 +102033,6 @@
  36.233.99.65
  36.234.180.56
  36.235.105.226
-36.235.135.192
  36.235.210.112
  36.235.38.144
  36.235.40.196
@@ -108038,6 +102053,7 @@
  36.237.70.61
  36.237.81.191
  36.237.9.61
+36.238.102.54
  36.238.108.14
  36.238.114.16
  36.238.36.157
@@ -108046,15 +102062,12 @@
  36.238.52.189
  36.238.54.160
  36.238.55.242
-36.239.1.165
  36.239.101.50
  36.239.104.178
  36.239.112.192
  36.239.145.176
  36.239.165.74
-36.239.240.43
  36.239.36.37
-36.239.56.99
  36.239.63.150
  36.239.73.161
  36.239.74.201
@@ -108068,16 +102081,19 @@
  36.239.87.36
  36.239.92.36
  36.24.139.230
-36.24.2.221
  36.24.9.43
+36.248.149.27
  36.248.153.3
  36.248.161.205
  36.248.162.91
  36.248.164.231
  36.248.169.137
+36.248.169.146
  36.248.169.181
+36.248.170.140
  36.248.170.168
  36.248.170.225
+36.248.182.171
  36.248.182.190
  36.248.182.204
  36.248.182.235
@@ -108096,16 +102112,17 @@
  36.250.174.98
  36.250.175.14
  36.250.175.148
+36.250.175.156
  36.250.175.193
+36.250.175.85
  36.250.182.249
+36.250.185.133
  36.250.186.201
  36.250.186.63
  36.250.203.94
  36.250.229.115
-36.250.229.97
  36.250.5.117
  36.250.75.44
-36.251.151.56
  36.251.19.231
  36.251.52.129
  36.251.66.253
@@ -108120,11 +102137,10 @@
  36.255.133.246
  36.255.156.126
  36.255.156.78
-36.255.158.237
  36.255.211.1
  36.255.220.2
  36.255.248.130
-36.255.250.54
+36.255.250.53
  36.255.61.190
  36.255.61.26
  36.255.85.227
@@ -108143,25 +102159,20 @@
  36.255.87.240
  36.255.87.247
  36.255.87.250
+36.26.142.91
  36.26.155.23
  36.26.194.61
  36.26.194.83
  36.26.210.57
  36.26.48.234
  36.26.68.41
-36.26.78.36
-36.26.82.40
  36.26.84.45
-36.26.85.60
  36.26.87.107
  36.26.91.200
-36.26.95.179
-36.27.128.160
  36.27.208.157
  36.27.209.188
  36.27.29.199
-36.27.29.232
-36.27.30.248
+36.27.30.66
  36.27.33.168
  36.27.33.216
  36.32.110.7
@@ -108183,9 +102194,11 @@
  36.33.140.248
  36.33.162.8
  36.33.192.123
-36.33.21.117
+36.33.31.73
+36.34.15.70
  36.34.150.235
  36.34.86.44
+36.35.155.92
  36.35.160.188
  36.35.160.240
  36.35.161.107
@@ -108214,9 +102227,7 @@
  36.37.139.2
  36.37.155.163
  36.37.157.250
-36.37.174.228
  36.37.175.123
-36.37.177.186
  36.37.180.59
  36.37.183.214
  36.37.197.171
@@ -108226,6 +102237,7 @@
  36.37.73.245
  36.37.81.135
  36.37.98.82
+36.38.123.181
  36.38.59.139
  36.39.143.52
  36.39.161.23
@@ -108234,23 +102246,22 @@
  36.43.65.41
  36.44.136.10
  36.44.137.207
+36.44.137.68
  36.44.155.55
  36.44.156.71
  36.44.16.122
-36.45.160.27
  36.45.177.195
  36.45.177.213
  36.45.183.24
  36.46.135.38
-36.46.142.80
  36.46.172.231
  36.46.173.10
  36.46.173.199
  36.46.173.3
  36.46.174.102
  36.46.174.199
+36.48.144.135
  36.48.144.203
-36.48.145.135
  36.48.145.230
  36.48.145.5
  36.48.159.5
@@ -108259,9 +102270,8 @@
  36.49.92.152
  36.5.216.25
  36.5.93.146
-36.5.93.86
-36.5.94.178
  36.55.230.146
+36.56.191.54
  36.57.37.119
  36.57.37.121
  36.57.37.135
@@ -108270,6 +102280,7 @@
  36.57.37.71
  36.6.140.47
  36.6.159.103
+36.6.159.112
  36.6.57.42
  36.62.10.175
  36.62.10.19
@@ -108279,6 +102290,7 @@
  36.62.11.101
  36.62.238.137
  36.62.238.254
+36.62.239.105
  36.62.8.1
  36.62.8.144
  36.62.8.18
@@ -108334,7 +102346,6 @@
  36.66.34.4
  36.66.36.251
  36.66.36.252
-36.66.43.65
  36.66.48.187
  36.66.53.191
  36.66.61.119
@@ -108346,8 +102357,6 @@
  36.66.98.236
  36.66.98.237
  36.66.98.6
-36.67.106.109
-36.67.106.58
  36.67.109.165
  36.67.11.41
  36.67.112.11
@@ -108389,7 +102398,6 @@
  36.67.27.189
  36.67.27.205
  36.67.27.211
-36.67.32.45
  36.67.38.135
  36.67.38.25
  36.67.51.186
@@ -108399,7 +102407,6 @@
  36.67.57.45
  36.67.63.239
  36.67.63.29
-36.67.66.100
  36.67.66.202
  36.67.68.21
  36.67.7.33
@@ -108414,7 +102421,9 @@
  36.67.93.210
  36.67.93.214
  36.68.100.181
-36.68.22.190
+36.68.149.240
+36.68.222.207
+36.68.223.5
  36.68.63.166
  36.69.184.79
  36.69.229.204
@@ -108427,7 +102436,7 @@
  36.7.138.214
  36.7.140.21
  36.7.142.146
-36.7.159.235
+36.7.149.205
  36.7.159.60
  36.7.159.62
  36.7.168.201
@@ -108438,7 +102447,6 @@
  36.7.185.155
  36.7.188.109
  36.7.68.210
-36.7.68.25
  36.7.69.56
  36.7.80.168
  36.7.84.14
@@ -108451,14 +102459,15 @@
  36.71.137.52
  36.71.140.15
  36.71.140.9
+36.71.212.80
  36.71.215.145
  36.71.235.183
  36.71.34.111
  36.71.34.240
  36.71.74.139
  36.71.79.208
-36.72.14.234
  36.72.14.69
+36.72.214.246
  36.72.217.109
  36.72.218.19
  36.72.236.35
@@ -108466,7 +102475,6 @@
  36.72.57.115
  36.72.83.222
  36.73.163.185
-36.73.197.36
  36.73.22.199
  36.73.27.78
  36.73.30.43
@@ -108476,47 +102484,40 @@
  36.74.144.83
  36.74.148.66
  36.74.161.186
-36.74.171.216
  36.74.185.98
  36.74.188.7
  36.74.202.198
  36.74.236.180
  36.74.27.23
  36.74.35.183
-36.74.70.111
  36.74.75.31
  36.75.212.60
  36.75.41.153
+36.75.64.158
  36.75.66.55
+36.76.189.64
  36.76.208.183
  36.76.89.130
  36.77.131.141
  36.77.138.152
-36.77.26.210
+36.77.26.233
  36.77.45.165
-36.77.59.208
  36.77.60.255
  36.78.140.51
  36.78.210.176
-36.78.249.251
  36.79.20.187
  36.79.220.162
  36.79.32.137
  36.79.70.247
  36.80.100.96
  36.80.109.12
-36.80.112.240
-36.80.136.143
-36.80.147.43
  36.80.34.225
  36.80.36.57
  36.80.48.9
  36.81.103.149
  36.81.203.211
  36.81.255.22
-36.81.3.145
  36.82.1.172
-36.82.106.238
  36.82.144.35
  36.82.17.39
  36.82.247.13
@@ -108541,7 +102542,6 @@
  36.85.222.34
  36.85.222.55
  36.85.46.83
-36.85.49.202
  36.85.91.95
  36.88.235.207
  36.89.10.51
@@ -108552,7 +102552,6 @@
  36.89.129.183
  36.89.135.203
  36.89.143.171
-36.89.143.21
  36.89.143.23
  36.89.145.162
  36.89.147.123
@@ -108562,8 +102561,6 @@
  36.89.155.66
  36.89.156.162
  36.89.156.211
-36.89.157.197
-36.89.163.178
  36.89.165.13
  36.89.165.89
  36.89.169.170
@@ -108613,6 +102610,7 @@
  36.89.32.227
  36.89.41.113
  36.89.51.25
+36.89.55.95
  36.89.65.253
  36.89.65.5
  36.89.68.38
@@ -108625,51 +102623,42 @@
  36.89.93.28
  36.89.94.139
  36.89.99.98
+36.90.11.104
  36.90.119.211
  36.90.123.171
  36.90.123.172
  36.90.123.173
-36.90.15.64
-36.90.156.154
-36.90.166.222
-36.90.167.118
-36.90.169.123
  36.90.169.159
  36.90.17.54
  36.90.170.105
  36.90.171.232
-36.90.172.236
  36.90.173.245
  36.90.18.202
  36.90.224.180
-36.90.224.2
-36.90.224.209
-36.90.32.3
  36.90.38.251
-36.90.40.233
  36.90.41.242
  36.90.42.169
  36.90.42.81
-36.90.43.66
+36.90.43.218
  36.90.43.75
+36.90.48.187
  36.90.48.243
-36.90.50.71
  36.90.51.167
  36.90.51.205
  36.90.51.212
  36.90.53.251
-36.90.58.1
+36.90.54.144
  36.90.60.177
  36.90.61.118
  36.90.61.132
  36.90.61.201
  36.90.61.208
+36.90.61.238
  36.90.62.212
  36.90.62.25
  36.90.63.177
  36.90.63.77
  36.90.66.53
-36.90.67.1
  36.90.85.162
  36.91.115.21
  36.91.119.243
@@ -108687,7 +102676,6 @@
  36.91.36.155
  36.91.37.155
  36.91.38.31
-36.91.40.132
  36.91.44.183
  36.91.45.10
  36.91.48.186
@@ -108702,7 +102690,6 @@
  36.92.109.147
  36.92.111.143
  36.92.125.37
-36.92.126.109
  36.92.138.25
  36.92.147.99
  36.92.151.149
@@ -108716,23 +102703,21 @@
  36.92.211.43
  36.92.222.105
  36.92.35.73
-36.92.57.235
  36.92.57.87
  36.92.67.165
  36.92.68.141
  36.92.68.145
-36.92.7.159
  36.92.70.209
  36.92.80.5
  36.92.83.178
  36.92.9.75
  36.92.93.139
  36.92.93.61
-36.94.100.74
-36.94.112.194
  36.94.119.139
  36.94.12.210
  36.94.130.176
+36.94.132.171
+36.94.132.241
  36.94.142.140
  36.94.142.250
  36.94.145.21
@@ -108758,10 +102743,7 @@
  36.99.160.161
  36.99.161.193
  36.99.175.246
-36.99.180.242
-36.99.193.6
  36.99.35.61
-36.99.39.95
  36.99.40.139
  36.99.41.29
  36.99.44.70
@@ -109030,14 +103012,16 @@
  36s52f.xyz
  36scanniointeriors.com
  37-72-175-173.static.hvvc.us
+37.0.49.205
  37.1.196.156
  37.1.200.82
  37.1.208.100
+37.1.208.168
  37.1.216.172
  37.10.127.82
  37.104.112.176
-37.105.218.126
-37.105.226.126
+37.104.127.212
+37.105.239.64
  37.106.122.158
  37.106.28.200
  37.107.67.177
@@ -109048,17 +103032,14 @@
  37.110.135.108
  37.110.66.21
  37.110.85.88
-37.110.93.183
  37.111.42.210
-37.112.174.166
-37.112.210.203
+37.112.180.154
  37.112.227.224
  37.112.41.224
  37.112.47.170
  37.112.50.99
  37.112.60.154
  37.113.131.22
-37.113.176.101
  37.113.187.152
  37.113.47.145
  37.114.149.20
@@ -109066,7 +103047,6 @@
  37.114.61.73
  37.115.112.150
  37.115.121.13
-37.115.144.226
  37.115.184.246
  37.115.186.114
  37.115.190.73
@@ -109086,26 +103066,30 @@
  37.119.252.159
  37.119.60.181
  37.120.138.83
+37.120.138.86
  37.120.138.91
  37.120.138.92
  37.120.140.134
  37.120.142.230
  37.120.143.152
  37.120.143.163
-37.120.144.233
+37.120.144.231
  37.120.145.126
+37.120.145.163
  37.120.146.26
  37.120.148.78
  37.120.171.27
  37.120.176.61
  37.120.192.154
  37.120.198.253
+37.120.201.244
  37.120.202.53
  37.120.203.131
  37.120.203.73
  37.120.205.186
  37.120.205.188
  37.120.213.170
+37.120.215.68
  37.120.217.11
  37.120.217.67
  37.120.217.77
@@ -109123,9 +103107,9 @@
  37.123.143.94
  37.123.153.10
  37.123.153.41
-37.123.163.106
+37.123.162.190
  37.123.166.86
-37.123.222.124
+37.123.207.188
  37.123.246.36
  37.128.107.98
  37.128.181.25
@@ -109149,11 +103133,11 @@
  37.134.200.239
  37.134.238.244
  37.135.138.247
-37.135.57.46
+37.138.202.127
  37.139.0.44
  37.139.1.197
+37.139.11.239
  37.139.15.140
-37.139.15.164
  37.139.15.38
  37.139.15.91
  37.139.16.206
@@ -109162,7 +103146,6 @@
  37.139.17.71
  37.139.19.78
  37.139.19.89
-37.139.2.218
  37.139.2.233
  37.139.2.242
  37.139.2.57
@@ -109193,10 +103176,8 @@
  37.139.8.104
  37.139.85.66
  37.139.9.23
-37.14.130.140
  37.14.141.51
-37.140.198.25
-37.142.118.244
+37.140.192.155
  37.142.120.186
  37.142.180.53
  37.142.207.244
@@ -109205,12 +103186,14 @@
  37.143.130.183
  37.143.135.161
  37.143.9.107
+37.144.41.232
+37.145.152.36
  37.145.74.29
  37.146.188.143
  37.146.72.75
+37.147.98.36
  37.148.209.168
  37.148.211.78
-37.15.208.22
  37.150.108.164
  37.150.56.201
  37.150.58.77
@@ -109223,11 +103206,6 @@
  37.151.37.85
  37.152.163.35
  37.152.176.65
-37.152.178.44
-37.152.179.110
-37.152.181.151
-37.152.183.16
-37.152.183.18
  37.152.185.214
  37.152.187.44
  37.152.239.229
@@ -109243,8 +103221,9 @@
  37.157.254.19
  37.157.40.4
  37.157.75.3
-37.159.10.197
  37.159.208.218
+37.159.26.76
+37.160.133.106
  37.17.12.32
  37.17.12.33
  37.17.16.61
@@ -109255,15 +103234,13 @@
  37.17.182.24
  37.17.237.111
  37.17.56.44
-37.17.65.154
  37.17.73.220
  37.17.9.140
  37.17.9.28
-37.176.2.255
+37.173.36.177
  37.179.145.105
  37.179.164.177
  37.179.204.33
-37.179.206.153
  37.18.184.10
  37.18.184.47
  37.182.160.87
@@ -109272,6 +103249,7 @@
  37.182.79.164
  37.183.188.131
  37.183.194.157
+37.183.195.125
  37.183.198.98
  37.183.247.24
  37.186.118.64
@@ -109279,13 +103257,10 @@
  37.186.127.24
  37.186.249.90
  37.187.0.20
-37.187.1.235
  37.187.100.150
  37.187.100.50
-37.187.101.66
  37.187.102.202
  37.187.102.226
-37.187.102.235
  37.187.103.237
  37.187.103.54
  37.187.104.135
@@ -109293,7 +103268,6 @@
  37.187.105.36
  37.187.106.104
  37.187.107.217
-37.187.109.219
  37.187.109.60
  37.187.11.61
  37.187.113.144
@@ -109306,24 +103280,19 @@
  37.187.117.187
  37.187.117.39
  37.187.118.150
-37.187.119.181
  37.187.12.100
  37.187.12.126
  37.187.122.82
  37.187.124.209
  37.187.124.25
-37.187.125.235
-37.187.125.32
  37.187.125.87
  37.187.129.166
  37.187.129.227
  37.187.130.92
  37.187.132.132
-37.187.132.151
  37.187.132.190
  37.187.132.31
  37.187.132.5
-37.187.133.169
  37.187.134.111
  37.187.135.130
  37.187.135.6
@@ -109343,14 +103312,12 @@
  37.187.181.182
  37.187.19.207
  37.187.190.2
-37.187.195.209
  37.187.196.218
  37.187.196.227
  37.187.2.199
  37.187.2.31
  37.187.2.76
  37.187.21.81
-37.187.22.227
  37.187.22.60
  37.187.222.53
  37.187.23.106
@@ -109360,7 +103327,6 @@
  37.187.3.112
  37.187.3.53
  37.187.39.210
-37.187.5.137
  37.187.5.202
  37.187.53.168
  37.187.53.180
@@ -109386,12 +103352,11 @@
  37.187.94.86
  37.187.95.218
  37.187.96.95
-37.187.99.16
  37.189.244.143
  37.19.86.225
  37.19.95.12
  37.191.130.66
-37.191.137.150
+37.191.133.60
  37.191.157.81
  37.191.171.100
  37.191.179.253
@@ -109410,12 +103375,10 @@
  37.192.51.8
  37.193.123.110
  37.193.125.103
-37.193.158.9
  37.193.175.55
  37.193.227.16
  37.193.3.46
  37.193.60.9
-37.193.61.38
  37.193.65.172
  37.193.86.120
  37.194.166.177
@@ -109424,8 +103387,11 @@
  37.194.29.155
  37.195.209.169
  37.196.26.48
+37.20.185.37
+37.20.208.110
  37.200.77.123
  37.201.116.60
+37.201.137.207
  37.201.139.174
  37.202.103.152
  37.202.116.197
@@ -109441,10 +103407,8 @@
  37.203.174.78
  37.203.236.29
  37.204.11.167
-37.204.219.150
  37.205.12.100
  37.205.14.137
-37.205.51.40
  37.205.8.78
  37.205.81.41
  37.206.130.116
@@ -109455,35 +103419,31 @@
  37.208.30.143
  37.209.12.197
  37.21.127.199
-37.210.144.44
  37.210.43.114
  37.211.186.233
  37.211.19.161
  37.211.43.154
  37.211.50.203
  37.211.7.90
-37.211.77.84
  37.211.79.233
-37.211.92.128
  37.212.138.205
  37.212.182.90
-37.212.183.39
  37.212.224.179
  37.212.252.97
  37.212.41.233
  37.212.8.236
  37.213.123.47
  37.213.229.124
+37.214.117.211
  37.214.181.208
  37.214.67.130
  37.215.189.209
-37.215.34.33
-37.215.39.225
  37.215.9.127
  37.218.191.190
  37.218.242.209
  37.218.245.25
  37.220.109.238
+37.220.195.14
  37.220.22.106
  37.220.22.131
  37.220.31.119
@@ -109498,37 +103458,36 @@
  37.220.35.202
  37.220.35.36
  37.220.36.240
-37.221.106.175
  37.221.163.218
+37.221.178.105
  37.221.178.157
+37.221.178.204
  37.221.178.236
  37.221.178.237
-37.221.178.46
+37.221.178.44
+37.221.178.47
  37.221.178.50
-37.221.178.58
+37.221.178.74
  37.221.178.85
-37.221.178.86
-37.221.179.132
-37.221.179.154
-37.221.179.204
-37.221.179.206
+37.221.179.149
+37.221.179.155
+37.221.179.174
+37.221.179.200
+37.221.179.205
+37.221.179.207
  37.221.179.233
  37.221.179.236
  37.221.179.237
-37.221.179.30
  37.221.179.42
-37.221.181.130
-37.221.181.149
+37.221.181.124
  37.221.181.178
-37.221.182.156
+37.221.181.7
  37.221.182.162
-37.221.182.172
-37.221.182.179
-37.221.182.227
+37.221.182.165
  37.221.182.238
+37.221.183.119
  37.221.183.124
  37.221.183.192
-37.221.183.26
  37.221.183.41
  37.221.183.54
  37.221.183.59
@@ -109536,16 +103495,11 @@
  37.221.209.222
  37.221.214.24
  37.221.248.111
-37.221.248.4
  37.222.98.51
  37.223.0.196
-37.223.57.41
-37.223.6.16
  37.224.115.7
  37.224.20.33
  37.224.51.251
-37.228.107.241
-37.228.117.33
  37.228.129.2
  37.228.129.237
  37.228.129.5
@@ -109567,7 +103521,7 @@
  37.230.206.15
  37.230.99.119
  37.232.128.192
-37.232.191.183
+37.232.186.185
  37.232.34.201
  37.232.4.12
  37.232.98.103
@@ -109579,10 +103533,8 @@
  37.233.77.228
  37.233.99.157
  37.235.102.249
-37.235.105.243
  37.235.142.10
  37.235.153.214
-37.235.17.248
  37.235.178.123
  37.235.203.91
  37.235.206.211
@@ -109594,27 +103546,23 @@
  37.236.167.250
  37.237.111.235
  37.237.65.43
-37.238.119.190
  37.238.130.50
  37.238.130.84
  37.238.135.69
  37.238.136.74
  37.239.46.2
  37.239.46.26
+37.24.128.100
  37.24.240.15
-37.24.255.158
-37.24.8.99
  37.242.2.36
  37.247.111.141
  37.247.209.179
-37.248.156.231
  37.250.61.61
  37.251.220.10
  37.252.11.91
  37.252.15.13
  37.252.15.241
  37.252.187.140
-37.252.188.130
  37.252.190.224
  37.252.200.191
  37.252.231.75
@@ -109634,8 +103582,8 @@
  37.252.77.194
  37.252.77.196
  37.252.77.200
+37.252.8.185
  37.255.183.3
-37.255.197.63
  37.255.198.32
  37.255.199.246
  37.255.209.94
@@ -109675,7 +103623,6 @@
  37.37.131.14
  37.37.146.15
  37.4.227.227
-37.41.104.46
  37.44.137.205
  37.44.237.102
  37.44.252.16
@@ -109688,24 +103635,31 @@
  37.44.253.13
  37.44.253.164
  37.44.253.186
+37.44.253.243
+37.44.254.116
  37.44.254.153
  37.44.254.166
  37.44.254.171
  37.44.254.173
  37.44.254.177
  37.44.254.179
-37.44.254.181
+37.44.254.187
+37.44.254.190
  37.44.254.192
+37.44.254.224
  37.44.254.252
-37.44.254.253
+37.44.254.47
  37.44.254.64
  37.44.255.116
+37.44.255.121
+37.44.255.14
+37.44.255.180
  37.44.255.19
  37.44.255.195
  37.44.255.207
+37.44.255.21
  37.44.255.246
-37.44.255.49
-37.44.255.66
+37.44.255.33
  37.44.88.83
  37.45.1.155
  37.45.14.241
@@ -109724,7 +103678,6 @@
  37.46.150.169
  37.46.150.17
  37.46.150.177
-37.46.150.199
  37.46.150.207
  37.46.150.235
  37.46.150.24
@@ -109738,7 +103691,6 @@
  37.46.32.124
  37.46.73.5
  37.47.130.73
-37.47.30.234
  37.48.103.228
  37.48.105.203
  37.48.109.107
@@ -109746,7 +103698,6 @@
  37.48.120.196
  37.48.125.238
  37.48.65.175
-37.48.70.74
  37.48.73.19
  37.48.84.223
  37.48.90.222
@@ -109792,7 +103743,6 @@
  37.49.224.87
  37.49.224.9
  37.49.224.98
-37.49.225.106
  37.49.225.111
  37.49.225.115
  37.49.225.12
@@ -109800,28 +103750,22 @@
  37.49.225.123
  37.49.225.134
  37.49.225.140
-37.49.225.15
+37.49.225.146
  37.49.225.152
  37.49.225.153
  37.49.225.154
-37.49.225.157
  37.49.225.159
  37.49.225.164
  37.49.225.165
-37.49.225.167
-37.49.225.169
+37.49.225.166
  37.49.225.170
  37.49.225.171
  37.49.225.183
  37.49.225.190
  37.49.225.194
  37.49.225.196
-37.49.225.198
  37.49.225.200
-37.49.225.207
-37.49.225.223
  37.49.225.225
-37.49.225.229
  37.49.225.23
  37.49.225.233
  37.49.225.245
@@ -109895,7 +103839,6 @@
  37.49.230.169
  37.49.230.17
  37.49.230.178
-37.49.230.179
  37.49.230.180
  37.49.230.190
  37.49.230.195
@@ -109936,6 +103879,7 @@
  37.53.83.130
  37.53.89.16
  37.53.93.198
+37.54.1.5
  37.54.151.160
  37.55.141.180
  37.55.18.244
@@ -109972,9 +103916,7 @@
  37.58.75.46
  37.59.106.38
  37.59.109.58
-37.59.112.180
  37.59.123.166
-37.59.125.163
  37.59.138.199
  37.59.141.40
  37.59.160.146
@@ -109992,17 +103934,13 @@
  37.59.223.107
  37.59.224.39
  37.59.229.31
-37.59.232.6
  37.59.234.155
  37.59.239.26
-37.59.244.142
  37.59.31.135
  37.59.36.210
-37.59.37.69
  37.59.37.74
  37.59.38.74
  37.59.43.63
-37.59.44.134
  37.59.44.40
  37.59.44.43
  37.59.46.228
@@ -110014,20 +103952,17 @@
  37.59.48.36
  37.59.50.14
  37.59.50.81
-37.59.50.84
  37.59.53.126
  37.59.53.135
+37.59.54.36
  37.59.55.128
-37.59.55.14
  37.59.56.107
  37.59.56.124
  37.59.56.74
-37.59.57.227
  37.59.57.96
  37.59.58.142
  37.59.58.8
  37.59.60.115
-37.59.61.13
  37.59.61.212
  37.59.62.105
  37.59.62.38
@@ -110049,18 +103984,15 @@
  37.6.52.78
  37.6.55.173
  37.6.64.233
-37.6.77.97
  37.60.190.98
  37.60.211.74
  37.61.202.71
  37.61.219.34
  37.61.219.53
-37.70.130.54
  37.70.131.107
  37.72.175.160
  37.72.175.206
  37.72.186.132
-37.72.190.177
  37.75.127.240
  37.75.81.120
  37.76.154.230
@@ -110092,7 +104024,7 @@
  37.79.0.184
  37.79.129.240
  37.79.131.229
-37.79.251.4
+37.79.244.174
  37.79.4.242
  37.8.3.193
  37.9.134.133
@@ -110101,33 +104033,49 @@
  37.9.169.4
  37.9.169.5
  37.9.176.160
+37.9.192.204
  37.9.40.114
  37.9.40.116
+37.9.41.188
+37.9.41.19
  37.9.41.202
-37.9.41.98
+37.9.41.213
+37.9.41.217
+37.9.41.236
  37.9.44.241
  37.9.44.243
+37.9.44.250
  37.9.45.248
+37.9.46.206
  37.9.46.237
  37.9.46.29
  37.9.47.147
  37.9.47.161
+37.9.47.209
+37.9.47.217
+37.9.47.225
+37.9.47.234
  37.9.53.123
  37.97.139.116
  37.97.173.245
  37.97.190.174
  37.97.191.18
  37.97.249.17
-37.98.196.162
-37.98.196.186
  37.98.196.42
  37.98.231.2
  37.99.132.138
  37.99.141.12
  37.99.214.45
+37.99.250.179
+37.99.250.8
+37.99.251.225
  37.99.252.153
+37.99.252.185
+37.99.252.209
  37.99.253.102
  37.99.253.62
+37.99.254.75
+37.99.255.146
  37.99.255.59
  37.99.33.183
  37015.url.hen360.com
@@ -110248,9 +104196,6 @@
  38.100.21.68
  38.100.21.78
  38.101.199.228
-38.102.172.37
-38.102.172.44
-38.102.173.7
  38.102.254.23
  38.102.28.1
  38.102.69.70
@@ -110260,7 +104205,6 @@
  38.108.81.53
  38.109.195.42
  38.111.114.148
-38.121.63.198
  38.122.16.146
  38.123.64.242
  38.124.1.228
@@ -110271,18 +104215,17 @@
  38.130.75.38
  38.130.75.49
  38.131.31.156
-38.132.103.149
  38.132.124.147
  38.132.65.178
  38.133.200.94
  38.140.231.10
  38.142.63.146
  38.143.11.21
-38.143.18.224
  38.143.3.107
+38.143.68.25
  38.145.201.162
  38.145.201.41
-38.21.240.216
+38.146.91.230
  38.242.12.100
  38.242.21.27
  38.29.136.44
@@ -110299,12 +104242,10 @@
  38.68.53.129
  38.69.48.2
  38.73.238.138
-38.73.238.247
  38.74.21.183
  38.75.38.144
  38.75.38.150
  38.77.16.239
-38.78.210.125
  38.80.148.37
  38.81.163.11
  38.81.163.2
@@ -110342,51 +104283,41 @@
  38963.xc.liaochuo.com
  38f1d44f1a954bd72362716c792b3cf7-dot-dbenitonline.ey.r.appspot.com
  38seventeen.com
-39.100.106.42
  39.100.112.86
-39.100.119.208
-39.100.123.55
-39.100.14.104
-39.100.142.87
-39.100.149.197
+39.100.227.126
  39.100.230.115
  39.100.28.147
  39.100.36.150
  39.100.37.39
  39.100.65.211
+39.100.88.14
  39.100.90.147
  39.101.136.226
  39.101.142.197
  39.101.206.20
-39.101.207.5
-39.102.34.118
-39.102.38.42
  39.103.139.6
  39.103.175.42
+39.104.114.87
  39.104.118.116
  39.104.14.142
  39.104.166.20
  39.104.66.185
  39.104.77.51
  39.104.88.227
-39.104.92.51
  39.105.121.125
  39.105.129.219
  39.105.136.217
  39.105.149.234
-39.105.166.115
  39.105.175.153
+39.105.192.221
+39.105.192.77
  39.105.200.55
+39.105.209.58
  39.105.45.201
  39.105.46.101
  39.105.64.68
-39.105.65.32
-39.105.75.253
-39.105.76.21
  39.105.80.23
  39.105.85.40
-39.105.92.0
-39.105.94.150
  39.106.117.121
  39.106.118.147
  39.106.13.134
@@ -110401,17 +104332,17 @@
  39.106.229.113
  39.106.46.102
  39.106.7.117
-39.106.77.90
+39.106.9.129
  39.106.9.88
  39.106.97.156
  39.107.158.80
  39.107.181.166
+39.107.181.240
  39.107.226.105
  39.107.232.43
  39.107.234.140
  39.107.236.42
  39.107.40.43
-39.107.53.246
  39.107.69.172
  39.108.104.226
  39.108.123.4
@@ -110420,12 +104351,12 @@
  39.108.167.47
  39.108.3.76
  39.108.49.78
+39.108.64.20
  39.108.68.237
  39.109.112.98
  39.109.115.176
  39.109.122.127
  39.109.122.156
-39.109.123.214
  39.109.126.162
  39.109.127.81
  39.109.129.100
@@ -110452,19 +104383,16 @@
  39.113.100.56
  39.113.245.254
  39.114.141.64
-39.115.113.146
  39.115.133.87
  39.118.131.43
  39.119.127.117
  39.121.63.35
  39.122.186.3
-39.122.32.208
  39.123.120.121
  39.123.135.12
  39.123.255.55
  39.129.116.158
  39.129.15.246
-39.129.176.133
  39.129.209.95
  39.129.27.73
  39.129.27.80
@@ -110480,7 +104408,6 @@
  39.152.133.169
  39.152.133.8
  39.152.16.22
-39.152.177.33
  39.152.192.110
  39.152.192.73
  39.152.193.62
@@ -110490,27 +104417,23 @@
  39.152.34.229
  39.152.36.254
  39.152.37.88
+39.152.42.166
  39.152.67.245
  39.152.69.206
  39.152.7.70
  39.152.9.154
  39.152.9.3
+39.153.132.29
  39.153.135.16
  39.153.157.63
  39.153.246.234
  39.153.252.196
  39.155.134.147
-39.155.166.34
  39.155.169.2
  39.155.195.1
-39.155.212.90
-39.155.215.139
  39.155.215.182
-39.155.221.190
  39.155.244.81
  39.155.255.94
-39.156.9.132
-39.156.9.133
  39.164.112.139
  39.164.205.16
  39.164.32.145
@@ -110530,37 +104453,32 @@
  39.186.201.132
  39.186.201.147
  39.186.201.149
-39.33.120.158
  39.36.169.113
  39.36.195.178
-39.38.112.88
  39.40.45.56
  39.41.150.214
+39.41.192.60
  39.42.13.224
  39.44.183.128
  39.44.198.203
  39.45.130.238
-39.45.149.90
  39.45.160.141
  39.45.181.128
  39.45.206.7
  39.45.213.100
  39.45.55.231
-39.45.9.200
-39.46.114.246
  39.46.25.154
  39.46.30.68
  39.46.49.207
  39.46.72.200
  39.46.86.141
+39.48.65.214
  39.50.97.132
-39.57.11.60
-39.59.59.0
  39.59.88.141
  39.61.48.219
  39.61.53.67
  39.64.149.48
-39.64.200.76
+39.64.164.251
  39.64.215.93
  39.64.36.1
  39.65.102.212
@@ -110585,6 +104503,7 @@
  39.65.32.194
  39.65.42.119
  39.65.49.168
+39.65.68.117
  39.65.77.204
  39.65.92.233
  39.66.10.244
@@ -110593,12 +104512,14 @@
  39.66.178.41
  39.66.179.245
  39.66.33.156
+39.66.74.61
  39.66.85.78
  39.66.97.214
  39.66.97.215
  39.67.199.5
  39.67.226.250
  39.67.238.73
+39.67.31.134
  39.67.80.26
  39.68.11.133
  39.68.154.55
@@ -110610,7 +104531,9 @@
  39.69.1.94
  39.69.115.100
  39.69.57.186
+39.69.63.90
  39.70.133.255
+39.70.150.181
  39.70.202.131
  39.71.105.54
  39.71.122.50
@@ -110629,6 +104552,7 @@
  39.72.243.56
  39.72.72.50
  39.73.1.187
+39.73.111.160
  39.73.122.199
  39.73.123.173
  39.73.123.45
@@ -110637,34 +104561,37 @@
  39.73.128.122
  39.73.129.127
  39.73.131.121
-39.73.160.13
  39.73.160.208
+39.73.163.87
  39.73.169.24
  39.73.17.175
-39.73.175.68
  39.73.21.146
  39.73.217.43
  39.73.220.236
+39.73.236.150
  39.73.236.42
  39.73.242.182
  39.73.242.23
  39.73.243.234
+39.73.243.96
  39.73.251.50
  39.73.29.216
  39.73.46.26
  39.73.46.70
+39.73.47.132
  39.73.47.134
  39.73.61.233
  39.73.64.97
+39.73.69.172
  39.73.71.31
  39.73.90.184
  39.73.96.107
  39.74.102.84
  39.74.133.26
  39.74.135.235
+39.74.135.89
  39.74.139.172
  39.74.139.238
-39.74.139.46
  39.74.146.147
  39.74.152.139bin.sh
  39.74.153.25
@@ -110675,7 +104602,6 @@
  39.74.182.189
  39.74.189.152
  39.74.189.177
-39.74.197.52
  39.74.198.19
  39.74.198.239
  39.74.20.114
@@ -110684,8 +104610,6 @@
  39.74.238.137
  39.74.24.68
  39.74.240.204
-39.74.243.57
-39.74.248.107
  39.74.250.170
  39.74.36.15
  39.74.48.199
@@ -110718,7 +104642,6 @@
  39.78.75.59
  39.78.92.243
  39.79.104.44
-39.79.120.202
  39.79.122.48
  39.79.137.77
  39.79.145.239
@@ -110745,6 +104668,7 @@
  39.79.5.156
  39.79.65.231
  39.79.81.119
+39.79.92.119
  39.79.95.1
  39.79.95.113
  39.80.161.170
@@ -110753,17 +104677,18 @@
  39.80.191.49bin.sh
  39.80.202.13
  39.80.217.241
+39.80.34.32
  39.80.49.229
  39.80.57.255
  39.80.57.95
  39.80.62.170
  39.80.62.6
+39.80.71.48
  39.80.83.114
  39.81.139.3
  39.81.189.207
  39.81.238.18
  39.81.25.141
-39.81.26.119
  39.81.29.148
  39.81.31.145
  39.81.46.205
@@ -110773,11 +104698,11 @@
  39.82.43.247
  39.82.8.36
  39.83.112.87
-39.83.116.222
  39.83.184.117
  39.83.185.237
  39.83.186.54
  39.83.24.220
+39.83.28.34
  39.83.56.21
  39.84.120.187
  39.84.234.185
@@ -110792,11 +104717,11 @@
  39.85.197.204
  39.85.250.246
  39.85.64.200
+39.85.77.107
  39.85.82.18
  39.85.92.197
  39.85.93.132
  39.86.0.43
-39.86.119.43
  39.86.152.130
  39.86.155.107
  39.86.173.23
@@ -110815,7 +104740,6 @@
  39.86.65.130
  39.86.66.16
  39.86.66.249
-39.86.67.40
  39.86.76.213
  39.86.77.242
  39.86.82.189
@@ -110871,18 +104795,17 @@
  39.89.174.67
  39.89.181.221
  39.89.194.231
-39.89.2.121
  39.89.204.42
  39.89.211.37
  39.89.237.220
  39.89.249.184
  39.89.30.20
  39.89.30.218
+39.89.35.14
  39.89.36.241
  39.89.60.237
  39.89.62.134
  39.89.63.125
-39.89.65.175
  39.89.66.187
  39.9.190.144
  39.90.152.43
@@ -110892,26 +104815,23 @@
  39.90.235.254
  39.91.101.135
  39.96.175.55
+39.96.176.165
  39.96.202.234
  39.96.32.187
  39.96.71.218
  39.96.82.174
  39.96.84.38
-39.97.107.178
-39.97.107.254
-39.97.108.54
-39.97.109.40
+39.97.107.161
+39.97.107.42
  39.97.126.90
-39.97.179.114
  39.97.227.67
  39.97.227.7
  39.97.231.198
-39.97.241.196
  39.97.244.212
+39.98.192.41
  39.98.228.208
-39.98.245.32
-39.99.140.246
-39.99.152.86
+39.98.250.239
+39.99.171.26
  39.99.203.251
  39.99.232.25
  39.99.237.209
@@ -110949,6 +104869,7 @@
  3aggxg0gqj.com
  3alert-verify.co
  3alert.co.uk
+3alerts-billing.com
  3alerts-restrictions.com
  3alerts.2fa-support.mobi
  3alerts.link
@@ -111115,6 +105036,7 @@
  3vc6.seeanu.ru
  3verify-billing.com
  3verifyinfo.com
+3we6-jz07y5.com
  3wllsfrg0.webcindario.com
  3xportfolio.com
  3xruji.regfrodom.ru
@@ -111130,7 +105052,6 @@
  4.17.231.194
  4.17.231.196
  4.17.231.197
-4.17.231.204
  4.17.231.207
  4.17.231.208
  4.17.85.253
@@ -111154,7 +105075,6 @@
  40.113.206.182
  40.113.238.202
  40.114.104.42
-40.114.108.93
  40.114.110.198
  40.114.114.89
  40.114.116.10
@@ -111176,15 +105096,12 @@
  40.117.191.139
  40.117.192.99
  40.117.214.88
-40.117.227.31
  40.117.231.90
-40.117.250.147
  40.117.252.18
  40.117.252.39
  40.117.46.166
  40.117.75.152
  40.117.83.119
-40.117.89.111
  40.118.133.199
  40.118.168.204
  40.118.172.113
@@ -111193,15 +105110,12 @@
  40.118.236.59
  40.118.67.85
  40.120.62.167
-40.121.0.68
  40.121.12.127
-40.121.136.231
+40.121.145.56
  40.121.154.151
  40.121.163.198
  40.121.17.49
-40.121.18.230
  40.121.196.179
-40.121.22.221
  40.121.58.255
  40.121.70.33
  40.121.86.78
@@ -111218,8 +105132,8 @@
  40.122.49.211
  40.122.68.214
  40.122.70.73
+40.122.74.136
  40.123.204.131
-40.123.207.179
  40.123.208.206
  40.123.219.77
  40.123.251.49
@@ -111231,11 +105145,9 @@
  40.124.15.74
  40.124.27.223
  40.124.29.187
-40.124.46.19
  40.124.54.157
  40.125.215.96
  40.125.65.33
-40.126.224.148
  40.127.109.254
  40.127.139.82
  40.127.160.75
@@ -111247,11 +105159,8 @@
  40.66.34.81
  40.67.151.55
  40.67.192.11
-40.68.154.237
  40.68.255.214
  40.68.3.76
-40.68.77.27
-40.69.153.24
  40.69.155.91
  40.69.71.114
  40.69.91.131
@@ -111263,29 +105172,23 @@
  40.70.189.4
  40.70.203.48
  40.70.209.122
-40.70.240.229
  40.70.70.14
-40.70.74.171
  40.71.102.62
  40.71.169.235
  40.71.186.171
  40.71.205.91
-40.71.217.26
  40.71.250.6
  40.71.251.58
  40.71.36.235
  40.71.41.208
  40.71.87.18
  40.71.92.214
-40.73.0.147
-40.73.101.69
  40.73.103.7
  40.73.114.247
  40.73.120.132
  40.73.35.39
  40.73.59.55
  40.73.67.85
-40.73.73.244
  40.74.112.227
  40.74.125.113
  40.74.132.210
@@ -111295,15 +105198,14 @@
  40.74.231.153
  40.74.235.156
  40.74.249.57
-40.74.70.145
  40.74.78.199
  40.74.79.99
  40.74.80.66
  40.74.86.190
  40.74.92.77
  40.75.113.163
-40.75.83.91
  40.76.0.90
+40.76.114.230
  40.76.12.201
  40.76.201.251
  40.76.21.137
@@ -111311,7 +105213,6 @@
  40.76.229.112
  40.76.24.2
  40.76.244.210
-40.76.4.214
  40.76.44.230
  40.76.48.188
  40.76.5.111
@@ -111320,7 +105221,6 @@
  40.76.82.187
  40.76.88.174
  40.76.92.194
-40.77.103.157
  40.77.105.109
  40.77.167.0
  40.77.167.1
@@ -111394,15 +105294,12 @@
  40.77.26.187
  40.78.126.29
  40.78.19.149
-40.78.60.112
  40.78.67.135
  40.78.70.107
  40.78.83.99
-40.79.25.254
  40.79.253.153
  40.79.26.139
  40.80.147.169
-40.81.205.83
  40.82.196.210
  40.82.197.91
  40.82.204.84
@@ -111413,20 +105310,20 @@
  40.83.88.145
  40.83.89.19
  40.84.133.212
-40.84.139.238
  40.84.139.252
  40.84.148.116
  40.84.158.212
  40.84.225.234
  40.85.117.25
  40.85.121.0
+40.85.125.196
  40.85.126.196
+40.85.126.63
  40.85.162.35
  40.85.165.200
  40.85.188.123
  40.85.202.11
  40.85.205.219
-40.85.206.198
  40.85.217.120
  40.85.221.22
  40.85.252.223
@@ -111437,6 +105334,7 @@
  40.86.220.0
  40.86.223.44
  40.86.227.160
+40.86.227.89
  40.86.229.29
  40.86.252.31
  40.86.87.161
@@ -111448,17 +105346,13 @@
  40.87.54.154
  40.87.87.198
  40.87.96.228
-40.88.133.81
-40.88.141.108
  40.88.148.192
-40.88.34.58
  40.89.137.145
-40.89.137.181
-40.89.143.10
  40.89.150.85
  40.89.155.133
  40.89.159.38
  40.89.164.252
+40.90.211.189
  40.90.238.52
  40.91.234.240
  4000095599.com
@@ -111494,8 +105388,6 @@
  41.110.65.59
  41.111.123.99
  41.111.131.149
-41.111.135.196
-41.111.135.199
  41.128.168.39
  41.128.181.181
  41.129.132.116
@@ -111509,22 +105401,20 @@
  41.139.223.242
  41.139.9.47
  41.140.173.233
-41.140.205.86
+41.140.18.10
  41.140.253.4
  41.140.31.106
+41.141.100.42
  41.141.220.3
  41.141.250.3
  41.142.248.91
  41.142.252.63
-41.142.42.75
  41.143.149.21
  41.143.249.57
  41.143.249.60
  41.143.250.78
  41.143.252.170
  41.143.254.58
-41.144.147.247
-41.146.21.5
  41.151.26.23
  41.153.20.124
  41.155.239.202
@@ -111532,7 +105422,7 @@
  41.155.239.220
  41.155.241.27
  41.155.246.26
-41.157.45.114
+41.157.220.199
  41.157.80.183
  41.160.100.202
  41.160.100.204
@@ -111555,8 +105445,6 @@
  41.164.24.243
  41.164.247.186
  41.165.18.30
-41.165.88.132
-41.168.8.197
  41.169.123.37
  41.169.130.26
  41.169.139.2
@@ -111569,11 +105457,8 @@
  41.169.78.42
  41.169.79.166
  41.170.12.92
-41.170.14.90
-41.170.84.122
  41.175.22.228
  41.175.252.38
-41.175.79.118
  41.176.252.59
  41.180.4.117
  41.180.64.254
@@ -111587,27 +105472,21 @@
  41.182.128.117
  41.182.132.130
  41.182.135.202
-41.182.147.39
-41.182.148.61
  41.182.151.121
  41.182.151.177
  41.182.52.10
  41.185.28.84
  41.185.29.128
-41.185.73.242
  41.185.8.170
  41.188.124.50
-41.188.169.250
  41.188.46.17
  41.188.5.110
  41.189.206.5
  41.189.211.130
-41.189.211.154
  41.190.136.202
  41.190.137.126
  41.190.141.110
  41.190.147.158
-41.190.153.35
  41.190.226.190
  41.190.232.139
  41.190.232.36
@@ -111630,45 +105509,35 @@
  41.193.55.190
  41.193.86.73
  41.194.37.106
-41.202.80.50
-41.203.156.254
-41.204.8.16
+41.200.24.96
  41.204.84.182
  41.204.93.114
  41.204.93.22
  41.205.13.126
-41.205.59.241
  41.205.83.6
  41.206.11.44
  41.206.35.222
  41.206.48.90
  41.207.138.10
-41.207.184.182
  41.207.251.194
  41.208.150.114
-41.208.150.118
  41.208.161.203
-41.208.68.4
  41.208.68.48
  41.208.70.39
  41.208.71.226
-41.208.72.141
  41.21.233.230
  41.210.140.35
-41.210.16.133
+41.210.16.95
  41.210.161.114
  41.211.122.81
  41.212.121.138
-41.212.126.128
  41.212.26.163
-41.212.75.111
-41.213.124.182
+41.212.41.34
  41.213.13.146
  41.213.13.154
  41.213.138.16
  41.213.158.225
  41.214.185.29
-41.214.20.60
  41.215.10.6
  41.215.118.218
  41.215.128.91
@@ -111688,15 +105557,12 @@
  41.215.79.182
  41.215.81.26
  41.215.95.113
-41.216.102.178
  41.216.148.55
  41.216.173.222
  41.216.177.120
  41.216.178.171
  41.216.178.30
-41.216.178.71
-41.216.186.89
-41.217.148.5
+41.216.227.82
  41.217.204.220
  41.217.216.17
  41.217.216.45
@@ -111705,16 +105571,13 @@
  41.217.219.165
  41.217.219.49
  41.217.219.53
-41.217.59.37
-41.217.65.246
  41.218.116.38
  41.218.117.46
-41.218.118.154
+41.218.192.124
  41.218.193.162
  41.218.196.149
  41.218.198.83
-41.218.202.156
-41.218.206.130
+41.218.212.127
  41.218.225.173
  41.218.253.127
  41.219.186.194
@@ -111731,10 +105594,8 @@
  41.221.238.5
  41.221.245.50
  41.221.251.19
-41.221.30.185
  41.221.53.30
  41.221.81.14
-41.221.86.21
  41.222.0.194
  41.222.15.74
  41.222.172.57
@@ -111752,12 +105613,8 @@
  41.224.247.126
  41.224.57.98
  41.224.59.242
-41.224.59.78
-41.225.16.156
  41.225.186.80
  41.225.99.33
-41.226.11.252
-41.226.14.36
  41.226.162.74
  41.226.176.221
  41.226.18.215
@@ -111774,6 +105631,7 @@
  41.230.12.180
  41.230.14.133
  41.230.14.134
+41.230.147.252
  41.230.17.220
  41.230.218.190
  41.230.230.113
@@ -111788,13 +105646,12 @@
  41.231.5.206
  41.231.5.36
  41.231.53.25
-41.231.54.123
  41.231.87.69
-41.235.239.119
+41.233.129.125
  41.237.164.12
+41.237.228.137
  41.238.200.222
  41.238.47.117
-41.239.53.30
  41.242.103.16
  41.242.117.242
  41.242.136.2
@@ -111810,13 +105667,11 @@
  41.242.96.5
  41.242.96.8
  41.243.13.70
-41.244.234.127
  41.248.133.186
  41.248.62.160
  41.249.212.74
  41.249.250.209
  41.250.160.92
-41.250.173.187
  41.250.86.70
  41.250.96.149
  41.251.106.8
@@ -111824,7 +105679,6 @@
  41.251.248.90
  41.251.252.222
  41.251.254.98
-41.253.60.91
  41.254.41.230
  41.254.44.241
  41.254.44.62
@@ -111849,8 +105703,8 @@
  41.32.217.62
  41.32.23.127
  41.32.237.228
+41.32.246.17
  41.32.42.5
-41.32.43.162
  41.32.52.102
  41.32.52.109
  41.32.58.147
@@ -111862,6 +105716,7 @@
  41.33.205.132
  41.33.210.78
  41.33.212.68
+41.33.229.210
  41.33.240.117
  41.33.27.139
  41.33.45.180
@@ -111869,8 +105724,9 @@
  41.33.66.226
  41.33.66.228
  41.33.66.230
-41.34.111.248
  41.34.229.222
+41.36.34.7
+41.36.41.97
  41.38.109.108
  41.38.128.22
  41.38.144.114
@@ -111883,7 +105739,6 @@
  41.38.19.147
  41.38.190.22
  41.38.195.30
-41.38.203.171
  41.38.249.35
  41.38.250.18
  41.38.26.106
@@ -111895,7 +105750,6 @@
  41.39.157.150
  41.39.159.15
  41.39.159.99
-41.39.167.25
  41.39.171.206
  41.39.181.152
  41.39.183.27
@@ -111918,7 +105772,6 @@
  41.41.221.164
  41.41.225.78
  41.41.239.190
-41.41.245.202
  41.41.245.87
  41.41.37.219
  41.41.50.52
@@ -111926,8 +105779,9 @@
  41.41.70.190
  41.41.77.196
  41.43.140.210
-41.44.137.44
+41.46.49.173
  41.57.109.74
+41.57.42.174
  41.59.199.78
  41.59.200.33
  41.59.202.12
@@ -111938,26 +105792,17 @@
  41.60.216.153
  41.60.218.10
  41.60.220.84
+41.60.233.116
  41.60.236.145
  41.60.238.148
-41.60.64.35
-41.63.0.133
  41.63.0.41
-41.63.1.44
-41.63.1.45
-41.63.1.46
  41.63.10.12
  41.63.10.5
  41.63.165.143
  41.64.18.117
  41.65.111.226
  41.65.146.38
-41.65.163.66
-41.65.174.66
-41.65.174.74
-41.65.174.79
  41.65.174.85
-41.65.174.91
  41.65.218.72
  41.65.68.70
  41.66.227.41
@@ -111970,11 +105815,11 @@
  41.68.41.246
  41.71.119.195
  41.71.24.136
+41.71.24.148
  41.71.24.150
  41.71.24.165
  41.72.203.182
  41.72.203.66
-41.72.219.102
  41.72.61.50
  41.72.61.67
  41.72.99.144
@@ -111982,7 +105827,6 @@
  41.73.15.130
  41.73.15.134
  41.73.15.246
-41.73.213.148
  41.73.213.186
  41.74.4.166
  41.75.110.37
@@ -111990,9 +105834,11 @@
  41.75.111.50
  41.75.113.217
  41.75.123.21
+41.75.123.33
  41.75.123.37
  41.75.123.49
  41.75.123.8
+41.75.123.82
  41.75.126.50
  41.75.92.98
  41.75.93.254
@@ -112000,9 +105846,7 @@
  41.76.156.90
  41.76.157.202
  41.76.157.46
-41.76.169.43
  41.76.169.8
-41.76.212.104
  41.76.213.144
  41.76.242.186
  41.76.244.185
@@ -112011,26 +105855,25 @@
  41.76.248.17
  41.76.251.205
  41.76.42.75
-41.76.8.16
  41.77.100.129
  41.77.136.114
  41.77.137.114
-41.77.146.98
+41.77.158.4
  41.77.186.32
  41.77.245.240
  41.78.103.8
+41.78.117.86
  41.78.118.2
  41.78.172.77
  41.78.224.47
  41.78.245.41
  41.78.247.252
  41.78.26.155
-41.78.75.45
  41.78.82.180
-41.78.87.244
  41.79.151.175
  41.79.16.154
  41.79.170.125
+41.79.170.241
  41.79.170.73
  41.79.170.88
  41.79.171.32
@@ -112039,7 +105882,6 @@
  41.79.49.23
  41.79.64.106
  41.79.64.110
-41.79.65.27
  41.79.66.106
  41.79.78.59
  41.79.82.46
@@ -112053,6 +105895,7 @@
  41.83.134.235
  41.83.79.229
  41.84.159.206
+41.85.167.30
  41.85.189.66
  41.85.191.6
  41.86.153.187
@@ -112063,7 +105906,6 @@
  41.86.18.149
  41.86.18.150
  41.86.18.152
-41.86.18.153
  41.86.18.154
  41.86.18.174
  41.86.18.20
@@ -112076,8 +105918,7 @@
  41.86.19.200
  41.86.19.205
  41.86.19.206
-41.86.21.22
-41.86.21.23
+41.86.21.27
  41.86.21.44
  41.86.21.59
  41.86.21.62
@@ -112085,19 +105926,14 @@
  41.86.34.45
  41.86.48.178
  41.86.5.103
-41.86.5.142
-41.86.5.164
  41.86.5.197
  41.86.5.205
  41.86.56.224
-41.87.14.91
  41.87.29.130
  41.87.7.22
-41.89.162.197
  41.89.162.8
  41.89.171.220
  41.89.196.26
-41.89.198.239
  41.89.211.5
  41.89.94.30
  41.90.105.202
@@ -112106,14 +105942,13 @@
  41.92.133.214
  41.92.9.175
  41.93.155.17
-41.93.32.122
  41.93.45.139
  41.93.82.7
  41.94.22.3
  41.94.22.6
  41.94.47.41
  41.96.71.92
-41.97.51.56
+41.97.92.122
  41.98.84.239
  4117570-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  413bd12fe0.nxcli.net
@@ -112125,9 +105960,6 @@
  41fde.codesandbox.io
  41r73tlc.gmz.cc
  42.0.109.208
-42.0.4.243
-42.101.43.186
-42.101.50.119
  42.101.66.55
  42.101.89.131
  42.104.109.194
@@ -112148,10 +105980,8 @@
  42.112.221.44
  42.112.234.99
  42.112.238.30
-42.112.243.200
  42.112.26.24
  42.112.26.30
-42.112.27.170
  42.112.36.20
  42.112.37.242
  42.112.50.218
@@ -112162,18 +105992,18 @@
  42.112.94.2
  42.112.95.193
  42.112.95.40
-42.112.95.82
  42.112.97.180
+42.113.0.108
  42.113.0.250
  42.113.1.39
  42.113.101.21
-42.113.103.157
  42.113.105.162
  42.113.112.81
  42.113.130.228
  42.113.135.248
  42.113.137.15
  42.113.143.23
+42.113.144.193
  42.113.144.216
  42.113.151.232
  42.113.151.40
@@ -112187,14 +106017,12 @@
  42.113.200.56
  42.113.204.43
  42.113.205.141
-42.113.205.2
  42.113.216.199
  42.113.216.216
  42.113.216.245
  42.113.218.154
  42.113.218.198
  42.113.218.255
-42.113.221.137
  42.113.225.71
  42.113.229.100
  42.113.229.143
@@ -112218,7 +106046,6 @@
  42.113.235.113
  42.113.236.193
  42.113.236.54
-42.113.238.203
  42.113.239.94
  42.113.241.157
  42.113.246.226
@@ -112252,9 +106079,9 @@
  42.114.23.54
  42.114.249.29
  42.114.250.208
-42.114.34.244
  42.114.52.174
  42.114.56.33
+42.114.56.90
  42.114.68.126
  42.114.68.251
  42.114.73.103
@@ -112293,10 +106120,12 @@
  42.116.43.112
  42.116.82.250
  42.117.13.143
+42.117.133.249
  42.117.15.72
  42.117.152.105
  42.117.154.105
  42.117.174.168
+42.117.176.151
  42.117.186.91
  42.117.20.102
  42.117.20.103
@@ -112397,6 +106226,7 @@
  42.118.123.166
  42.118.123.236
  42.118.126.158
+42.118.131.150
  42.118.139.13
  42.118.139.238
  42.118.139.76
@@ -112412,6 +106242,7 @@
  42.118.196.99
  42.118.202.80
  42.118.205.192
+42.118.206.64
  42.118.214.206
  42.118.214.38
  42.118.219.234
@@ -112430,7 +106261,6 @@
  42.118.5.75
  42.118.62.185
  42.118.70.139
-42.118.70.149
  42.118.71.140
  42.118.71.180
  42.118.71.6
@@ -112440,7 +106270,6 @@
  42.119.112.109
  42.119.148.54
  42.119.148.83
-42.119.149.98
  42.119.150.246
  42.119.151.237
  42.119.152.30
@@ -112466,6 +106295,7 @@
  42.119.200.38
  42.119.204.130
  42.119.204.161
+42.119.218.224
  42.119.228.247
  42.119.229.171
  42.119.229.228
@@ -112495,22 +106325,16 @@
  42.119.97.19
  42.119.98.171
  42.122.49.41
-42.122.50.166
  42.122.50.61
  42.122.51.114
-42.123.126.188
  42.123.99.67
-42.125.249.195
  42.127.215.6
  42.127.80.212
  42.157.192.132
-42.157.193.153
  42.157.195.226
  42.157.6.204
  42.157.6.208
  42.159.10.142
-42.159.104.37
-42.159.121.246
  42.159.142.14
  42.159.147.118
  42.159.155.8
@@ -112521,6 +106345,8 @@
  42.159.86.108
  42.176.142.200
  42.176.154.174
+42.176.18.199
+42.176.219.48
  42.176.233.184
  42.176.234.243
  42.176.245.115
@@ -112542,14 +106368,12 @@
  42.177.235.102
  42.177.239.17
  42.177.33.129
-42.178.115.234
  42.178.168.184
  42.178.193.79
  42.178.205.97
  42.178.213.57
  42.178.220.99
  42.178.232.206
-42.178.252.79
  42.178.55.125
  42.179.143.214
  42.179.164.35
@@ -112557,12 +106381,10 @@
  42.179.176.243
  42.179.186.224
  42.179.201.9
-42.179.211.101
  42.179.239.219
  42.179.242.246
  42.179.248.60
  42.179.249.225
-42.179.254.75
  42.179.36.245
  42.179.62.188
  42.179.63.25
@@ -112580,12 +106402,12 @@
  42.180.49.4
  42.187.121.88
  42.188.201.82
+42.188.58.38
  42.189.128.125
  42.189.147.51
  42.189.216.19
  42.190.145.193
  42.190.155.123
-42.191.12.114
  42.191.141.62
  42.191.154.65
  42.191.159.116
@@ -112621,9 +106443,9 @@
  42.192.55.98
  42.192.7.200
  42.192.85.120
+42.192.95.184
  42.193.0.34
  42.194.128.158
-42.194.133.28
  42.194.135.105
  42.194.137.87
  42.194.138.78
@@ -112644,8 +106466,6 @@
  42.194.182.82
  42.194.184.92
  42.194.185.24
-42.194.186.136
-42.194.187.114
  42.194.187.94
  42.194.193.50
  42.194.198.187
@@ -112674,6 +106494,7 @@
  42.2.149.127
  42.2.152.231
  42.2.167.10
+42.2.172.93
  42.2.173.75
  42.2.175.52
  42.2.179.183
@@ -112688,7 +106509,6 @@
  42.200.118.211
  42.200.135.228
  42.200.142.209
-42.200.142.45
  42.200.143.145
  42.200.150.157
  42.200.153.190
@@ -112699,11 +106519,11 @@
  42.200.198.230
  42.200.200.146
  42.200.206.225
-42.200.206.52
  42.200.211.79
  42.200.226.58
  42.200.238.74
  42.200.243.208
+42.200.247.251
  42.200.35.174
  42.200.35.239
  42.200.64.182
@@ -112716,127 +106536,126 @@
  42.200.96.63
  42.201.228.210
  42.201.253.195
+42.224.0.199
  42.224.0.25
  42.224.1.37
-42.224.117.45
-42.224.120.27
  42.224.122.152
  42.224.123.136
-42.224.126.32
-42.224.127.145
-42.224.128.208
+42.224.127.116
  42.224.136.181
  42.224.137.155
-42.224.140.147
-42.224.140.168
+42.224.137.185
+42.224.138.197
+42.224.139.48
  42.224.141.189
  42.224.141.218
-42.224.143.117
-42.224.169.158
-42.224.17.130
-42.224.170.200
+42.224.142.36
+42.224.143.170
  42.224.171.80
-42.224.174.234
+42.224.173.138
+42.224.173.202
+42.224.176.191
  42.224.176.77
  42.224.177.237
  42.224.177.243
  42.224.178.204
  42.224.178.222
-42.224.179.54
-42.224.180.113
+42.224.18.209
  42.224.180.248
-42.224.181.52
+42.224.183.168
  42.224.2.14
  42.224.2.194
  42.224.20.216
-42.224.209.65
+42.224.208.2
+42.224.209.52
  42.224.210.141
+42.224.211.55
  42.224.212.200
-42.224.213.247
  42.224.213.42
-42.224.215.245
  42.224.215.69
  42.224.221.134
-42.224.222.206
+42.224.236.111
  42.224.236.68
  42.224.237.81
-42.224.24.76
  42.224.242.180
-42.224.244.49
-42.224.246.58
-42.224.249.178
+42.224.25.155
+42.224.250.76
+42.224.251.156
  42.224.252.64
-42.224.253.242
-42.224.26.211
-42.224.29.41
-42.224.30.31
-42.224.39.11
  42.224.41.90
+42.224.42.146
+42.224.43.145
  42.224.43.171
-42.224.49.66
-42.224.50.93
-42.224.55.231
-42.224.56.82
+42.224.50.18
+42.224.55.117
  42.224.57.26
+42.224.58.162
  42.224.6.248
  42.224.66.108
  42.224.67.29
-42.224.67.82
-42.224.68.67
+42.224.69.111
  42.224.69.205
  42.224.7.207
  42.224.70.21
-42.224.70.236
  42.224.71.252
  42.224.71.61
  42.224.73.115
  42.224.73.14
+42.224.73.179
  42.224.74.125
-42.224.74.190
  42.224.74.26
+42.224.75.166
+42.224.75.9
  42.224.76.236
  42.224.77.242
+42.224.77.95
  42.224.78.102
+42.224.79.26
  42.224.8.11
-42.224.82.19
+42.224.93.39
+42.224.95.62
  42.224.98.101
-42.225.18.163
+42.224.99.226
+42.225.200.211
+42.225.200.26
  42.225.203.166
  42.225.204.17
-42.225.205.169
-42.225.205.20
+42.225.205.212
  42.225.205.232
  42.225.207.118
  42.225.211.236
-42.225.211.77
  42.225.215.149
+42.225.22.50
+42.225.228.52
  42.225.23.49
-42.225.232.240
+42.225.240.191
  42.225.246.190
+42.225.246.78
  42.225.31.50
+42.225.39.205
+42.226.65.136
  42.226.67.235
-42.226.69.233
+42.226.76.63
  42.226.78.70
+42.226.83.181
  42.226.83.98
  42.226.90.170
  42.227.116.20
  42.227.121.217
-42.227.144.212
-42.227.153.2
-42.227.158.219
+42.227.165.12
  42.227.166.244
  42.227.166.69
  42.227.172.211
  42.227.172.232
+42.227.174.181
  42.227.184.249
  42.227.184.46
-42.227.184.66
+42.227.185.18
  42.227.196.128
-42.227.197.204
+42.227.197.111
  42.227.197.5
-42.227.21.22
-42.227.213.132
-42.227.240.74
+42.227.204.215
+42.227.224.217
  42.227.244.85
  42.227.245.255
  42.227.246.245
@@ -112847,45 +106666,46 @@
  42.227.44.164
  42.227.57.194
  42.227.57.47
-42.227.59.55
+42.228.122.103
  42.228.124.84
  42.228.126.50
  42.228.164.22
  42.228.164.23
+42.228.193.58
  42.228.2.150
-42.228.220.3
+42.228.216.143
  42.228.237.138
-42.228.33.213
-42.228.35.247
-42.228.36.47
-42.228.36.48
+42.228.32.51
  42.228.36.7
  42.228.38.179
  42.228.38.195
  42.228.38.50
-42.228.38.51
  42.228.39.12
-42.228.39.126
+42.228.39.235
+42.228.39.66
  42.228.4.35
  42.228.42.58
-42.228.43.118
-42.228.43.130
  42.228.43.26
-42.228.44.114
-42.228.45.251
-42.228.45.8
  42.228.46.106
+42.228.46.129
+42.228.46.248
  42.228.47.169
+42.228.47.3
  42.228.54.98
-42.228.60.114
+42.228.59.226
+42.228.66.148
  42.228.68.132
  42.228.68.254
  42.228.68.74
-42.228.69.232
+42.228.69.116
+42.228.70.55
  42.228.71.44
-42.228.78.17
+42.228.72.143
+42.228.74.63
+42.228.75.143
+42.228.79.112
  42.228.79.15
-42.228.79.250
+42.228.79.40
  42.228.79.60
  42.228.80.137
  42.228.81.115
@@ -112895,76 +106715,72 @@
  42.228.93.179
  42.228.94.145
  42.228.94.93
-42.229.153.195
  42.229.160.145
-42.229.172.199
-42.229.247.138
-42.230.0.144
  42.230.102.140
  42.230.103.149
-42.230.103.184
-42.230.11.204
-42.230.121.150
-42.230.122.42
+42.230.103.47
+42.230.121.178
  42.230.123.74
  42.230.125.151
-42.230.125.240
  42.230.126.238
-42.230.127.57
+42.230.133.128
  42.230.144.111
-42.230.147.60
-42.230.149.197
  42.230.152.90
-42.230.16.78
-42.230.169.117
  42.230.170.56
-42.230.172.94
  42.230.176.61
-42.230.178.35
+42.230.177.194
  42.230.179.161
-42.230.188.101
-42.230.194.109
-42.230.224.201
-42.230.244.42
-42.230.247.18
+42.230.179.192
+42.230.185.51
+42.230.191.83
+42.230.217.232
+42.230.219.157
+42.230.228.195
+42.230.230.251
  42.230.27.134
-42.230.33.122
+42.230.37.112
  42.230.37.194
  42.230.38.96
  42.230.43.23
+42.230.43.30
  42.230.49.132
-42.230.50.171
+42.230.5.249
  42.230.50.192
  42.230.51.210
+42.230.60.23
  42.230.61.80
+42.230.62.196
  42.230.62.207
  42.230.7.155
-42.230.7.99
  42.230.70.211
  42.230.70.223
-42.230.70.45
-42.230.85.174
+42.230.80.206
+42.230.89.71
  42.230.91.130
  42.230.91.21
+42.230.95.82
+42.230.97.0
  42.230.97.74
+42.230.98.115
  42.230.99.159
-42.231.104.39
+42.231.107.171
  42.231.111.173
  42.231.121.10
+42.231.126.231
+42.231.128.122
+42.231.128.229
+42.231.159.19
  42.231.159.56
  42.231.161.220
  42.231.174.94
-42.231.189.123
-42.231.208.236
-42.231.217.68
-42.231.222.29
+42.231.238.57
  42.231.244.187
-42.231.254.182
  42.231.41.51
  42.231.42.217
  42.231.51.23
  42.231.74.96
-42.231.91.170
+42.231.75.106
+42.231.87.111
  42.232.100.48
  42.232.101.226
  42.232.103.116
@@ -112972,10 +106788,11 @@
  42.232.114.186
  42.232.115.208
  42.232.117.8
+42.232.118.198
  42.232.169.158
  42.232.169.5
-42.232.170.155
-42.232.170.72
+42.232.171.107
+42.232.18.154
  42.232.188.62
  42.232.198.40
  42.232.200.185
@@ -112983,41 +106800,35 @@
  42.232.225.124
  42.232.226.108
  42.232.229.25
-42.232.232.214
+42.232.230.222
  42.232.233.5
-42.232.237.218
+42.232.234.21
  42.232.239.137
  42.232.40.39
  42.232.45.68
-42.232.56.128
  42.232.56.78
  42.232.72.205
+42.232.76.26
  42.232.80.133
-42.232.81.188
-42.233.122.64
  42.233.125.82
-42.233.126.109
  42.233.142.83
-42.233.150.59
+42.233.147.35
  42.233.219.67
  42.233.220.180
  42.233.222.143
  42.233.227.7
  42.233.232.93
-42.233.250.60
-42.233.251.149
  42.233.254.41
  42.233.32.16
+42.233.88.177
  42.233.89.247
-42.234.105.199
-42.234.128.18
-42.234.155.21
-42.234.176.51
+42.233.98.98
+42.234.166.241
  42.234.186.167
  42.234.219.75
-42.234.232.115
-42.234.233.248
-42.234.234.105
+42.234.234.245
+42.234.235.38
+42.234.236.114
  42.234.236.206
  42.234.238.31
  42.234.240.23
@@ -113026,73 +106837,69 @@
  42.234.241.145
  42.234.241.160
  42.234.242.117
-42.234.243.195
  42.234.248.148
-42.234.248.27
+42.234.248.171
+42.234.249.174
  42.234.249.87
+42.234.251.110
  42.234.251.126
-42.234.251.24
-42.234.253.50
+42.234.252.12
+42.234.254.42
  42.234.84.85
  42.234.86.215
-42.235.103.158
+42.235.102.51
  42.235.103.175
-42.235.113.129
-42.235.126.54
+42.235.111.101
+42.235.126.228
  42.235.14.225
-42.235.152.253
-42.235.153.113
+42.235.141.166
  42.235.156.137
-42.235.156.187
+42.235.156.251
+42.235.156.29
+42.235.157.117
  42.235.158.31
-42.235.158.70
-42.235.161.20
+42.235.163.42
  42.235.165.179
  42.235.166.201
  42.235.169.175
-42.235.169.63
+42.235.169.202
+42.235.170.128
+42.235.173.196
  42.235.173.233
-42.235.179.160
-42.235.180.83
-42.235.180.90
-42.235.181.59
-42.235.182.51
+42.235.181.49
  42.235.184.115
-42.235.184.146
  42.235.184.15
  42.235.184.2
-42.235.186.32
-42.235.187.79
-42.235.190.160
+42.235.186.72
+42.235.189.100
+42.235.189.210
+42.235.189.47
  42.235.2.53
  42.235.20.211
-42.235.43.70
+42.235.28.29
+42.235.56.87
  42.235.57.48
  42.235.59.66
  42.235.64.62
-42.235.66.121
+42.235.65.90
  42.235.66.159
-42.235.66.222
-42.235.68.20
+42.235.67.199
  42.235.70.61
-42.235.70.91
-42.235.82.43
-42.235.84.97
-42.235.86.249
+42.235.8.159
+42.235.81.7
+42.235.83.45
  42.235.88.178
  42.235.88.20
  42.235.89.209
-42.235.91.214
-42.235.92.124
-42.235.93.89
+42.235.91.145
+42.235.91.66
  42.235.93.98
  42.235.94.187
  42.235.94.71
  42.235.96.83
  42.235.99.102
-42.236.139.201
+42.236.136.29
  42.236.140.22
-42.236.144.161
  42.236.148.237
  42.236.151.48
  42.236.151.8
@@ -113101,6 +106908,8 @@
  42.236.161.183
  42.236.161.43
  42.236.163.85
+42.236.212.147
+42.236.212.155
  42.236.212.234
  42.236.212.239
  42.236.212.94
@@ -113113,45 +106922,33 @@
  42.236.215.249
  42.236.220.118
  42.236.221.189
-42.236.221.99
  42.236.222.135
-42.236.222.185
+42.236.222.191
  42.236.222.199
-42.236.223.2
  42.236.223.79
  42.236.252.128
  42.236.253.196
-42.236.253.46
  42.236.254.201
  42.236.254.70
  42.236.255.226
  42.236.68.56
-42.236.73.90
  42.236.74.70
-42.237.108.223
+42.237.110.234
  42.237.112.52
  42.237.114.101
  42.237.114.126
-42.237.126.115
  42.237.18.141
  42.237.196.213
  42.237.197.58
  42.237.40.112
-42.237.40.81
-42.237.46.61
-42.237.6.53
-42.237.84.185
+42.237.53.108
  42.237.90.156
  42.238.101.152
-42.238.146.186
-42.238.168.248
-42.238.181.89
+42.238.188.100
+42.238.206.205
  42.238.225.127
-42.238.230.104
  42.238.231.157
  42.238.235.73
-42.238.238.136
-42.238.238.251
  42.238.241.114
  42.238.244.92
  42.238.246.0
@@ -113159,43 +106956,41 @@
  42.238.251.182
  42.238.5.149
  42.238.51.98
-42.239.125.132
+42.239.10.192
  42.239.145.30
  42.239.148.32
  42.239.150.235
-42.239.155.57
  42.239.163.85
  42.239.181.224
  42.239.193.119
-42.239.229.232
-42.239.231.113
+42.239.230.116
+42.239.230.124
+42.239.230.222
  42.239.233.77
  42.239.236.90
  42.239.237.10
+42.239.237.31
  42.239.237.79
  42.239.239.21
  42.239.239.25
  42.239.239.71
-42.239.244.124
-42.239.244.225
+42.239.240.163
  42.239.246.63
-42.239.248.122
+42.239.248.242
  42.239.249.74
+42.239.252.237
  42.239.253.10
  42.239.253.113
  42.239.253.2
-42.239.253.229
+42.239.253.224
  42.239.253.92
-42.239.29.19
-42.239.29.249
-42.239.72.193
-42.239.8.159
+42.239.76.207
  42.240.129.58
  42.242.141.80
  42.242.231.12
  42.242.231.248
-42.242.240.183
  42.242.243.114
+42.242.98.1
  42.243.111.90
  42.243.162.63
  42.243.35.234
@@ -113246,6 +107041,7 @@
  42.3.53.184
  42.3.87.176
  42.3.97.69
+42.3.98.11
  42.3.98.85
  42.4.113.47
  42.4.14.106
@@ -113273,6 +107069,7 @@
  42.5.207.1
  42.5.208.88
  42.5.214.244
+42.5.215.42
  42.5.215.8
  42.5.234.33
  42.5.79.19
@@ -113284,8 +107081,6 @@
  42.51.202.167
  42.51.225.175
  42.51.26.79
-42.51.28.203
-42.51.33.40
  42.51.34.169
  42.51.46.140
  42.51.60.220
@@ -113301,8 +107096,8 @@
  42.52.96.21
  42.53.119.173
  42.53.144.95
-42.53.156.215
  42.53.161.28
+42.53.214.48
  42.53.27.137
  42.53.36.143
  42.53.48.2
@@ -113311,9 +107106,9 @@
  42.54.168.55
  42.54.205.51
  42.54.205.67
-42.54.85.131
  42.54.86.197
  42.54.92.115
+42.55.134.167
  42.55.144.11
  42.55.17.119
  42.55.179.159
@@ -113331,6 +107126,7 @@
  42.57.118.152
  42.57.147.194
  42.57.15.215
+42.57.174.38
  42.57.190.39
  42.57.9.146
  42.57.9.190
@@ -113338,6 +107134,7 @@
  42.57.9.28
  42.57.91.201
  42.58.122.107
+42.58.151.244
  42.58.177.65
  42.58.210.57
  42.58.223.74
@@ -113361,6 +107158,7 @@
  42.6.133.134
  42.6.134.205
  42.6.139.16
+42.6.215.190
  42.6.226.87
  42.6.227.226
  42.6.24.243
@@ -113377,13 +107175,11 @@
  42.61.190.66
  42.61.218.66
  42.61.221.203
-42.61.234.251
  42.61.253.232
  42.61.64.70
  42.61.99.155
  42.62.107.209
  42.62.114.231
-42.62.114.98
  42.62.26.115
  42.62.31.51
  42.62.96.34
@@ -113391,12 +107187,14 @@
  42.63.199.141
  42.63.244.87
  42.63.9.198
+42.7.121.84
  42.7.14.208
  42.7.14.8
  42.7.149.251
  42.7.15.129
  42.7.15.201
  42.7.15.214
+42.7.15.93
  42.7.16.112
  42.7.18.253
  42.7.187.100
@@ -113406,8 +107204,6 @@
  42.7.97.102
  42.81.0.42
  42.81.123.232
-42.81.160.213
-42.82.179.128
  42.82.217.241
  42.82.224.71
  42.82.224.72
@@ -113417,13 +107213,12 @@
  42.82.237.142
  42.82.237.144
  42.82.239.15
-42.84.162.196
  42.84.194.61
  42.84.197.24
  42.84.198.14
  42.84.218.16
  42.84.32.149
-42.84.36.42
+42.84.32.53
  42.85.145.231
  42.85.163.138
  42.85.52.140
@@ -113431,7 +107226,6 @@
  42.86.125.191
  42.86.145.56
  42.86.147.160
-42.86.148.34
  42.86.150.245
  42.86.153.75
  42.86.17.90
@@ -113442,7 +107236,7 @@
  42.87.12.215
  42.87.248.11
  42.87.76.172
-42.98.114.213
+42.87.8.51
  42.98.123.67
  42.98.153.245
  42.98.208.127
@@ -113450,6 +107244,7 @@
  42.98.251.126
  42.98.254.246
  42.98.7.35
+42.98.71.10
  42.98.8.73
  42.99.116.139
  42.99.180.135
@@ -113476,6 +107271,7 @@
  43.224.128.110
  43.224.130.146
  43.224.180.195
+43.224.181.119
  43.224.234.88
  43.224.248.159
  43.224.248.183
@@ -113485,11 +107281,11 @@
  43.224.249.53
  43.224.8.116
  43.224.8.124
+43.224.8.125
  43.224.8.14
-43.225.112.152
+43.225.100.3
  43.225.151.142
  43.225.151.198
-43.225.151.253
  43.225.157.152
  43.225.158.69
  43.225.161.91
@@ -113500,6 +107296,7 @@
  43.225.187.210
  43.225.192.225
  43.225.192.241
+43.225.194.121
  43.225.195.89
  43.225.195.90
  43.225.21.193
@@ -113509,63 +107306,46 @@
  43.225.62.107
  43.225.67.122
  43.225.67.181
-43.225.67.35
  43.226.144.14
  43.226.144.179
  43.226.144.63
  43.226.144.80
  43.226.145.122
-43.226.145.94
-43.226.146.239
+43.226.146.180
  43.226.146.76
  43.226.147.122
  43.226.147.142
  43.226.147.229
-43.226.147.239
  43.226.147.62
-43.226.148.154
  43.226.148.205
  43.226.148.223
-43.226.148.239
  43.226.148.62
-43.226.148.66
  43.226.148.89
-43.226.149.141
  43.226.149.198
-43.226.149.234
  43.226.150.134
  43.226.150.164
  43.226.150.26
  43.226.152.17
  43.226.153.14
-43.226.153.29
-43.226.156.173
-43.226.156.254
-43.226.156.93
  43.226.16.20
  43.226.22.90
  43.226.236.222
  43.226.238.12
  43.226.239.126
  43.226.26.159
-43.226.41.171
  43.226.49.211
  43.226.51.193
  43.226.67.124
  43.226.69.103
  43.226.69.200
-43.226.69.248
  43.226.73.26
  43.227.113.81
  43.227.128.6
  43.227.135.214
  43.227.217.50
-43.227.23.76
  43.227.56.11
-43.227.67.215
  43.227.68.122
  43.228.117.242
-43.228.125.7
  43.228.126.114
  43.228.131.115
  43.228.222.114
@@ -113573,7 +107353,6 @@
  43.228.38.174
  43.228.70.27
  43.228.70.36
-43.228.79.91
  43.228.84.23
  43.229.11.20
  43.229.11.80
@@ -113581,7 +107360,6 @@
  43.229.151.135
  43.229.152.88
  43.229.153.13
-43.229.153.76
  43.229.207.116
  43.229.207.206
  43.229.225.236
@@ -113589,13 +107367,14 @@
  43.229.252.157
  43.229.252.226
  43.229.252.99
-43.229.27.161
  43.229.54.48
  43.229.55.61
  43.229.62.133
  43.229.62.95
  43.229.72.220
  43.229.73.229
+43.229.73.233
+43.229.73.238
  43.229.73.239
  43.229.73.251
  43.230.168.149
@@ -113606,12 +107385,10 @@
  43.230.89.50
  43.230.89.54
  43.231.114.180
-43.231.124.60
  43.231.129.193
  43.231.150.78
  43.231.52.183
  43.231.62.100
-43.231.76.1
  43.231.76.105
  43.231.76.109
  43.231.76.113
@@ -113621,7 +107398,6 @@
  43.231.76.145
  43.231.76.149
  43.231.76.161
-43.231.76.165
  43.231.76.169
  43.231.76.173
  43.231.76.185
@@ -113644,12 +107420,14 @@
  43.231.76.89
  43.231.76.93
  43.231.76.97
-43.231.77.21
+43.231.77.17
  43.231.77.25
  43.231.77.33
  43.231.77.37
  43.231.77.45
+43.231.77.49
  43.231.77.53
+43.231.77.57
  43.231.77.61
  43.231.77.65
  43.231.77.77
@@ -113660,9 +107438,8 @@
  43.231.78.113
  43.231.78.33
  43.231.78.41
-43.231.78.45
-43.231.78.5
  43.231.78.57
+43.231.78.61
  43.231.78.81
  43.231.78.85
  43.231.78.89
@@ -113708,7 +107485,6 @@
  43.241.130.106
  43.241.130.107
  43.241.196.78
-43.241.238.152
  43.241.25.66
  43.241.37.209
  43.242.112.133
@@ -113720,7 +107496,6 @@
  43.242.214.183
  43.242.39.136
  43.243.136.253
-43.243.151.190
  43.243.171.24
  43.243.204.106
  43.243.204.134
@@ -113732,12 +107507,11 @@
  43.243.87.144
  43.245.130.88
  43.245.184.150
-43.245.184.30
-43.245.185.66
  43.245.192.126
  43.245.192.174
  43.245.202.13
  43.245.202.15
+43.245.216.190
  43.245.222.163
  43.245.249.4
  43.245.94.226
@@ -113755,9 +107529,6 @@
  43.247.184.121
  43.247.184.225
  43.247.185.98
-43.247.190.111
-43.247.69.105
-43.248.124.132
  43.248.186.170
  43.248.24.122
  43.248.24.157
@@ -113766,11 +107537,9 @@
  43.248.24.234
  43.248.25.6
  43.248.26.18
-43.248.69.165
  43.248.9.100
  43.249.113.219
-43.249.113.236
-43.249.114.36
+43.249.113.235
  43.249.129.230
  43.249.205.169
  43.249.218.125
@@ -113784,7 +107553,6 @@
  43.249.60.220
  43.249.65.56
  43.249.83.16
-43.250.105.187
  43.250.126.1
  43.250.127.98
  43.250.164.92
@@ -113798,9 +107566,9 @@
  43.251.159.144
  43.251.16.143
  43.251.17.39
+43.251.17.61
  43.251.172.13
  43.251.214.14
-43.251.255.4
  43.251.255.83
  43.251.72.2
  43.251.99.4
@@ -113816,20 +107584,18 @@
  43.252.221.143
  43.252.228.110
  43.252.228.133
-43.252.229.118
  43.252.229.93
  43.252.230.100
  43.252.230.164
  43.252.238.50
+43.252.60.50
  43.252.73.99
  43.254.151.94
-43.254.153.74
  43.254.153.79
  43.254.156.200
  43.254.156.213
  43.254.156.214
  43.254.156.218
-43.254.156.237
  43.254.156.48
  43.254.158.178
  43.254.158.179
@@ -113839,20 +107605,16 @@
  43.254.207.20
  43.254.217.145
  43.254.217.158
-43.254.217.233
-43.254.219.175
  43.254.219.183
  43.254.219.3
  43.254.220.195
-43.254.220.207
  43.254.240.150
  43.254.240.34
  43.254.241.20
-43.254.43.76
  43.254.54.96
-43.254.59.246
  43.254.90.231
  43.255.118.109
+43.255.140.133
  43.255.142.72
  43.255.152.16
  43.255.156.21
@@ -113892,6 +107654,7 @@
  43sd.org
  44.234.25.204
  44.234.67.186
+44.235.184.166
  44.235.31.168
  44.241.40.115
  44.242.104.42
@@ -113918,28 +107681,31 @@
  44unit.duckdns.org
  45-76-47-204.plesk.page
  45.10.164.217
+45.10.165.120
+45.10.165.173
  45.10.165.181
  45.10.165.186
  45.10.165.196
-45.10.165.81
-45.10.175.80
+45.10.165.20
+45.10.165.24
+45.10.165.59
  45.10.232.111
  45.10.232.14
-45.10.232.38
+45.10.232.44
+45.10.232.50
  45.10.232.51
+45.10.232.62
  45.10.232.68
  45.10.232.69
  45.10.232.74
-45.10.232.80
  45.10.232.92
+45.10.234.92
  45.10.237.201
  45.10.237.229
  45.10.237.49
  45.10.237.9
  45.10.239.106
-45.10.239.229
  45.10.239.51
-45.10.239.66
  45.10.24.137
  45.10.24.197
  45.10.24.218
@@ -113960,7 +107726,6 @@
  45.112.117.150
  45.112.117.163
  45.112.127.23
-45.112.132.55
  45.112.140.25
  45.112.160.110
  45.112.202.109
@@ -113968,7 +107733,6 @@
  45.112.204.203
  45.112.207.2
  45.112.242.162
-45.112.242.170
  45.112.242.228
  45.112.54.146
  45.112.56.142
@@ -113981,7 +107745,6 @@
  45.113.238.30
  45.113.67.66
  45.113.68.179
-45.113.69.153
  45.113.69.175
  45.113.70.144
  45.113.70.146
@@ -114006,6 +107769,7 @@
  45.114.130.4
  45.114.144.155
  45.114.147.121
+45.114.147.225
  45.114.147.232
  45.114.147.246
  45.114.147.255
@@ -114014,7 +107778,6 @@
  45.114.68.174
  45.114.85.18
  45.114.85.202
-45.114.85.90
  45.115.112.214
  45.115.112.252
  45.115.171.23
@@ -114023,7 +107786,7 @@
  45.115.171.81
  45.115.173.205
  45.115.174.29
-45.115.178.83
+45.115.176.129
  45.115.179.221
  45.115.26.9
  45.115.60.197
@@ -114042,7 +107805,6 @@
  45.116.179.183
  45.116.2.17
  45.116.3.249
-45.116.35.144
  45.116.76.177
  45.116.77.206
  45.116.79.141
@@ -114062,7 +107824,6 @@
  45.117.112.116
  45.117.160.31
  45.117.160.82
-45.117.168.152
  45.117.207.26
  45.117.222.26
  45.117.228.153
@@ -114083,7 +107844,6 @@
  45.117.65.137
  45.117.74.89
  45.117.77.41
-45.117.81.170
  45.117.82.166
  45.118.132.158
  45.118.133.14
@@ -114095,20 +107855,17 @@
  45.118.145.86
  45.118.151.85
  45.118.32.109
-45.118.32.73
  45.118.32.90
  45.118.32.95
  45.118.35.169
  45.118.35.182
  45.119.125.102
-45.119.125.150
  45.119.125.62
  45.119.125.86
  45.119.125.90
  45.119.126.168
  45.119.126.192
  45.119.126.58
-45.119.126.93
  45.119.203.170
  45.119.212.136
  45.119.212.14
@@ -114119,7 +107876,6 @@
  45.119.80.168
  45.119.80.98
  45.119.81.210
-45.119.81.99
  45.119.82.124
  45.119.82.132
  45.119.82.251
@@ -114129,6 +107885,7 @@
  45.119.84.149
  45.119.84.18
  45.119.85.165
+45.119.85.168
  45.119.85.234
  45.12.177.144
  45.12.177.161
@@ -114140,20 +107897,21 @@
  45.120.119.55
  45.120.162.120
  45.120.200.2
+45.120.49.129
+45.120.49.86
  45.120.50.108
  45.120.50.114
  45.120.50.168
  45.120.50.41
  45.120.50.85
+45.120.51.127
  45.120.51.150
  45.120.51.158
  45.120.51.190
  45.120.51.228
  45.120.51.38
  45.120.51.94
-45.120.69.14
  45.120.69.81
-45.120.69.97
  45.120.76.21
  45.121.111.1
  45.121.144.114
@@ -114170,7 +107928,6 @@
  45.122.222.110
  45.122.255.205
  45.123.109.191
-45.123.109.255
  45.123.109.84
  45.123.110.122
  45.123.110.220
@@ -114192,13 +107949,10 @@
  45.123.43.114
  45.123.43.138
  45.123.8.165
-45.123.8.181
  45.123.8.200
  45.123.8.202
-45.123.8.211
  45.123.8.25
  45.123.8.55
-45.123.8.83
  45.124.109.59
  45.124.113.6
  45.124.144.116
@@ -114217,25 +107971,18 @@
  45.124.25.237
  45.124.53.112
  45.124.86.155
-45.124.86.228
-45.124.86.65
-45.124.87.131
-45.124.95.220
  45.125.117.100
  45.125.117.97
  45.125.12.170
-45.125.222.120
  45.125.239.34
  45.125.239.54
  45.125.245.148
  45.125.245.196
-45.125.44.217
  45.125.45.223
  45.125.45.64
  45.125.46.31
  45.125.58.38
  45.125.63.46
-45.125.65.0
  45.125.65.105
  45.125.65.112
  45.125.65.118
@@ -114251,22 +107998,17 @@
  45.126.124.242
  45.126.161.226
  45.126.22.162
-45.126.252.218
  45.127.101.114
  45.127.101.217
  45.127.186.21
  45.127.204.96
  45.127.205.255
-45.127.96.69
  45.127.97.67
  45.128.133.158
  45.128.133.242
  45.129.165.136
  45.129.166.40
  45.129.180.214
-45.129.180.228
-45.129.181.124
-45.129.181.47
  45.129.198.167
  45.129.33.10
  45.129.33.101
@@ -114288,7 +108030,6 @@
  45.129.33.148
  45.129.33.149
  45.129.33.15
-45.129.33.152
  45.129.33.153
  45.129.33.154
  45.129.33.155
@@ -114331,36 +108072,39 @@
  45.13.58.149
  45.13.58.4
  45.130.144.226
-45.130.147.18
  45.130.147.27
  45.130.255.218
  45.130.60.97
  45.131.108.227
  45.131.192.180
-45.131.193.55
+45.131.193.49
  45.131.231.90
  45.131.29.81
  45.131.34.201
  45.131.4.13
+45.131.4.23
+45.131.47.212
  45.131.7.14
  45.131.7.24
  45.131.7.6
  45.132.104.18
  45.132.105.43
+45.132.12.134
  45.132.138.15
  45.132.138.16
-45.132.18.204
  45.132.185.12
  45.132.185.183
  45.132.185.186
+45.132.185.195
+45.132.185.221
  45.132.185.44
+45.132.185.56
  45.132.185.80
  45.132.187.214
  45.132.194.12
  45.132.194.15
  45.132.194.27
  45.132.242.49
-45.132.246.182
  45.132.26.111
  45.133.106.148
  45.133.106.196
@@ -114368,15 +108112,14 @@
  45.133.107.161
  45.133.119.138
  45.133.171.205
-45.133.179.143
  45.133.180.94
  45.133.192.39
  45.133.192.5
-45.133.193.153
  45.133.193.204
  45.133.232.146
  45.133.232.148
  45.133.88.11
+45.133.88.12
  45.133.88.13
  45.133.88.14
  45.133.88.15
@@ -114387,19 +108130,18 @@
  45.133.88.21
  45.133.88.23
  45.133.88.28
+45.133.88.29
  45.133.88.6
-45.133.88.7
  45.133.88.9
  45.133.9.21
-45.133.9.4
  45.133.9.60
-45.134.145.19
-45.134.147.182
-45.134.147.80
+45.134.172.100
+45.134.172.110
  45.134.172.126
  45.134.172.144
  45.134.172.161
  45.134.172.169
+45.134.172.174
  45.134.172.184
  45.134.172.193
  45.134.172.202
@@ -114407,28 +108149,42 @@
  45.134.172.245
  45.134.172.27
  45.134.172.28
+45.134.172.60
+45.134.172.63
+45.134.173.110
  45.134.173.125
  45.134.173.134
+45.134.173.201
  45.134.173.206
+45.134.173.209
  45.134.173.37
  45.134.173.52
+45.134.173.62
+45.134.173.78
+45.134.173.97
  45.134.174.149
  45.134.174.155
+45.134.174.197
  45.134.174.223
  45.134.174.224
+45.134.174.30
  45.134.174.52
  45.134.174.54
  45.134.174.73
  45.134.175.147
  45.134.175.198
+45.134.175.234
+45.134.175.244
+45.134.175.46
+45.134.175.52
  45.134.175.60
  45.134.175.62
+45.134.175.67
  45.134.183.202
  45.134.183.210
  45.134.187.104
  45.134.187.124
  45.134.187.129
-45.134.187.150
  45.134.187.157
  45.134.187.184
  45.134.187.194
@@ -114440,15 +108196,17 @@
  45.134.187.59
  45.134.187.7
  45.134.187.90
+45.134.20.48
  45.134.22.2
  45.134.22.82
-45.134.26.225
-45.134.26.226
+45.134.24.9
+45.134.26.78
  45.135.118.144
  45.135.134.200
  45.135.134.51
  45.135.135.169
  45.135.167.225
+45.135.187.98
  45.135.232.21
  45.135.232.22
  45.135.232.23
@@ -114460,48 +108218,42 @@
  45.135.4.215
  45.136.12.45
  45.136.12.47
-45.136.128.112
  45.136.131.179
-45.136.28.88
  45.137.10.89
  45.137.150.131
  45.137.180.45
  45.137.184.31
-45.137.190.213
  45.137.190.249
  45.137.198.27
  45.137.198.9
  45.137.20.107
  45.137.22.156
-45.137.22.37
  45.137.22.58
-45.137.22.74
+45.137.22.78
  45.137.22.84
-45.137.22.92
  45.137.65.84
  45.138.100.227
  45.138.100.69
  45.138.101.122
-45.138.101.15
+45.138.101.135
+45.138.101.137
  45.138.101.178
-45.138.101.217
+45.138.101.221
+45.138.101.228
  45.138.101.234
  45.138.101.244
-45.138.101.28
  45.138.101.38
  45.138.101.52
-45.138.101.69
  45.138.101.80
  45.138.101.85
  45.138.101.97
-45.138.102.117
+45.138.101.99
  45.138.102.254
  45.138.97.46
  45.138.99.4
-45.139.176.170
  45.139.176.78
  45.139.186.123
-45.139.186.17
+45.139.186.175
  45.139.222.19
  45.139.236.14
  45.139.236.5
@@ -114518,11 +108270,8 @@
  45.139.48.8
  45.139.52.13
  45.14.148.105
-45.14.148.95
  45.14.148.96
  45.14.149.205
-45.14.149.46
-45.14.150.103
  45.14.150.133
  45.14.150.140
  45.14.150.19
@@ -114531,7 +108280,6 @@
  45.14.150.29
  45.14.150.51
  45.14.150.52
-45.14.150.86
  45.14.151.249
  45.14.20.149
  45.14.224.105
@@ -114539,10 +108287,8 @@
  45.14.224.108
  45.14.224.110
  45.14.224.112
-45.14.224.120
  45.14.224.124
  45.14.224.144
-45.14.224.146
  45.14.224.148
  45.14.224.152
  45.14.224.158
@@ -114551,11 +108297,9 @@
  45.14.224.166
  45.14.224.170
  45.14.224.177
-45.14.224.182
  45.14.224.184
  45.14.224.190
  45.14.224.191
-45.14.224.199
  45.14.224.204
  45.14.224.214
  45.14.224.22
@@ -114574,41 +108318,37 @@
  45.14.224.99
  45.14.225.59
  45.14.225.7
-45.14.251.175
  45.14.29.133
  45.14.49.56
  45.14.50.207
  45.140.165.219
-45.140.165.225
  45.140.168.127
  45.140.168.138
  45.140.169.30
  45.140.170.187
  45.140.170.254
-45.140.206.250
  45.140.207.134
  45.140.207.153
  45.140.207.227
  45.140.235.237
  45.140.53.62
+45.141.100.176
  45.141.156.14
  45.141.156.17
  45.141.156.196
-45.141.156.20
-45.141.156.25
  45.141.156.26
  45.141.156.53
  45.141.156.57
  45.141.156.59
  45.141.157.123
  45.141.159.63
-45.141.176.38
  45.141.241.125
  45.141.247.17
  45.141.58.173
  45.141.58.205
  45.141.58.72
  45.141.84.126
+45.141.84.129
  45.141.84.173
  45.141.84.182
  45.141.84.184
@@ -114616,6 +108356,7 @@
  45.141.84.99
  45.141.86.181
  45.141.86.76
+45.141.87.5
  45.142.120.121
  45.142.120.133
  45.142.120.137
@@ -114711,7 +108452,6 @@
  45.144.177.119
  45.144.177.120
  45.144.177.123
-45.144.177.124
  45.144.207.43
  45.144.30.4
  45.144.65.27
@@ -114720,30 +108460,48 @@
  45.145.117.73
  45.145.119.38
  45.145.121.145
+45.145.128.12
  45.145.128.128
+45.145.128.142
  45.145.128.160
  45.145.128.177
+45.145.128.182
  45.145.128.199
  45.145.128.224
  45.145.128.24
+45.145.128.27
  45.145.128.40
  45.145.128.97
  45.145.129.116
+45.145.129.12
+45.145.129.14
  45.145.129.145
+45.145.129.158
  45.145.129.163
  45.145.129.168
  45.145.129.173
  45.145.129.180
+45.145.129.188
  45.145.129.197
-45.145.129.198
+45.145.129.21
+45.145.129.219
+45.145.129.220
  45.145.129.37
  45.145.129.41
+45.145.129.43
  45.145.129.57
+45.145.129.88
  45.145.129.95
+45.145.129.98
  45.145.131.105
  45.145.131.107
  45.145.131.116
+45.145.131.135
+45.145.131.155
  45.145.131.157
+45.145.131.163
+45.145.131.186
+45.145.131.19
  45.145.131.202
  45.145.131.218
  45.145.131.229
@@ -114751,6 +108509,8 @@
  45.145.131.35
  45.145.131.52
  45.145.131.55
+45.145.131.89
+45.145.131.90
  45.145.185.111
  45.145.185.120
  45.145.185.187
@@ -114798,6 +108558,7 @@
  45.146.164.85
  45.146.164.97
  45.146.164.98
+45.146.165.107
  45.146.165.153
  45.146.165.154
  45.146.165.160
@@ -114824,6 +108585,7 @@
  45.146.165.70
  45.146.165.79
  45.146.165.84
+45.146.165.85
  45.146.166.217
  45.146.166.251
  45.146.167.181
@@ -114860,15 +108622,14 @@
  45.146.167.222
  45.146.167.223
  45.146.167.75
-45.146.168.71
-45.146.252.229
+45.146.253.24
  45.147.192.52
-45.147.192.87
  45.147.193.121
  45.147.198.233
  45.147.198.62
  45.147.228.245
  45.147.229.234
+45.147.229.28
  45.148.10.12
  45.148.10.140
  45.148.10.159
@@ -114878,7 +108639,6 @@
  45.148.10.177
  45.148.10.181
  45.148.10.186
-45.148.10.187
  45.148.10.194
  45.148.10.196
  45.148.10.197
@@ -114887,13 +108647,11 @@
  45.148.10.38
  45.148.10.46
  45.148.10.54
-45.148.10.60
  45.148.10.68
  45.148.10.72
  45.148.10.81
  45.148.10.82
  45.148.10.83
-45.148.10.85
  45.148.10.86
  45.148.10.87
  45.148.10.88
@@ -114902,7 +108660,6 @@
  45.148.10.92
  45.148.10.94
  45.148.10.95
-45.148.10.98
  45.148.120.126
  45.148.120.155
  45.148.120.193
@@ -114911,14 +108668,14 @@
  45.148.121.144
  45.148.121.62
  45.148.121.65
-45.148.121.85
  45.148.121.92
  45.148.122.113
-45.148.122.13
  45.148.122.184
  45.148.124.137
  45.148.124.165
+45.148.124.211
  45.148.124.29
+45.148.125.121
  45.148.125.126
  45.148.125.195
  45.148.125.196
@@ -114927,14 +108684,17 @@
  45.148.125.21
  45.148.125.220
  45.148.125.232
+45.148.125.237
  45.148.125.239
  45.148.125.249
  45.148.125.252
  45.148.125.51
  45.148.125.82
+45.148.125.88
  45.148.125.94
  45.148.125.99
  45.148.232.133
+45.148.232.140
  45.148.232.205
  45.148.232.39
  45.148.233.249
@@ -114945,7 +108705,6 @@
  45.148.235.95
  45.148.242.28
  45.148.75.252
-45.149.165.109
  45.149.165.27
  45.149.78.128
  45.149.78.79
@@ -114954,9 +108713,8 @@
  45.15.16.100
  45.15.16.72
  45.15.16.85
-45.15.237.68
+45.15.237.65
  45.15.24.48
-45.15.26.63
  45.15.61.233
  45.150.187.9
  45.150.206.113
@@ -114983,13 +108741,10 @@
  45.151.88.223
  45.151.88.224
  45.151.88.44
-45.152.116.13
  45.152.198.248
-45.152.198.34
  45.152.198.37
  45.152.199.17
  45.152.199.32
-45.152.202.239
  45.152.32.40
  45.152.32.49
  45.152.33.36
@@ -115003,12 +108758,12 @@
  45.153.157.61
  45.153.158.110
  45.153.158.126
-45.153.158.128
  45.153.158.15
  45.153.158.164
  45.153.158.227
  45.153.160.129
  45.153.160.130
+45.153.170.41
  45.153.184.96
  45.153.186.84
  45.153.187.110
@@ -115024,6 +108779,7 @@
  45.153.203.175
  45.153.203.181
  45.153.203.192
+45.153.203.215
  45.153.203.216
  45.153.203.222
  45.153.203.235
@@ -115043,17 +108799,16 @@
  45.154.168.201
  45.154.170.50
  45.154.170.98
-45.154.245.111
-45.154.245.114
+45.154.245.115
  45.154.245.123
  45.154.245.125
  45.154.245.129
+45.154.245.162
  45.154.245.175
+45.154.245.184
  45.154.245.251
  45.154.245.32
-45.154.245.63
  45.154.245.7
-45.154.245.76
  45.154.245.90
  45.154.245.97
  45.154.255.147
@@ -115096,26 +108851,26 @@
  45.155.42.44
  45.155.42.45
  45.155.42.71
+45.155.89.134
  45.156.100.134
  45.156.100.146
-45.156.186.188
-45.156.187.110
  45.156.22.107
  45.156.22.134
  45.156.22.152
  45.156.22.153
  45.156.22.191
-45.156.22.216
  45.156.22.231
  45.156.22.253
  45.156.22.31
  45.156.22.47
  45.156.22.78
  45.156.22.86
+45.156.23.216
  45.156.24.88
  45.156.25.83
  45.156.26.143
  45.156.30.239
+45.156.31.52
  45.156.84.236
  45.157.138.108
  45.157.149.4
@@ -115123,56 +108878,54 @@
  45.158.19.239
  45.158.199.156
  45.158.23.108
-45.158.37.210
-45.158.44.2
  45.158.44.6
  45.158.44.7
+45.159.17.253
  45.159.18.139
  45.159.18.242
  45.159.23.104
+45.159.23.115
  45.159.23.134
  45.159.23.14
+45.159.23.143
+45.159.23.145
  45.159.23.155
  45.159.23.238
+45.159.23.32
  45.159.23.49
  45.16.103.141
  45.16.226.117
  45.160.100.232
+45.160.130.23
+45.160.136.76
  45.160.138.170
-45.160.150.17
-45.160.151.3
  45.160.191.6
  45.160.75.11
  45.161.152.53
-45.161.176.1
-45.161.184.50
  45.161.242.102
  45.161.253.196
  45.161.255.21
  45.161.255.62
+45.161.3.154
  45.161.41.113
  45.161.42.66
  45.162.10.155
  45.162.123.9
  45.162.20.65
+45.162.20.68
  45.162.20.79
-45.162.20.92
  45.162.203.138
-45.162.216.10
+45.162.214.12
  45.162.225.82
  45.162.231.79
-45.162.32.226
  45.162.37.23
  45.162.4.175
-45.162.4.65
  45.162.4.83
  45.162.49.82
  45.162.49.88
  45.163.117.6
  45.163.117.8
-45.163.144.2
  45.163.147.133
-45.163.188.2
  45.163.193.170
  45.163.200.2
  45.163.200.9
@@ -115191,6 +108944,7 @@
  45.164.42.68
  45.164.8.244
  45.165.0.178
+45.165.129.169
  45.165.16.19
  45.165.164.38
  45.165.168.220
@@ -115198,24 +108952,23 @@
  45.165.213.203
  45.165.213.243
  45.165.214.162
-45.165.214.57
+45.165.214.42
+45.165.215.0
  45.165.68.2
  45.165.68.5
  45.165.90.215
  45.166.152.58
-45.166.153.193
  45.166.181.228
  45.166.186.222
  45.166.186.239
  45.166.246.1
  45.166.246.3
  45.166.33.131
-45.166.33.133
+45.166.33.141
  45.166.35.0
  45.166.35.4
  45.166.35.7
  45.166.35.8
-45.166.57.152
  45.166.69.169
  45.166.69.170
  45.167.11.94
@@ -115229,7 +108982,7 @@
  45.167.36.35
  45.167.36.43
  45.167.76.7
-45.167.9.252
+45.167.8.98
  45.167.9.67
  45.168.15.100
  45.168.15.104
@@ -115307,21 +109060,21 @@
  45.168.31.218
  45.168.31.253
  45.168.31.254
+45.168.43.18
  45.168.43.20
  45.168.43.22
-45.168.56.59
-45.168.56.98
-45.168.57.161
-45.168.57.163
-45.168.57.86
-45.168.58.10
-45.168.58.229
+45.168.56.37
+45.168.57.180
+45.168.57.208
+45.168.57.51
  45.168.74.6
  45.168.96.1
  45.168.99.5
  45.169.120.150
  45.169.136.185
+45.169.17.243
  45.169.172.2
+45.169.19.20
  45.169.196.17
  45.169.196.2
  45.169.201.7
@@ -115336,8 +109089,8 @@
  45.169.64.240
  45.169.98.242
  45.17.72.227
+45.170.129.135
  45.170.129.193
-45.170.14.97
  45.170.221.6
  45.170.251.41
  45.171.124.30
@@ -115345,13 +109098,13 @@
  45.171.246.64
  45.171.33.164
  45.171.59.81
+45.172.108.62
  45.172.108.64
+45.172.108.65
  45.172.108.66
  45.172.108.67
-45.172.108.69
-45.172.108.73
-45.172.108.78
-45.172.108.79
+45.172.108.70
+45.172.108.76
  45.172.108.81
  45.172.108.87
  45.172.108.88
@@ -115360,18 +109113,18 @@
  45.172.152.173
  45.172.202.9
  45.172.214.21
-45.172.234.249
  45.173.12.196
  45.173.12.60
  45.173.130.97
  45.173.18.241
  45.173.196.136
+45.173.26.142
  45.173.28.1
  45.173.36.19
  45.173.72.2
  45.173.88.33
  45.174.149.4
-45.174.237.13
+45.174.237.4
  45.175.108.148
  45.175.108.151
  45.175.12.36
@@ -115405,8 +109158,10 @@
  45.176.109.28bin.sh
  45.176.109.30
  45.176.109.48
+45.176.109.88
  45.176.109.89
  45.176.110.106
+45.176.110.11
  45.176.110.127
  45.176.110.154
  45.176.110.16
@@ -115418,13 +109173,11 @@
  45.176.110.88
  45.176.111.100
  45.176.111.172
-45.176.111.21
  45.176.111.211
  45.176.111.51
  45.176.111.69
  45.176.133.46
  45.176.188.36
-45.176.208.50
  45.176.233.201
  45.176.244.48
  45.176.40.169
@@ -115438,11 +109191,9 @@
  45.177.223.2
  45.177.233.106
  45.178.0.159
-45.178.1.37
  45.178.141.20
  45.178.144.234
  45.178.218.246
-45.178.3.37
  45.178.48.54
  45.179.223.26
  45.179.24.234
@@ -115450,7 +109201,6 @@
  45.180.110.102
  45.180.159.235
  45.180.228.9
-45.181.19.1
  45.181.197.135
  45.181.228.209
  45.181.228.210
@@ -115461,15 +109211,11 @@
  45.181.229.209
  45.181.25.25
  45.181.30.145
-45.181.30.172
-45.181.31.203
-45.181.31.43
-45.181.31.7
  45.181.48.2
+45.181.84.17
  45.181.84.19
-45.181.84.21
+45.181.84.23
  45.181.84.28
-45.182.144.38
  45.182.144.40
  45.182.156.13
  45.182.156.3
@@ -115482,7 +109228,6 @@
  45.183.6.2
  45.183.69.48
  45.183.94.22
-45.184.225.2
  45.184.24.5
  45.184.68.145
  45.184.68.32
@@ -115493,9 +109238,7 @@
  45.185.132.210
  45.185.132.252
  45.185.133.150
-45.185.133.178
  45.185.133.189
-45.185.133.219
  45.185.133.223
  45.185.133.252
  45.185.133.44
@@ -115506,17 +109249,14 @@
  45.185.134.166
  45.185.134.203
  45.185.135.19
-45.185.135.58
  45.185.135.66
  45.185.135.84
  45.185.16.33
  45.185.164.116
  45.185.164.178
-45.185.164.234
  45.185.164.235
  45.185.164.58
  45.185.164.60
-45.185.164.62
  45.185.164.77
  45.185.164.80
  45.185.164.86
@@ -115543,7 +109283,6 @@
  45.188.198.229
  45.188.198.31
  45.188.198.42
-45.188.198.5
  45.188.198.51
  45.188.198.52
  45.188.198.79
@@ -115561,7 +109300,6 @@
  45.189.204.26
  45.189.57.198
  45.19.201.181
-45.190.138.166
  45.190.151.250
  45.190.178.1
  45.190.178.13
@@ -115582,10 +109320,12 @@
  45.191.174.75
  45.191.34.133
  45.191.76.1
-45.191.76.113
  45.191.77.103
  45.195.152.140
  45.195.177.32
+45.195.69.109
+45.195.69.13
+45.195.69.71
  45.199.13.17
  45.2.214.83
  45.20.67.1
@@ -115597,7 +109337,6 @@
  45.201.145.47
  45.201.145.61
  45.201.146.240
-45.201.147.208
  45.201.163.240
  45.201.163.85
  45.201.164.42
@@ -115613,31 +109352,30 @@
  45.201.188.95
  45.201.189.201
  45.201.193.10
-45.201.193.149
  45.201.194.215
  45.201.195.191
+45.201.198.248
  45.201.200.44
  45.201.203.36
  45.201.207.146
  45.201.209.44
  45.201.212.112
  45.201.212.170
-45.202.25.50
-45.202.8.61
  45.207.58.113
  45.221.11.24
  45.221.56.41
+45.221.61.42
  45.221.73.94
  45.221.77.82
  45.222.98.173
  45.222.98.234
+45.224.151.53
  45.224.157.171
  45.224.161.79
-45.224.162.246
-45.224.162.81
+45.224.171.88
  45.224.173.254
  45.224.197.137
-45.224.22.26
+45.224.199.37
  45.224.23.209
  45.224.43.68
  45.224.43.89
@@ -115645,17 +109383,14 @@
  45.225.110.195
  45.225.110.198
  45.225.110.221
-45.225.110.225
-45.225.160.96
-45.225.162.255
  45.225.169.1
  45.225.184.86
  45.225.201.10
-45.225.216.80
  45.225.90.118
  45.225.92.58
  45.225.92.93
-45.226.135.105
+45.226.212.159
+45.226.22.106
  45.226.48.101
  45.226.48.113
  45.226.48.38
@@ -115673,10 +109408,10 @@
  45.227.255.224
  45.227.255.233
  45.227.255.59
+45.227.255.60
  45.227.76.208
  45.227.97.195
  45.227.97.97
-45.227.98.200
  45.227.98.215
  45.228.137.6
  45.228.147.247
@@ -115712,10 +109447,9 @@
  45.23.22.186
  45.230.100.238
  45.230.115.20
-45.230.122.159
  45.230.125.207
+45.230.176.146
  45.230.181.145
-45.230.189.252
  45.230.190.160
  45.230.190.245
  45.230.191.24
@@ -115724,30 +109458,23 @@
  45.230.200.220
  45.230.200.255
  45.230.200.35
-45.230.201.14
  45.230.201.26
  45.230.201.60
  45.230.201.61
-45.230.201.91
-45.230.202.167
-45.230.202.241
  45.230.202.5
-45.230.203.117
-45.230.203.143
  45.230.203.222
  45.230.203.30
-45.230.203.44
-45.230.203.57
+45.230.228.134
  45.230.230.219
  45.230.237.31
  45.230.240.107
-45.230.45.14
+45.230.49.37
  45.230.69.248
  45.230.8.20
-45.230.80.148
  45.231.105.176
  45.231.105.75
  45.231.12.37
+45.231.129.226
  45.231.139.231
  45.231.145.103
  45.231.145.61
@@ -115759,6 +109486,7 @@
  45.231.31.108
  45.231.58.1
  45.231.61.112
+45.231.61.190
  45.231.70.124
  45.232.148.145
  45.232.177.242
@@ -115778,7 +109506,6 @@
  45.232.73.46bin.sh
  45.232.73.83
  45.232.75.253
-45.232.75.255
  45.232.95.124
  45.233.106.72
  45.233.169.14
@@ -115788,6 +109515,8 @@
  45.233.79.42
  45.233.92.125
  45.233.95.120
+45.234.17.23
+45.234.195.64
  45.234.205.197
  45.234.69.150
  45.234.69.178
@@ -115798,41 +109527,35 @@
  45.235.154.187
  45.235.16.88
  45.235.169.2
-45.235.21.181
  45.235.22.243
  45.235.222.215
-45.235.37.4
  45.235.37.98
  45.235.46.13
-45.235.86.21
  45.235.87.138
  45.235.93.14
  45.236.117.25
  45.236.120.119
  45.236.120.241
  45.236.129.243
+45.236.130.158
  45.236.152.24
  45.236.170.6
  45.236.170.9
  45.236.171.122
  45.236.240.70
-45.236.64.138
  45.236.74.206
-45.236.88.35
  45.236.94.8
-45.237.140.120
  45.237.140.13
  45.237.182.98
  45.237.19.194
-45.237.46.136
  45.237.7.216
-45.238.1.234
-45.238.121.135
-45.238.121.206
+45.238.121.175
  45.238.121.207
  45.238.121.225
-45.238.121.251
+45.238.121.243
+45.238.122.107
  45.238.122.174
+45.238.122.219
  45.238.208.10
  45.238.208.6
  45.238.23.82
@@ -115840,8 +109563,9 @@
  45.238.244.161
  45.238.252.74
  45.238.253.133
-45.238.3.216
  45.238.33.144
+45.238.33.147
+45.238.33.150
  45.238.33.156
  45.239.106.32
  45.239.106.5
@@ -115859,6 +109583,7 @@
  45.240.110.172
  45.240.165.228
  45.240.165.56
+45.240.167.48
  45.240.169.32
  45.240.242.19
  45.240.250.6
@@ -115872,22 +109597,22 @@
  45.248.138.210
  45.248.139.140
  45.248.148.106
+45.248.151.6
+45.248.156.143
  45.248.188.30
-45.248.192.187
+45.248.192.181
  45.248.192.84
-45.248.193.1
+45.248.194.116
  45.248.194.175
-45.248.194.196
+45.248.194.217
+45.248.195.160
  45.248.195.170
-45.248.195.182
  45.248.195.32
  45.248.195.94
  45.248.43.33
  45.248.57.126
  45.248.64.58
-45.248.68.189
  45.248.71.169
-45.248.78.28
  45.248.85.91
  45.248.86.69
  45.248.86.88
@@ -115900,25 +109625,19 @@
  45.249.101.1
  45.249.122.6
  45.249.170.193
-45.249.170.50
  45.249.171.100
  45.249.245.50
  45.249.246.175
  45.249.247.162
  45.249.79.105
-45.249.79.149
  45.249.79.185
  45.249.79.190
  45.249.88.41
  45.249.91.246
-45.249.94.208
-45.249.95.6
-45.250.225.44
  45.250.226.136
  45.250.226.56
  45.250.37.130
  45.250.37.136
-45.250.37.165
  45.250.37.174
  45.250.37.186
  45.250.37.187
@@ -115940,20 +109659,15 @@
  45.251.240.125
  45.251.240.197
  45.252.248.13
-45.252.248.16
  45.252.248.177
  45.252.248.18
  45.252.249.73
-45.252.250.64
  45.252.63.2
  45.252.70.44
-45.252.80.2
  45.252.80.3
  45.253.247.117
-45.253.26.216
  45.254.246.93
  45.254.247.234
-45.254.25.213
  45.254.254.130
  45.26.142.184
  45.29.158.89
@@ -115981,7 +109695,6 @@
  45.32.13.11
  45.32.13.224
  45.32.147.97
-45.32.151.224
  45.32.151.23
  45.32.157.119
  45.32.161.147
@@ -116047,7 +109760,6 @@
  45.32.46.42
  45.32.48.134
  45.32.51.158
-45.32.52.90
  45.32.53.231
  45.32.56.132
  45.32.60.66
@@ -116067,6 +109779,7 @@
  45.33.0.176
  45.33.102.116
  45.33.105.252
+45.33.105.8
  45.33.106.26
  45.33.112.174
  45.33.114.241
@@ -116079,7 +109792,6 @@
  45.33.126.185
  45.33.16.200
  45.33.2.198
-45.33.21.213
  45.33.22.66
  45.33.24.209
  45.33.27.61
@@ -116122,16 +109834,15 @@
  45.35.38.114
  45.35.86.118
  45.36.184.6
-45.39.54.51
  45.4.107.96
  45.4.120.236
  45.4.133.35
  45.4.158.22
  45.4.168.15
-45.4.169.201
+45.4.168.224
+45.4.168.32
  45.4.169.231
  45.4.170.240
-45.4.171.18
  45.4.183.30
  45.4.216.52
  45.4.216.54
@@ -116143,10 +109854,10 @@
  45.4.254.82
  45.4.5.221
  45.4.51.68
+45.4.53.193
  45.4.55.10
  45.4.8.66
  45.4.85.152
-45.4.85.76
  45.40.130.40
  45.40.166.142
  45.40.166.144
@@ -116155,43 +109866,40 @@
  45.40.194.129
  45.40.198.93
  45.40.199.82
-45.40.201.5
  45.40.203.112
  45.40.228.204
  45.40.234.156
  45.40.234.46
  45.40.253.179
  45.40.6.122
-45.41.181.139
-45.41.181.153
+45.41.181.126
  45.41.181.95
  45.42.99.241
  45.43.18.171
  45.43.18.215
-45.43.2.2
  45.43.21.31
  45.43.223.210
  45.43.27.71
-45.43.37.166
  45.44.208.10
  45.44.67.105
  45.46.162.85
  45.46.37.97
+45.47.211.246
+45.48.155.61
  45.48.168.16
-45.49.126.40
+45.48.209.6
  45.49.227.60
+45.49.84.92
  45.5.119.86
-45.5.150.206
  45.5.152.78
  45.5.201.18
  45.5.203.2
  45.5.208.129
  45.5.208.25
-45.5.208.57
+45.5.208.6
  45.5.208.72
  45.5.237.56
  45.5.36.104
-45.5.37.56
  45.50.112.141
  45.50.113.87
  45.50.145.59
@@ -116206,7 +109914,6 @@
  45.55.11.212
  45.55.126.22
  45.55.127.240
-45.55.128.109
  45.55.132.121
  45.55.132.29
  45.55.133.137
@@ -116218,13 +109925,10 @@
  45.55.145.34
  45.55.147.118
  45.55.151.121
-45.55.155.224
  45.55.155.31
-45.55.155.72
  45.55.156.19
  45.55.157.1
  45.55.157.126
-45.55.158.8
  45.55.159.57
  45.55.16.175
  45.55.160.193
@@ -116240,13 +109944,11 @@
  45.55.174.85
  45.55.175.193
  45.55.176.173
-45.55.177.214
  45.55.178.16
  45.55.178.34
  45.55.179.132
  45.55.179.219
  45.55.179.243
-45.55.180.7
  45.55.182.138
  45.55.182.159
  45.55.182.232
@@ -116262,11 +109964,9 @@
  45.55.203.174
  45.55.204.230
  45.55.207.153
-45.55.210.248
  45.55.211.163
  45.55.212.244
  45.55.214.42
-45.55.214.64
  45.55.215.38
  45.55.218.21
  45.55.219.114
@@ -116287,7 +109987,6 @@
  45.55.229.195
  45.55.230.207
  45.55.231.12
-45.55.231.94
  45.55.232.81
  45.55.233.181
  45.55.233.213
@@ -116300,7 +109999,6 @@
  45.55.240.206
  45.55.242.13
  45.55.242.212
-45.55.243.124
  45.55.243.61
  45.55.247.211
  45.55.250.212
@@ -116331,8 +110029,6 @@
  45.55.57.6
  45.55.58.10
  45.55.58.205
-45.55.59.4
-45.55.6.42
  45.55.61.114
  45.55.61.52
  45.55.63.118
@@ -116342,21 +110038,18 @@
  45.55.70.15
  45.55.72.19
  45.55.72.34
-45.55.72.69
  45.55.73.155
  45.55.73.47
  45.55.75.49
  45.55.76.70
  45.55.78.41
  45.55.79.45
-45.55.80.186
  45.55.81.21
  45.55.81.254
  45.55.82.2
  45.55.85.252
  45.55.86.6
  45.55.88.16
-45.55.88.94
  45.55.92.26
  45.55.93.198
  45.55.93.253
@@ -116396,15 +110089,14 @@
  45.57.216.78
  45.57.218.203
  45.57.220.236
+45.57.220.243
  45.57.230.153
  45.57.247.164
  45.57.252.135
-45.58.125.72
+45.57.255.118
  45.58.52.13
  45.58.52.17
  45.58.56.76
-45.59.119.127
-45.59.15.18
  45.59.245.93
  45.6.100.128
  45.6.101.206
@@ -116428,19 +110120,23 @@
  45.60.14.113
  45.61.136.31
  45.61.139.48
-45.61.142.182
  45.61.157.194
  45.61.160.112
  45.61.160.154
-45.61.161.214
+45.61.160.75
+45.61.161.13
  45.61.161.217
-45.61.163.164
+45.61.163.21
  45.61.163.49
+45.61.164.134
  45.61.164.213
  45.61.165.20
  45.61.166.100
+45.61.166.115
+45.61.166.119
  45.61.166.62
  45.61.166.78
+45.61.166.92
  45.61.168.18
  45.61.168.30
  45.61.168.32
@@ -116518,8 +110214,8 @@
  45.64.112.184
  45.64.112.78
  45.64.122.210
-45.64.126.103
  45.64.128.160
+45.64.134.198
  45.64.135.130
  45.64.139.126
  45.64.153.150
@@ -116529,6 +110225,7 @@
  45.64.153.61
  45.64.153.62
  45.64.160.53
+45.64.179.144
  45.64.186.102
  45.64.213.46
  45.64.222.24
@@ -116564,46 +110261,66 @@
  45.66.208.235
  45.66.208.81
  45.66.209.104
+45.66.209.121
  45.66.209.139
  45.66.209.156
+45.66.209.179
+45.66.209.195
  45.66.209.20
  45.66.209.203
  45.66.209.36
  45.66.209.38
  45.66.209.43
-45.66.209.97
  45.66.35.35
  45.66.9.110
  45.66.9.200
+45.67.112.122
  45.67.112.43
  45.67.113.140
+45.67.113.71
  45.67.138.104
  45.67.14.154
  45.67.14.61
+45.67.212.119
  45.67.212.169
  45.67.212.183
  45.67.212.208
  45.67.212.230
+45.67.212.249
  45.67.212.44
  45.67.212.53
-45.67.212.66
+45.67.212.56
  45.67.212.69
+45.67.212.79
+45.67.212.81
+45.67.212.94
+45.67.213.12
+45.67.213.126
  45.67.213.136
  45.67.213.153
  45.67.213.154
  45.67.213.160
  45.67.213.166
+45.67.213.178
  45.67.213.189
+45.67.213.191
  45.67.213.206
  45.67.213.219
+45.67.213.241
  45.67.213.32
+45.67.213.37
  45.67.213.45
  45.67.213.61
  45.67.213.68
+45.67.213.72
  45.67.213.76
+45.67.213.89
+45.67.213.95
+45.67.214.105
  45.67.214.109
+45.67.214.157
  45.67.214.160
-45.67.214.182
+45.67.214.186
  45.67.214.42
  45.67.214.45
  45.67.214.51
@@ -116641,7 +110358,6 @@
  45.7.177.226
  45.7.177.229
  45.7.177.231
-45.7.177.232
  45.7.177.235
  45.7.177.236
  45.7.177.241
@@ -116649,13 +110365,13 @@
  45.7.177.248
  45.7.178.102
  45.7.178.106
+45.7.179.113
  45.7.179.201
  45.7.196.77
  45.7.205.103
  45.7.208.130
  45.7.208.144
  45.7.209.44
-45.7.230.252
  45.7.231.15
  45.7.238.90
  45.70.0.137
@@ -116672,6 +110388,7 @@
  45.70.204.21
  45.70.204.233
  45.70.204.238
+45.70.204.245
  45.70.204.249
  45.70.204.254
  45.70.207.253
@@ -116700,32 +110417,29 @@
  45.71.80.25
  45.71.80.49
  45.71.80.5
-45.72.0.130
  45.72.0.132
  45.72.0.140
  45.72.0.141
  45.72.0.166
-45.72.0.168
  45.72.0.247
  45.72.109.125
+45.72.119.67
  45.72.129.231
  45.72.219.86
  45.72.223.119
  45.72.26.34
+45.72.28.102
  45.72.3.143
  45.72.3.252
  45.72.35.243
-45.72.61.120
  45.72.61.141
+45.72.61.149
  45.72.61.155
  45.72.61.187
  45.72.61.201
  45.72.61.225
-45.72.67.13
  45.72.67.58
-45.72.67.61
  45.72.67.79
-45.72.67.92
  45.72.7.197
  45.72.71.180
  45.72.71.214
@@ -116750,7 +110464,6 @@
  45.76.0.233
  45.76.100.103
  45.76.105.56
-45.76.11.72
  45.76.110.71
  45.76.113.53
  45.76.115.159
@@ -116761,6 +110474,7 @@
  45.76.131.75
  45.76.132.156
  45.76.135.239
+45.76.144.211
  45.76.145.89
  45.76.146.75
  45.76.147.15
@@ -116773,7 +110487,6 @@
  45.76.153.45
  45.76.153.90
  45.76.159.251
-45.76.160.241
  45.76.161.189
  45.76.164.246
  45.76.165.182
@@ -116788,7 +110501,6 @@
  45.76.179.26
  45.76.179.89
  45.76.18.117
-45.76.183.235
  45.76.183.242
  45.76.186.19
  45.76.187.18
@@ -116805,6 +110517,7 @@
  45.76.199.36
  45.76.20.147
  45.76.20.69
+45.76.202.121
  45.76.203.14
  45.76.203.62
  45.76.207.18
@@ -116867,7 +110580,6 @@
  45.77.101.17
  45.77.101.204
  45.77.101.248
-45.77.106.122
  45.77.106.13
  45.77.106.55
  45.77.115.191
@@ -116893,15 +110605,14 @@
  45.77.18.237
  45.77.181.137
  45.77.182.189
-45.77.186.161
  45.77.186.176
  45.77.193.121
  45.77.193.123
+45.77.199.180
  45.77.205.198
  45.77.208.40
  45.77.208.49
  45.77.209.52
-45.77.210.84
  45.77.22.135
  45.77.22.234
  45.77.224.233
@@ -116922,7 +110633,6 @@
  45.77.26.160
  45.77.28.74
  45.77.3.234
-45.77.33.128
  45.77.33.26
  45.77.37.131
  45.77.38.117
@@ -116957,7 +110667,6 @@
  45.78.19.3
  45.78.45.82
  45.78.58.136
-45.78.65.108
  45.78.7.222
  45.78.77.44
  45.79.0.178
@@ -116999,6 +110708,7 @@
  45.79.146.48
  45.79.151.241
  45.79.157.103
+45.79.16.111
  45.79.161.222
  45.79.164.28
  45.79.165.189
@@ -117006,6 +110716,7 @@
  45.79.165.48
  45.79.165.61
  45.79.172.142
+45.79.173.47
  45.79.175.163
  45.79.179.13
  45.79.179.161
@@ -117022,7 +110733,6 @@
  45.79.196.171
  45.79.197.163
  45.79.2.113
-45.79.202.29
  45.79.209.189
  45.79.211.38
  45.79.211.69
@@ -117078,29 +110788,26 @@
  45.79.95.107
  45.79.95.154
  45.79.99.208
-45.8.116.127
  45.8.255.76
-45.8.99.125
-45.8.99.144
-45.8.99.171
-45.8.99.192
  45.8.99.223
  45.8.99.231
  45.8.99.241
  45.8.99.245
-45.8.99.40
-45.8.99.66
-45.8.99.76
-45.8.99.94
  45.80.104.228
  45.80.104.23
  45.80.105.189
+45.80.105.35
+45.80.106.105
+45.80.106.12
+45.80.106.152
  45.80.106.154
-45.80.106.162
+45.80.106.211
  45.80.106.239
+45.80.106.240
  45.80.106.250
  45.80.106.43
  45.80.106.53
+45.80.106.55
  45.80.106.80
  45.80.106.98
  45.80.107.110
@@ -117108,8 +110815,12 @@
  45.80.107.14
  45.80.107.143
  45.80.107.15
+45.80.107.150
+45.80.107.166
+45.80.107.174
  45.80.107.179
  45.80.107.198
+45.80.107.201
  45.80.107.202
  45.80.107.225
  45.80.107.226
@@ -117122,21 +110833,18 @@
  45.80.107.99
  45.80.148.33
  45.80.149.68
-45.80.151.58
  45.80.153.177
  45.80.153.178
  45.80.210.236
  45.80.210.254
  45.80.64.230
  45.80.64.246
-45.80.65.82
  45.81.136.11
  45.81.226.10
  45.81.226.17
  45.81.226.57
  45.81.226.59
  45.81.235.31
-45.81.235.58
  45.81.7.162
  45.81.7.40
  45.81.7.68
@@ -117145,7 +110853,6 @@
  45.82.138.80
  45.82.139.34
  45.82.144.59
-45.82.153.245
  45.82.196.100
  45.82.196.103
  45.82.196.126
@@ -117154,8 +110861,8 @@
  45.82.196.240
  45.82.197.123
  45.82.197.132
-45.82.197.135
  45.82.197.136
+45.82.197.141
  45.82.197.165
  45.82.197.184
  45.82.197.186
@@ -117163,16 +110870,18 @@
  45.82.197.252
  45.82.197.3
  45.82.197.90
-45.82.245.34
  45.82.72.92
  45.82.73.214
  45.83.27.152
+45.83.27.171
  45.83.64.103
+45.83.64.107
  45.83.64.113
  45.83.64.118
  45.83.64.121
  45.83.64.123
  45.83.64.128
+45.83.64.130
  45.83.64.131
  45.83.64.136
  45.83.64.165
@@ -117181,11 +110890,13 @@
  45.83.64.200
  45.83.64.210
  45.83.64.213
+45.83.64.220
  45.83.64.226
  45.83.64.228
  45.83.64.240
  45.83.64.241
  45.83.64.242
+45.83.64.243
  45.83.64.246
  45.83.64.248
  45.83.64.34
@@ -117194,17 +110905,23 @@
  45.83.64.43
  45.83.64.58
  45.83.64.59
+45.83.64.71
+45.83.64.76
  45.83.64.77
  45.83.64.83
  45.83.65.100
  45.83.65.102
  45.83.65.106
+45.83.65.107
  45.83.65.108
+45.83.65.122
  45.83.65.123
  45.83.65.125
  45.83.65.138
  45.83.65.157
+45.83.65.166
  45.83.65.175
+45.83.65.178
  45.83.65.183
  45.83.65.192
  45.83.65.194
@@ -117213,13 +110930,17 @@
  45.83.65.203
  45.83.65.205
  45.83.65.212
+45.83.65.229
  45.83.65.230
  45.83.65.238
+45.83.65.241
  45.83.65.245
  45.83.65.249
  45.83.65.25
  45.83.65.34
  45.83.65.39
+45.83.65.40
+45.83.65.41
  45.83.65.69
  45.83.65.76
  45.83.65.82
@@ -117246,6 +110967,7 @@
  45.83.66.38
  45.83.66.40
  45.83.66.61
+45.83.66.73
  45.83.66.74
  45.83.66.8
  45.83.67.103
@@ -117326,11 +111048,11 @@
  45.84.196.51
  45.84.196.58
  45.84.196.6
+45.84.196.60
  45.84.196.75
  45.84.196.81
  45.84.196.84
  45.84.196.85
-45.84.196.86
  45.84.196.88
  45.84.196.89
  45.84.196.99
@@ -117341,12 +111063,12 @@
  45.86.201.173
  45.86.65.210
  45.86.68.29
-45.87.186.77
  45.87.2.244
  45.87.212.58
  45.87.212.59
  45.87.213.162
  45.87.213.88
+45.87.228.50
  45.87.43.10
  45.87.43.109
  45.87.43.115
@@ -117359,8 +111081,6 @@
  45.88.106.72
  45.88.106.90
  45.88.110.171
-45.88.12.52
-45.88.13.242
  45.88.209.181
  45.88.3.145
  45.88.55.25
@@ -117372,7 +111092,6 @@
  45.89.241.33
  45.89.67.171
  45.89.67.49
-45.89.73.3
  45.9.148.102
  45.9.148.134
  45.9.148.29
@@ -117381,20 +111100,15 @@
  45.9.251.14
  45.9.251.178
  45.9.46.139
-45.9.61.221
  45.9.62.110
  45.90.141.44
-45.90.196.199
-45.90.33.180
  45.90.57.101
-45.90.58.42
  45.91.101.18
  45.91.202.62
  45.91.203.231
  45.91.203.3
  45.91.23.19
  45.91.250.65
-45.92.169.198
  45.92.228.21
  45.92.28.166
  45.92.28.180
@@ -117407,7 +111121,6 @@
  45.93.201.131
  45.93.201.167
  45.93.201.62
-45.94.108.99
  45.94.232.124
  45.94.232.146
  45.94.232.151
@@ -117415,7 +111128,9 @@
  45.94.232.159
  45.94.232.183
  45.94.232.199
+45.94.232.67
  45.94.234.133
+45.94.234.141
  45.94.234.17
  45.94.234.179
  45.94.234.185
@@ -117431,6 +111146,7 @@
  45.94.235.187
  45.94.47.131
  45.95.116.111
+45.95.116.148
  45.95.116.82
  45.95.168.102
  45.95.168.103
@@ -117603,7 +111319,6 @@
  45reasonswhy.com
  45tges3.icu
  45tuyr.site
-46.0.203.166
  46.0.205.102
  46.0.228.207
  46.1.2.157
@@ -117613,7 +111328,9 @@
  46.10.221.163
  46.10.253.4
  46.10.72.86
+46.100.249.100
  46.100.55.18
+46.100.55.79
  46.100.57.26
  46.100.60.225
  46.100.63.54
@@ -117629,7 +111346,6 @@
  46.101.103.221
  46.101.105.227
  46.101.109.13
-46.101.11.213
  46.101.111.159
  46.101.111.168
  46.101.112.24
@@ -117640,10 +111356,8 @@
  46.101.117.16
  46.101.117.167
  46.101.117.230
-46.101.120.173
  46.101.124.192
  46.101.127.55
-46.101.128.28
  46.101.129.22
  46.101.13.178
  46.101.130.218
@@ -117659,7 +111373,6 @@
  46.101.138.85
  46.101.139.105
  46.101.139.12
-46.101.139.211
  46.101.139.248
  46.101.139.73
  46.101.141.96
@@ -117672,15 +111385,12 @@
  46.101.15.161
  46.101.150.9
  46.101.151.167
-46.101.151.52
-46.101.151.97
  46.101.152.58
  46.101.152.77
  46.101.154.113
  46.101.154.96
-46.101.157.11
+46.101.156.213
  46.101.158.114
-46.101.164.27
  46.101.164.33
  46.101.164.46
  46.101.164.5
@@ -117698,7 +111408,6 @@
  46.101.173.231
  46.101.173.66
  46.101.173.84
-46.101.174.188
  46.101.174.244
  46.101.177.24
  46.101.178.69
@@ -117708,14 +111417,13 @@
  46.101.18.29
  46.101.182.128
  46.101.182.131
-46.101.183.105
+46.101.182.213
  46.101.184.178
  46.101.184.87
  46.101.185.141
  46.101.188.144
  46.101.188.246
  46.101.189.20
-46.101.189.37
  46.101.19.133
  46.101.19.231
  46.101.192.47
@@ -117732,7 +111440,6 @@
  46.101.197.40
  46.101.2.135
  46.101.2.142
-46.101.200.68
  46.101.201.158
  46.101.201.4
  46.101.204.113
@@ -117748,6 +111455,7 @@
  46.101.211.105
  46.101.211.186
  46.101.213.139
+46.101.213.39
  46.101.214.166
  46.101.215.222
  46.101.217.186
@@ -117756,7 +111464,6 @@
  46.101.221.84
  46.101.223.195
  46.101.224.184
-46.101.226.91
  46.101.227.135
  46.101.228.29
  46.101.229.251
@@ -117786,15 +111493,12 @@
  46.101.250.174
  46.101.252.51
  46.101.253.214
-46.101.253.249
  46.101.254.119
  46.101.255.170
  46.101.255.209
  46.101.255.7
-46.101.26.21
  46.101.27.223
  46.101.3.224
-46.101.33.198
  46.101.35.241
  46.101.38.170
  46.101.38.84
@@ -117809,9 +111513,9 @@
  46.101.52.191
  46.101.53.154
  46.101.53.190
+46.101.55.40
  46.101.58.37
  46.101.6.43
-46.101.6.56
  46.101.6.76
  46.101.61.207
  46.101.61.36
@@ -117819,9 +111523,7 @@
  46.101.7.170
  46.101.72.51
  46.101.73.232
-46.101.73.64
  46.101.77.53
-46.101.77.58
  46.101.79.212
  46.101.8.59
  46.101.80.211
@@ -117830,7 +111532,6 @@
  46.101.81.12
  46.101.81.219
  46.101.81.228
-46.101.84.13
  46.101.84.227
  46.101.87.133
  46.101.88.10
@@ -117853,6 +111554,7 @@
  46.105.103.59
  46.105.103.9
  46.105.107.134
+46.105.107.154
  46.105.107.182
  46.105.107.98
  46.105.108.104
@@ -117871,20 +111573,16 @@
  46.105.131.79
  46.105.131.87
  46.105.132.32
-46.105.148.212
  46.105.148.221
-46.105.149.168
-46.105.149.77
  46.105.160.91
  46.105.161.65
  46.105.163.8
  46.105.17.34
  46.105.171.109
-46.105.178.243
+46.105.178.247
  46.105.18.17
  46.105.226.77
  46.105.227.206
-46.105.234.9
  46.105.243.22
  46.105.244.17
  46.105.250.196
@@ -117909,17 +111607,18 @@
  46.107.230.156
  46.107.68.106
  46.108.136.27
-46.11.176.22
+46.114.0.212
  46.114.106.30
  46.114.107.143
+46.114.108.150
  46.114.143.236
  46.114.144.118
  46.114.144.195
  46.114.145.181
-46.114.148.110
+46.114.148.118
  46.114.149.20
-46.114.149.84
-46.114.149.89
+46.114.3.46
+46.114.4.96
  46.114.5.5
  46.118.112.135
  46.118.113.15
@@ -117931,6 +111630,7 @@
  46.118.123.51
  46.118.126.218
  46.118.126.8
+46.118.141.56
  46.118.155.216
  46.118.158.197
  46.118.159.3
@@ -117940,6 +111640,7 @@
  46.119.115.106
  46.119.121.84
  46.119.127.129
+46.119.158.244
  46.119.160.162
  46.119.160.60
  46.119.162.195
@@ -117948,6 +111649,7 @@
  46.119.169.104
  46.119.172.173
  46.119.174.102
+46.119.176.165
  46.119.180.141
  46.119.181.140
  46.119.181.236
@@ -117956,6 +111658,7 @@
  46.119.189.193
  46.119.190.168
  46.12.124.179
+46.12.137.17
  46.12.159.43
  46.12.218.80
  46.12.250.238
@@ -117974,15 +111677,13 @@
  46.126.96.244
  46.127.38.231
  46.128.140.193
-46.128.245.114
-46.128.40.173
+46.128.41.9
  46.13.69.32
  46.130.119.42
  46.130.127.172
  46.130.63.240
  46.132.185.206
  46.132.189.44
-46.135.87.235
  46.136.51.234
  46.137.102.36
  46.137.138.142
@@ -117993,11 +111694,11 @@
  46.141.122.77
  46.141.92.60
  46.142.10.35
-46.142.15.52
-46.142.244.189
+46.142.15.6
+46.142.154.123
  46.142.7.107
  46.142.71.144
-46.142.79.173
+46.142.81.157
  46.143.184.209
  46.146.136.8
  46.146.20.23
@@ -118006,18 +111707,15 @@
  46.146.214.111
  46.146.214.244
  46.146.218.79
-46.146.222.134
  46.146.234.10
  46.146.239.105
  46.146.240.185
  46.146.240.199
-46.146.248.177
  46.146.248.89
  46.146.36.104
  46.146.48.171
  46.147.117.100
  46.147.132.50
-46.147.98.191
  46.148.18.122
  46.148.186.136
  46.148.190.223
@@ -118032,7 +111730,6 @@
  46.148.39.184
  46.148.39.24
  46.148.45.20
-46.148.45.249
  46.149.113.2
  46.149.176.223
  46.149.177.143
@@ -118058,7 +111755,6 @@
  46.150.252.11
  46.150.7.15
  46.150.75.100
-46.150.76.25
  46.150.84.42
  46.151.150.11
  46.151.157.115
@@ -118070,10 +111766,10 @@
  46.152.110.9
  46.152.147.228
  46.152.211.224
-46.152.56.28
  46.152.78.103
  46.158.243.217
  46.158.81.33
+46.16.10.155
  46.16.226.6
  46.16.228.6
  46.160.125.167
@@ -118142,6 +111838,7 @@
  46.161.62.69
  46.161.62.73
  46.161.62.74
+46.161.62.86
  46.161.62.87
  46.161.63.102
  46.161.63.103
@@ -118233,6 +111930,7 @@
  46.161.63.72
  46.161.63.73
  46.161.63.74
+46.161.63.77
  46.161.63.78
  46.161.63.79
  46.161.63.81
@@ -118257,12 +111955,21 @@
  46.164.245.157
  46.164.246.184
  46.164.248.220
-46.164.254.223
-46.165.129.66
-46.165.130.144
+46.165.130.77
+46.165.132.103
+46.165.133.62
+46.165.134.173
+46.165.136.53
+46.165.138.124
+46.165.141.231
+46.165.147.21
+46.165.149.79
  46.165.160.110
-46.165.177.219
-46.165.186.52
+46.165.177.116
+46.165.185.4
+46.165.186.109
+46.165.189.72
+46.165.191.38
  46.165.197.141
  46.165.210.17
  46.165.220.212
@@ -118288,12 +111995,12 @@
  46.166.139.20
  46.166.139.35
  46.166.142.2
-46.166.142.216
  46.166.143.115
  46.166.143.122
  46.166.148.141
  46.166.148.160
  46.166.148.177
+46.166.151.103
  46.166.151.116
  46.166.151.160
  46.166.160.44
@@ -118344,29 +112051,25 @@
  46.17.99.143
  46.170.225.73
  46.171.110.250
+46.171.143.75
  46.171.163.10
  46.171.210.65
  46.171.236.4
-46.171.236.7
  46.171.28.162
  46.172.155.222
  46.172.223.250
  46.172.238.233
  46.172.4.111
  46.172.56.2
+46.172.63.49
  46.172.69.163
  46.172.69.76
  46.172.84.203
  46.172.90.198
  46.173.11.110
-46.173.164.128
-46.173.164.63
  46.173.165.208
  46.173.167.107
-46.173.167.113
  46.173.167.152
-46.173.167.154
-46.173.167.34
  46.173.167.57
  46.173.172.103
  46.173.174.164
@@ -118405,7 +112108,6 @@
  46.176.198.232
  46.176.223.222
  46.176.244.203
-46.177.0.134
  46.18.202.159
  46.18.67.50
  46.18.76.4
@@ -118416,7 +112118,6 @@
  46.182.106.190
  46.182.111.80
  46.182.173.246
-46.182.173.247
  46.182.19.219
  46.182.19.49
  46.182.21.248
@@ -118460,8 +112161,6 @@
  46.185.206.200
  46.185.226.153
  46.185.240.125
-46.185.240.48
-46.185.246.192
  46.185.246.193
  46.187.56.214
  46.188.10.187
@@ -118471,7 +112170,6 @@
  46.188.30.118
  46.188.44.82
  46.188.45.11
-46.188.72.27
  46.188.82.11
  46.188.82.63
  46.188.83.165
@@ -118489,10 +112187,12 @@
  46.190.43.220
  46.190.49.203
  46.190.51.101
+46.190.74.47
  46.190.83.27
  46.191.137.149
  46.191.138.133
  46.191.138.52
+46.191.224.233
  46.191.226.105
  46.191.232.221
  46.194.133.208
@@ -118504,9 +112204,7 @@
  46.194.62.91
  46.195.178.84
  46.195.181.23
-46.196.24.98
  46.197.213.251
-46.198.194.125
  46.199.195.95
  46.2.242.2
  46.20.152.56
@@ -118520,7 +112218,6 @@
  46.200.137.238
  46.200.204.214
  46.200.40.235
-46.200.73.236
  46.200.80.14
  46.201.104.66
  46.201.227.148
@@ -118536,7 +112233,6 @@
  46.21.101.66
  46.21.111.219
  46.21.145.91
-46.21.147.137
  46.21.147.142
  46.21.147.61
  46.21.171.85
@@ -118549,13 +112245,13 @@
  46.21.86.122
  46.21.97.90
  46.212.177.70
+46.214.12.169
  46.214.120.147
  46.214.123.55
  46.214.125.132
  46.214.183.35
  46.214.201.152
  46.214.37.242
-46.214.58.169
  46.214.70.50
  46.216.11.214
  46.216.25.182
@@ -118568,7 +112264,6 @@
  46.218.85.122
  46.218.85.69
  46.219.112.33
-46.219.116.22
  46.219.126.85
  46.219.46.150
  46.219.80.142
@@ -118604,7 +112299,6 @@
  46.227.162.98
  46.227.36.147
  46.228.93.242
-46.229.127.27
  46.229.165.141
  46.229.165.142
  46.229.168.129
@@ -118648,13 +112342,13 @@
  46.229.224.194
  46.229.238.187
  46.229.67.198
+46.23.184.111
  46.23.42.113
  46.23.74.181
  46.23.87.218
  46.231.170.143
  46.231.66.202
  46.231.79.185
-46.231.90.201
  46.232.132.249
  46.232.176.45
  46.232.249.138
@@ -118662,7 +112356,6 @@
  46.232.251.222
  46.233.193.24
  46.233.20.96
-46.233.203.204
  46.233.218.209
  46.233.28.137
  46.233.40.185
@@ -118674,11 +112367,11 @@
  46.235.91.97
  46.236.116.143
  46.236.194.34
+46.236.79.13
  46.237.253.139
  46.237.49.3
  46.238.134.247
  46.238.41.201
-46.238.53.245
  46.24.130.254
  46.24.14.169
  46.24.142.33
@@ -118692,7 +112385,6 @@
  46.242.12.162
  46.242.128.108
  46.242.13.230
-46.242.145.104
  46.242.66.240
  46.243.12.99
  46.243.145.131
@@ -118732,35 +112424,22 @@
  46.246.39.231
  46.246.40.179
  46.246.40.212
-46.246.6.16
  46.246.61.185
  46.246.62.206
  46.246.65.158
-46.246.65.166
  46.246.65.211
  46.246.65.220
  46.246.77.55
  46.246.94.204
-46.248.166.75
  46.248.167.158
-46.248.186.152
  46.249.114.178
  46.249.19.176
-46.249.199.7
  46.249.3.66
  46.249.32.10
  46.249.32.100
-46.249.32.119
-46.249.32.121
  46.249.32.129
-46.249.32.150
  46.249.32.191
-46.249.32.200
-46.249.32.202
  46.249.32.27
-46.249.32.58
-46.249.32.77
-46.249.32.80
  46.249.32.95
  46.249.38.194
  46.249.59.113
@@ -118773,6 +112452,7 @@
  46.250.221.18
  46.251.140.203
  46.251.18.231
+46.251.59.172
  46.251.98.68
  46.252.100.42
  46.252.107.81
@@ -118789,14 +112469,12 @@
  46.254.240.106
  46.254.247.53
  46.254.247.60
-46.254.94.217
  46.255.211.20
-46.255.99.7
  46.26.133.184
  46.26.134.157
  46.26.157.54
+46.26.26.5
  46.27.131.40
-46.27.140.1
  46.27.181.85
  46.27.203.36
  46.27.213.170
@@ -118812,15 +112490,13 @@
  46.28.227.78
  46.28.67.124
  46.28.75.214
-46.28.89.34
-46.29.11.254
  46.29.116.3
  46.29.116.6
  46.29.160.11
-46.29.160.115
  46.29.160.116
  46.29.160.121
  46.29.161.214
+46.29.161.84
  46.29.164.31
  46.29.166.105
  46.29.172.234
@@ -118828,7 +112504,6 @@
  46.29.248.238
  46.29.249.218
  46.29.250.186
-46.29.251.206
  46.29.251.236
  46.29.251.238
  46.29.251.247
@@ -118840,15 +112515,11 @@
  46.31.221.116
  46.32.100.55
  46.32.104.98
-46.32.114.55
  46.32.2.158
  46.32.234.8
  46.32.239.84
  46.32.252.149
-46.32.252.84
  46.32.254.123
-46.32.45.207
-46.32.50.98
  46.32.53.120
  46.32.78.150
  46.33.226.78
@@ -118865,7 +112536,6 @@
  46.33.41.40
  46.33.43.73
  46.33.44.142
-46.33.46.164
  46.33.54.202
  46.34.153.66
  46.34.161.9
@@ -118877,8 +112547,8 @@
  46.35.7.43
  46.36.132.68
  46.36.141.236
+46.36.219.39
  46.36.220.44
-46.36.27.114
  46.36.27.120
  46.36.70.144
  46.37.188.139
@@ -118900,12 +112570,12 @@
  46.39.139.189
  46.39.144.10
  46.39.156.20
+46.39.197.9
  46.39.21.179
  46.39.223.186
  46.39.238.44
  46.39.41.21
  46.39.55.138
-46.39.55.153
  46.39.55.164
  46.39.55.245
  46.39.56.78
@@ -118922,7 +112592,6 @@
  46.4.122.56
  46.4.123.15
  46.4.123.172
-46.4.129.54
  46.4.136.69
  46.4.152.178
  46.4.157.37
@@ -118938,7 +112607,6 @@
  46.4.33.195
  46.4.34.140
  46.4.38.195
-46.4.5.98
  46.4.51.153
  46.4.64.197
  46.4.68.112
@@ -118947,6 +112615,7 @@
  46.4.71.70
  46.4.72.118
  46.4.78.148
+46.4.80.195
  46.4.87.105
  46.4.87.133
  46.4.88.46
@@ -118958,8 +112627,7 @@
  46.40.92.231
  46.41.102.50
  46.41.134.9
-46.41.135.161
-46.41.139.134
+46.42.102.246
  46.42.16.160
  46.42.18.28
  46.43.1.22
@@ -118967,8 +112635,8 @@
  46.43.204.88
  46.43.83.64
  46.44.0.198
+46.44.0.239
  46.44.166.125
-46.44.201.212
  46.44.243.62
  46.45.15.200
  46.45.187.49
@@ -118981,7 +112649,6 @@
  46.48.14.121
  46.48.142.45
  46.5.193.5
-46.5.206.147
  46.50.174.214
  46.50.198.180
  46.50.208.71
@@ -118993,7 +112660,9 @@
  46.52.255.69
  46.53.183.136
  46.53.195.177
+46.53.98.196
  46.55.168.50
+46.55.218.95
  46.55.247.81
  46.55.25.191
  46.55.34.223
@@ -119001,7 +112670,6 @@
  46.59.12.86
  46.59.124.166
  46.59.17.98
-46.59.205.153
  46.59.243.225
  46.59.25.81
  46.59.30.133
@@ -119009,8 +112677,10 @@
  46.59.65.88
  46.59.67.69
  46.59.79.34
+46.59.87.87
  46.6.1.130
  46.6.11.103
+46.6.15.129
  46.6.15.18
  46.6.7.61
  46.61.115.26
@@ -119033,9 +112703,11 @@
  46.77.64.29
  46.77.88.255
  46.8.105.10
+46.8.107.5
  46.8.135.172
-46.8.136.212
  46.8.15.214
+46.8.155.111
+46.8.156.177
  46.8.159.147
  46.8.16.53
  46.8.178.103
@@ -119055,7 +112727,6 @@
  46.8.178.120
  46.8.178.121
  46.8.178.67
-46.8.178.69
  46.8.178.80
  46.8.178.81
  46.8.178.82
@@ -119070,9 +112741,9 @@
  46.8.179.64
  46.8.187.208
  46.8.190.146
-46.8.193.85
  46.8.198.202
  46.8.198.222
+46.8.213.173
  46.8.243.235
  46.8.247.3
  46.8.33.101
@@ -119089,10 +112760,11 @@
  46.8.33.245
  46.8.33.250
  46.8.33.254
-46.8.39.98
  46.8.56.152
  46.8.56.21
  46.8.57.3
+46.82.243.40
+46.83.38.254
  46.83.64.222
  46.83.64.63
  46.83.66.63
@@ -119101,11 +112773,13 @@
  46.83.72.164
  46.83.73.54
  46.83.77.136
+46.83.85.192
  46.86.67.167
+46.88.232.95
  46.9.242.202
  46.90.93.165
-46.90.94.120
  46.91.125.87
+46.91.245.135
  46.91.248.149
  46.93.99.39
  46.97.241.238
@@ -119125,8 +112799,7 @@
  46.99.195.78
  46.99.251.244
  46.99.255.235
-46.99.55.151
-46.99.99.203
+46.99.38.218
  460365365.com
  4624.31cf4fdae.com
  4632.3190cfdae.com
@@ -119151,9 +112824,9 @@
  46buortfa46.bankofamericaslpemr.com
  46graingers.com.au
  46w46.com
+47.100.103.115
  47.100.106.114
  47.100.107.125
-47.100.119.112
  47.100.120.52
  47.100.137.252
  47.100.139.94
@@ -119163,80 +112836,78 @@
  47.100.192.146
  47.100.203.120
  47.100.226.196
+47.100.228.93
  47.100.244.87
  47.100.27.114
  47.100.43.246
-47.100.61.225
  47.100.88.65
-47.101.151.15
  47.101.175.143
-47.101.187.9
  47.101.190.190
  47.101.36.129
  47.102.102.47
  47.102.117.102
+47.102.139.58
  47.102.155.224
  47.102.193.203
  47.102.216.176
+47.102.223.171
  47.102.44.188
+47.102.98.167
  47.103.1.49
  47.103.134.44
  47.103.14.96
-47.103.195.117
-47.103.56.248
  47.104.150.67
-47.104.153.246
-47.104.176.209
-47.104.189.181
+47.104.156.239
+47.104.182.97
  47.104.191.32
-47.104.207.69
  47.104.222.152
  47.104.232.19
  47.104.238.8
-47.104.242.42
  47.104.252.203
  47.104.29.198
  47.104.68.172
  47.104.79.149
+47.104.90.58
  47.104.93.176
  47.105.100.191
  47.105.132.8
+47.105.137.74
+47.105.147.10
  47.105.149.144
  47.105.160.127
  47.105.161.162
  47.105.164.105
  47.105.25.175
+47.105.67.205
+47.106.113.245
  47.106.124.179
  47.106.161.182
  47.106.186.21
  47.106.192.167
-47.106.195.186
  47.106.197.184
  47.106.201.134
  47.106.221.116
-47.106.239.64
  47.106.59.75
  47.106.82.115
  47.106.84.72
  47.106.86.211
+47.106.91.124
  47.107.133.109
  47.107.134.197
  47.107.136.135
-47.107.138.137
  47.107.140.142
  47.107.140.220
  47.107.141.34
  47.107.147.168
+47.107.150.206
  47.107.164.148
-47.107.167.8
  47.107.174.142
  47.107.175.190
-47.107.228.241
+47.107.231.92
  47.107.244.98
  47.107.45.148
  47.107.61.8
  47.107.62.218
-47.107.85.50
  47.108.140.54
  47.108.156.129
  47.108.165.147
@@ -119246,6 +112917,7 @@
  47.108.30.126
  47.108.30.165
  47.108.30.250
+47.108.48.244
  47.108.50.199
  47.108.51.141
  47.108.56.153
@@ -119254,15 +112926,10 @@
  47.108.65.144
  47.108.78.200
  47.108.81.144
-47.110.126.60
  47.110.150.226
  47.110.225.78
  47.110.49.177
-47.110.53.174
-47.110.79.249
  47.110.92.146
-47.111.113.87
-47.111.138.217
  47.111.14.20
  47.111.161.245
  47.111.225.160
@@ -119277,9 +112944,8 @@
  47.113.201.83
  47.113.95.224
  47.114.103.210
-47.114.131.24
-47.114.34.227
-47.114.59.102
+47.114.47.245
+47.114.57.226
  47.114.72.158
  47.114.90.225
  47.114.96.237
@@ -119289,10 +112955,9 @@
  47.115.172.191
  47.115.52.118
  47.115.53.163
-47.12.55.24
-47.13.8.188
+47.13.140.15
+47.13.241.221
  47.134.135.148
-47.135.208.29
  47.144.81.151
  47.145.152.26
  47.146.117.214
@@ -119303,7 +112968,6 @@
  47.148.185.228
  47.148.89.148
  47.149.82.178
-47.149.9.231
  47.149.90.156
  47.149.93.97
  47.151.31.181
@@ -119320,7 +112984,6 @@
  47.16.77.171
  47.17.177.110
  47.17.187.4
-47.17.58.198
  47.176.104.74
  47.176.20.59
  47.176.38.242
@@ -119330,6 +112993,7 @@
  47.180.63.37
  47.180.66.139
  47.180.9.168
+47.184.16.2
  47.184.212.187
  47.184.48.254
  47.185.160.213
@@ -119341,17 +113005,15 @@
  47.187.116.17
  47.187.16.50
  47.187.241.113
-47.187.249.197
  47.187.26.135
+47.187.4.95
  47.187.7.210
-47.188.41.97
  47.188.43.153
  47.189.240.211
  47.19.54.70
  47.190.132.213
  47.190.19.75
  47.190.63.28
-47.190.81.83
  47.192.118.43
  47.196.131.158
  47.196.148.157
@@ -119368,52 +113030,43 @@
  47.203.93.167
  47.204.214.212
  47.205.14.119
-47.205.143.167
  47.208.246.213
  47.21.15.202
  47.21.202.98
  47.21.41.254
-47.21.81.122
-47.211.222.119
  47.215.235.204
  47.216.50.174
  47.217.122.253
  47.217.145.24
  47.217.23.156
  47.218.194.38
-47.22.82.8
-47.220.146.49
-47.220.237.106
  47.221.236.50
  47.221.44.74
  47.222.103.234
  47.223.138.176
  47.224.50.25
  47.225.11.69
+47.225.135.146
+47.226.34.87
  47.227.180.15
  47.227.226.242
  47.227.68.203
  47.23.4.36
  47.23.70.10
  47.233.102.157
-47.234.184.39
  47.234.210.235
  47.234.241.121
  47.24.129.216
+47.24.234.74
  47.240.230.87
-47.240.250.136
-47.240.41.43
  47.240.82.148
  47.241.0.210
-47.241.10.91
+47.241.104.189
  47.241.109.98
  47.241.128.140
-47.241.13.24
  47.241.15.209
-47.241.15.42
  47.241.21.95
  47.241.26.71
-47.241.28.63
  47.241.29.56
  47.241.33.14
  47.241.34.42
@@ -119422,10 +113075,7 @@
  47.241.63.146
  47.241.63.196
  47.241.7.129
-47.241.7.235
-47.241.7.69
  47.241.70.0
-47.241.74.84
  47.241.75.62
  47.242.0.178
  47.242.128.121
@@ -119435,6 +113085,7 @@
  47.242.165.238
  47.242.170.113
  47.242.19.155
+47.242.28.74
  47.242.30.91
  47.242.41.213
  47.242.52.179
@@ -119444,7 +113095,7 @@
  47.244.1.172
  47.244.107.89
  47.244.119.155
-47.244.137.178
+47.244.151.211
  47.244.166.23
  47.244.175.167
  47.244.184.204
@@ -119474,22 +113125,9 @@
  47.244.57.253
  47.244.9.128
  47.245.128.237
+47.245.28.237
  47.245.35.63
  47.245.56.186
-47.246.84.30
-47.252.14.19
-47.252.15.168
-47.252.19.69
-47.252.20.97
-47.252.22.10
-47.252.23.218
-47.252.23.27
-47.252.23.42
-47.252.24.104
-47.252.5.198
-47.252.6.200
-47.252.7.158
-47.252.7.35
  47.252.72.128
  47.252.73.221
  47.252.80.192
@@ -119505,39 +113143,32 @@
  47.254.145.104
  47.254.151.148
  47.254.151.241
-47.254.151.244
  47.254.170.214
  47.254.172.215
  47.254.173.87
  47.254.174.194
  47.254.174.39
-47.254.174.58
  47.254.177.13
  47.254.178.15
+47.254.193.127
  47.254.20.78
  47.254.20.82
  47.254.214.208
  47.254.215.132
-47.254.229.102
-47.254.233.204
-47.254.233.48
-47.254.238.40
+47.254.216.89
+47.254.234.70
  47.254.238.50
-47.254.251.250
  47.254.29.128
  47.254.47.38
-47.254.64.216
  47.254.73.32
+47.254.76.32
  47.254.77.228
-47.254.84.107
  47.254.93.177
  47.254.94.183
  47.254.95.196
  47.26.196.22
-47.26.94.181
  47.27.0.31
  47.32.155.207
-47.33.201.142
  47.34.128.25
  47.34.159.85
  47.34.164.211
@@ -119545,22 +113176,23 @@
  47.35.52.114
  47.36.140.164
  47.37.171.72
+47.37.27.8
  47.37.93.91
  47.38.77.194
  47.39.51.140
-47.40.109.79
+47.40.165.68
  47.41.203.241
  47.42.205.221
  47.44.26.10
  47.46.215.66
  47.46.34.39
+47.48.131.250
  47.49.12.165
  47.49.12.168
  47.49.12.169
  47.49.147.253
  47.49.171.19
  47.5.170.67
-47.5.200.127
  47.50.246.114
  47.51.161.235
  47.51.202.101
@@ -119571,6 +113203,7 @@
  47.52.128.231
  47.52.131.159
  47.52.134.197
+47.52.147.44
  47.52.152.69
  47.52.193.158
  47.52.201.10
@@ -119578,14 +113211,12 @@
  47.52.209.162
  47.52.211.53
  47.52.218.97
-47.52.223.57
  47.52.227.166
-47.52.229.116
  47.52.231.140
  47.52.232.24
+47.52.239.42
  47.52.28.179
  47.52.38.232
-47.52.39.76
  47.52.59.139
  47.52.61.250
  47.52.62.174
@@ -119593,17 +113224,12 @@
  47.52.68.110
  47.53.63.27
  47.53.73.136
-47.54.175.236
  47.54.211.232
  47.55.50.229
  47.56.132.105
  47.56.141.204
-47.56.154.54
  47.56.159.53
-47.56.16.178
-47.56.224.137
  47.56.231.218
-47.56.239.36
  47.56.251.168
  47.56.93.255
  47.57.124.34
@@ -119611,23 +113237,18 @@
  47.57.152.25
  47.57.162.76
  47.57.19.95
-47.57.4.203
  47.57.74.239
  47.57.88.124
-47.6.125.73
  47.6.15.79
-47.6.18.207
  47.6.85.252
  47.61.184.131
  47.62.242.1
+47.62.249.15
  47.63.239.154
  47.63.239.20
  47.63.46.67
  47.63.46.83
  47.7.114.234
-47.7.233.96
-47.72.128.205
-47.74.132.2
  47.74.148.237
  47.74.16.114
  47.74.175.100
@@ -119635,31 +113256,27 @@
  47.74.190.56
  47.74.20.131
  47.74.216.206
+47.74.220.148
  47.74.221.216
  47.74.221.8
  47.74.223.226
  47.74.228.168
  47.74.231.192
-47.74.234.121
  47.74.239.82
  47.74.240.108
  47.74.241.65
  47.74.242.64
  47.74.3.113
  47.74.32.13
-47.74.33.28
+47.74.32.199
  47.74.35.128
  47.74.35.143
-47.74.4.17
  47.74.44.224
  47.74.44.83
  47.74.48.159
  47.74.48.82
-47.74.48.89
  47.74.62.158
  47.74.70.72
-47.74.87.245
-47.74.89.138
  47.74.9.23
  47.75.1.243
  47.75.100.63
@@ -119671,22 +113288,20 @@
  47.75.15.2
  47.75.151.154
  47.75.154.176
-47.75.161.114
  47.75.167.17
  47.75.168.219
+47.75.175.59
  47.75.176.144
  47.75.178.149
  47.75.182.95
  47.75.184.180
  47.75.185.189
-47.75.186.204
-47.75.186.231
  47.75.187.146
  47.75.199.52
  47.75.2.225
  47.75.202.172
-47.75.204.149
  47.75.204.212
+47.75.205.246
  47.75.216.136
  47.75.221.20
  47.75.242.21
@@ -119695,20 +113310,18 @@
  47.75.42.179
  47.75.42.203
  47.75.42.226
+47.75.47.75
  47.75.48.133
  47.75.55.181
  47.75.7.170
  47.75.90.57
  47.75.96.85
  47.88.100.201
-47.88.104.105
-47.88.137.99
  47.88.148.177
-47.88.153.43
  47.88.153.61
  47.88.154.236
-47.88.155.195
  47.88.157.51
+47.88.159.100
  47.88.168.99
  47.88.17.25
  47.88.17.253
@@ -119717,6 +113330,7 @@
  47.88.245.100
  47.88.28.221
  47.88.50.157
+47.88.54.50
  47.88.7.18
  47.88.76.141
  47.88.79.207
@@ -119737,9 +113351,6 @@
  47.89.8.91
  47.90.0.38
  47.90.120.25
-47.90.202.34
-47.90.205.146
-47.90.243.190
  47.90.4.203
  47.90.43.18
  47.90.43.181
@@ -119750,42 +113361,36 @@
  47.91.106.208
  47.91.108.18
  47.91.124.172
+47.91.132.18
+47.91.156.40
  47.91.17.45
  47.91.178.158
  47.91.196.15
-47.91.196.238
  47.91.206.207
  47.91.215.113
  47.91.228.50
  47.91.239.118
  47.91.246.186
  47.91.253.239
-47.91.28.226
  47.91.29.241
  47.91.29.30
  47.91.77.103
  47.91.79.240
-47.91.86.181
  47.91.88.100
  47.91.89.32
  47.91.90.144
  47.91.92.101
-47.92.109.159
  47.92.109.48
  47.92.142.200
-47.92.147.81
  47.92.152.148
+47.92.162.8
  47.92.166.137
  47.92.198.58
-47.92.2.95
  47.92.204.240
  47.92.212.252
-47.92.228.155
  47.92.245.97
-47.92.252.40
  47.92.78.176
  47.92.79.85
-47.92.84.235
  47.92.90.12
  47.92.94.125
  47.93.100.59
@@ -119797,6 +113402,7 @@
  47.93.230.171
  47.93.244.101
  47.93.247.22
+47.93.29.190
  47.93.4.61
  47.93.96.145
  47.94.1.121
@@ -119809,7 +113415,6 @@
  47.94.196.118
  47.94.200.124
  47.94.215.35
-47.94.233.182
  47.94.242.18
  47.94.243.77
  47.94.41.69
@@ -119827,25 +113432,21 @@
  47.96.119.168
  47.96.144.102
  47.96.148.248
-47.96.148.67
-47.96.160.85
  47.96.176.154
  47.96.224.198
  47.96.234.249
  47.96.5.37
  47.96.84.84
-47.97.153.92
+47.97.190.222
  47.97.204.57
  47.97.221.68
  47.97.40.162
-47.97.5.57
  47.98.102.8
  47.98.114.56
  47.98.116.160
  47.98.138.84
-47.98.154.150
  47.98.166.130
-47.98.174.176
+47.98.170.47
  47.98.190.243
  47.98.192.141
  47.98.241.235
@@ -119858,6 +113459,7 @@
  47.99.151.81
  47.99.158.238
  47.99.65.77
+47.99.82.168
  470365365.com
  4715.3190cfdae.com
  471511113115611.002.sh.cn
@@ -119928,14 +113530,15 @@
  49.115.97.206
  49.115.98.124
  49.116.176.46
-49.116.179.90
  49.116.182.64
  49.116.183.175
  49.116.183.36
  49.116.197.233
  49.116.205.198
+49.116.212.210
  49.116.212.39
  49.116.214.38
+49.116.222.197
  49.116.32.150
  49.116.35.221
  49.116.71.58
@@ -119947,6 +113550,7 @@
  49.119.213.167
  49.119.213.174
  49.119.56.2
+49.119.59.3
  49.119.61.14
  49.119.63.134
  49.119.78.23
@@ -119969,22 +113573,19 @@
  49.128.181.229
  49.128.60.248
  49.130.62.72
-49.135.34.209
-49.135.40.5
+49.130.90.183
  49.135.42.48
-49.14.109.104
+49.135.43.113
+49.135.45.84
  49.142.102.191
  49.142.184.126
  49.142.35.90
  49.142.41.204
  49.142.82.60
-49.143.0.155
-49.143.0.17
  49.143.0.215
  49.143.142.56
  49.143.147.248
  49.143.150.189
-49.143.160.150
  49.143.174.156
  49.143.180.41
  49.143.180.89
@@ -120023,16 +113624,17 @@
  49.143.75.9
  49.143.93.171
  49.144.7.160
+49.145.104.103
  49.145.105.98
+49.145.171.23
  49.145.226.213
+49.146.34.99
  49.147.204.192
-49.149.133.100
+49.147.207.116
  49.149.133.99
-49.149.174.109
  49.149.45.236
  49.149.76.155
  49.150.228.59
-49.150.73.50
  49.151.49.196
  49.156.149.190
  49.156.149.218
@@ -120043,10 +113645,10 @@
  49.156.152.242
  49.156.35.202
  49.156.35.22
+49.156.41.74
  49.156.44.138
  49.156.45.181
  49.156.47.61
-49.156.53.17
  49.156.83.9
  49.156.93.250
  49.156.97.124
@@ -120066,7 +113668,6 @@
  49.158.44.191
  49.158.44.196
  49.158.44.4
-49.158.46.58
  49.158.52.148
  49.158.54.2
  49.158.97.22
@@ -120086,7 +113687,7 @@
  49.164.200.31
  49.164.46.64
  49.165.150.146
-49.165.96.21
+49.166.102.28
  49.166.153.89
  49.168.114.77
  49.168.58.33
@@ -120094,6 +113695,7 @@
  49.169.52.18
  49.169.52.8
  49.172.168.113
+49.172.19.28
  49.172.2.235
  49.172.35.112
  49.173.53.167
@@ -120107,12 +113709,11 @@
  49.195.105.206
  49.204.129.163
  49.205.177.150
-49.205.217.245
  49.206.121.76
+49.206.193.67
  49.206.228.138
  49.206.244.236
  49.206.26.9
-49.207.132.34
  49.207.140.81
  49.207.193.68
  49.207.199.193
@@ -120121,7 +113722,6 @@
  49.212.128.149
  49.212.151.222
  49.212.179.58
-49.212.43.150
  49.213.162.148
  49.213.162.208
  49.213.163.106
@@ -120178,6 +113778,8 @@
  49.213.226.13
  49.213.232.97
  49.224.143.241
+49.228.140.70
+49.228.184.215
  49.228.78.114
  49.229.69.4
  49.229.73.214
@@ -120185,10 +113787,8 @@
  49.231.146.68
  49.231.166.197
  49.231.182.30
-49.231.201.242
  49.231.219.197
  49.231.238.162
-49.231.35.39
  49.231.66.20
  49.232.100.132
  49.232.100.177
@@ -120196,7 +113796,6 @@
  49.232.101.38
  49.232.104.219
  49.232.105.118
-49.232.106.176
  49.232.106.184
  49.232.109.242
  49.232.11.17
@@ -120204,26 +113803,19 @@
  49.232.111.165
  49.232.115.233
  49.232.12.37
-49.232.130.25
-49.232.131.80
-49.232.132.10
  49.232.133.186
  49.232.134.70
-49.232.135.102
-49.232.135.14
  49.232.136.90
  49.232.139.234
  49.232.14.144
  49.232.14.216
  49.232.143.159
-49.232.145.174
-49.232.145.175
-49.232.145.201
  49.232.147.37
  49.232.148.100
  49.232.148.45
  49.232.152.23
  49.232.152.94
+49.232.153.45
  49.232.155.196
  49.232.157.17
  49.232.157.35
@@ -120232,28 +113824,20 @@
  49.232.16.47
  49.232.160.215
  49.232.161.124
-49.232.161.243
-49.232.161.5
-49.232.162.235
  49.232.162.53
-49.232.162.77
  49.232.163.163
  49.232.163.40
  49.232.164.192
  49.232.166.136
-49.232.166.190
-49.232.167.41
+49.232.166.221
  49.232.17.254
-49.232.171.28
  49.232.171.31
  49.232.171.88
  49.232.172.154
  49.232.172.20
-49.232.172.244
  49.232.172.85
  49.232.173.147
  49.232.174.142
-49.232.174.219
  49.232.191.244
  49.232.191.67
  49.232.192.222
@@ -120264,7 +113848,6 @@
  49.232.194.80
  49.232.196.115
  49.232.198.139
-49.232.199.15
  49.232.199.226
  49.232.2.249
  49.232.202.58
@@ -120282,10 +113865,7 @@
  49.232.24.10
  49.232.247.107
  49.232.26.148
-49.232.27.254
-49.232.28.199
  49.232.28.38
-49.232.28.79
  49.232.29.120
  49.232.29.152
  49.232.3.125
@@ -120294,29 +113874,17 @@
  49.232.39.21
  49.232.41.237
  49.232.42.135
-49.232.42.150
-49.232.43.151
  49.232.43.192
-49.232.45.64
-49.232.48.129
-49.232.5.122
-49.232.5.150
  49.232.5.171
-49.232.5.230
  49.232.5.66
  49.232.50.87
  49.232.51.103
-49.232.51.149
-49.232.52.142
  49.232.56.88
-49.232.58.113
  49.232.58.114
  49.232.59.246
  49.232.6.28
-49.232.63.206
  49.232.63.9
  49.232.66.173
-49.232.69.39
  49.232.7.169
  49.232.70.166
  49.232.71.199
@@ -120327,117 +113895,68 @@
  49.232.8.218
  49.232.82.76
  49.232.83.75
-49.232.86.244
-49.232.87.117
  49.232.87.218
  49.232.92.76
  49.232.99.178
  49.232.99.75
-49.233.10.41
  49.233.105.223
-49.233.105.41
  49.233.105.63
-49.233.108.195
  49.233.11.112
  49.233.11.118
-49.233.111.156
  49.233.111.193
  49.233.117.199
-49.233.119.183
  49.233.119.93
  49.233.12.104
-49.233.12.108
  49.233.12.186
-49.233.12.222
  49.233.122.40
  49.233.13.130
-49.233.13.145
-49.233.13.182
  49.233.130.37
  49.233.130.95
-49.233.134.252
-49.233.135.204
-49.233.136.245
  49.233.137.3
-49.233.139.218
  49.233.14.115
  49.233.14.149
  49.233.14.194
  49.233.14.36
-49.233.140.233
-49.233.144.153
  49.233.144.220
-49.233.147.108
-49.233.147.147
  49.233.147.188
-49.233.148.2
  49.233.15.54
  49.233.153.154
  49.233.153.71
-49.233.155.170
-49.233.159.65
  49.233.16.90
  49.233.160.103
-49.233.162.198
  49.233.162.222
-49.233.163.45
-49.233.164.146
  49.233.165.151
-49.233.166.113
  49.233.166.251
  49.233.168.100
-49.233.169.219
-49.233.170.155
-49.233.172.85
  49.233.173.136
  49.233.173.90
  49.233.177.166
  49.233.177.173
-49.233.177.19
-49.233.177.197
  49.233.177.99
-49.233.180.151
  49.233.180.165
-49.233.180.231
  49.233.180.38
-49.233.182.23
  49.233.183.15
  49.233.185.244
-49.233.185.63
  49.233.186.174
  49.233.186.66
  49.233.189.161
  49.233.189.200
-49.233.19.100
-49.233.190.94
  49.233.192.144
-49.233.192.22
  49.233.195.154
  49.233.196.120
-49.233.197.193
  49.233.199.240
  49.233.200.37
  49.233.202.149
  49.233.202.231
-49.233.202.62
  49.233.204.226
  49.233.204.30
  49.233.204.37
-49.233.205.82
-49.233.208.40
-49.233.208.45
  49.233.209.89
-49.233.21.163
-49.233.211.111
-49.233.212.117
  49.233.212.154
  49.233.212.66
  49.233.213.214
  49.233.214.16
-49.233.214.188
  49.233.216.158
-49.233.221.143
-49.233.24.148
  49.233.25.89
  49.233.26.110
  49.233.27.153
@@ -120446,7 +113965,6 @@
  49.233.30.125
  49.233.30.96
  49.233.31.121
-49.233.32.106
  49.233.32.245
  49.233.34.5
  49.233.34.9
@@ -120454,7 +113972,6 @@
  49.233.4.143
  49.233.42.217
  49.233.42.247
-49.233.46.219
  49.233.47.104
  49.233.50.154
  49.233.51.43
@@ -120466,44 +113983,23 @@
  49.233.58.73
  49.233.60.69
  49.233.68.90
-49.233.69.121
  49.233.69.138
  49.233.69.250
-49.233.7.27
-49.233.70.228
-49.233.72.213
-49.233.72.72
  49.233.74.239
  49.233.75.234
-49.233.75.31
  49.233.77.12
  49.233.79.152
  49.233.79.168
-49.233.80.126
-49.233.80.135
  49.233.80.20
-49.233.81.2
-49.233.83.35
  49.233.84.191
-49.233.84.59
-49.233.85.15
  49.233.85.167
-49.233.87.163
-49.233.88.126
-49.233.88.248
-49.233.88.50
-49.233.89.111
  49.233.89.163
-49.233.90.108
  49.233.90.200
-49.233.90.66
  49.233.90.8
  49.233.91.148
  49.233.92.134
  49.233.92.166
-49.233.92.34
-49.234.10.207
-49.234.10.48
+49.234.100.133
  49.234.100.188
  49.234.100.201
  49.234.100.95
@@ -120519,16 +114015,12 @@
  49.234.111.57
  49.234.113.72
  49.234.114.62
-49.234.115.143
  49.234.116.74
  49.234.117.66
  49.234.119.42
  49.234.120.32
-49.234.122.94
-49.234.123.171
  49.234.124.196
  49.234.124.225
-49.234.126.177
  49.234.126.35
  49.234.127.168
  49.234.131.117
@@ -120539,9 +114031,7 @@
  49.234.14.216
  49.234.143.24
  49.234.145.57
-49.234.147.154
  49.234.149.92
-49.234.15.91
  49.234.150.126
  49.234.150.129
  49.234.155.82
@@ -120553,32 +114043,22 @@
  49.234.18.158
  49.234.182.55
  49.234.182.99
-49.234.189.19
  49.234.189.22
  49.234.190.140
  49.234.192.145
-49.234.192.24
-49.234.192.39
  49.234.195.122
-49.234.196.215
  49.234.201.237
-49.234.203.5
  49.234.205.249
  49.234.205.32
-49.234.206.45
  49.234.208.46
  49.234.21.219
-49.234.212.177
-49.234.213.237
  49.234.214.156
  49.234.214.42
  49.234.214.88
  49.234.215.135
-49.234.216.52
  49.234.218.254
  49.234.219.31
  49.234.221.104
-49.234.222.49
  49.234.223.86
  49.234.224.105
  49.234.224.134
@@ -120590,7 +114070,6 @@
  49.234.230.31
  49.234.230.86
  49.234.232.164
-49.234.233.164
  49.234.235.127
  49.234.236.123
  49.234.236.161
@@ -120599,12 +114078,10 @@
  49.234.24.193
  49.234.24.246
  49.234.25.198
-49.234.25.70
  49.234.25.89
  49.234.27.90
  49.234.28.148
  49.234.30.113
-49.234.30.19
  49.234.31.121
  49.234.32.74
  49.234.33.229
@@ -120612,14 +114089,10 @@
  49.234.41.108
  49.234.42.108
  49.234.43.127
-49.234.43.173
  49.234.43.224
-49.234.43.34
  49.234.43.39
  49.234.45.241
  49.234.47.124
-49.234.48.32
-49.234.5.62
  49.234.50.235
  49.234.50.247
  49.234.51.251
@@ -120627,19 +114100,17 @@
  49.234.52.166
  49.234.52.176
  49.234.53.92
-49.234.56.65
  49.234.57.117
+49.234.58.233
  49.234.59.44
  49.234.60.118
-49.234.61.180
  49.234.61.76
  49.234.64.188
-49.234.65.157
  49.234.68.42
  49.234.69.205
  49.234.7.37
+49.234.70.189
  49.234.70.67
-49.234.72.122
  49.234.73.105
  49.234.76.124
  49.234.76.44
@@ -120649,13 +114120,10 @@
  49.234.79.129
  49.234.80.94
  49.234.81.14
-49.234.81.49
  49.234.82.73
-49.234.83.64
  49.234.84.213
  49.234.86.87
  49.234.87.24
-49.234.88.160
  49.234.90.80
  49.234.91.78
  49.234.92.108
@@ -120666,19 +114134,14 @@
  49.234.96.173
  49.234.96.210
  49.234.96.30
-49.234.98.56
  49.234.99.208
  49.234.99.246
  49.235.1.23
-49.235.10.240
  49.235.100.147
-49.235.100.58
  49.235.103.191
  49.235.104.133
  49.235.104.204
  49.235.107.186
-49.235.108.183
-49.235.109.205
  49.235.109.216
  49.235.11.137
  49.235.110.143
@@ -120694,18 +114157,14 @@
  49.235.124.31
  49.235.125.17
  49.235.128.105
-49.235.132.42
  49.235.132.88
  49.235.133.208
  49.235.133.228
-49.235.134.224
-49.235.134.46
  49.235.134.94
  49.235.135.230
  49.235.136.49
  49.235.136.89
  49.235.137.210
-49.235.138.168
  49.235.141.203
  49.235.141.55
  49.235.142.96
@@ -120713,121 +114172,78 @@
  49.235.144.143
  49.235.146.95
  49.235.147.85
-49.235.149.108
-49.235.151.50
-49.235.153.179
  49.235.153.220
  49.235.153.54
  49.235.154.66
  49.235.159.133
-49.235.16.103
-49.235.161.88
-49.235.162.132
  49.235.163.198
  49.235.164.107
  49.235.165.125
  49.235.167.59
-49.235.169.15
  49.235.169.195
-49.235.170.200
  49.235.172.41
  49.235.175.12
  49.235.175.24
-49.235.176.141
  49.235.178.150
  49.235.181.51
-49.235.186.109
  49.235.187.253
  49.235.190.177
  49.235.191.194
-49.235.193.207
  49.235.195.249
  49.235.196.250
  49.235.197.123
  49.235.199.42
  49.235.203.22
-49.235.203.242
  49.235.204.120
-49.235.204.59
  49.235.206.172
  49.235.206.24
-49.235.206.30
  49.235.207.127
-49.235.207.154
-49.235.208.246
-49.235.211.254
  49.235.213.170
-49.235.216.107
-49.235.216.127
-49.235.219.230
  49.235.221.172
  49.235.221.66
-49.235.222.191
-49.235.226.166
  49.235.226.192
  49.235.226.50
  49.235.227.17
-49.235.229.211
  49.235.229.226
-49.235.23.20
  49.235.230.136
  49.235.233.171
  49.235.233.189
-49.235.233.73
  49.235.234.186
-49.235.239.146
  49.235.239.238
  49.235.24.123
  49.235.24.207
-49.235.240.105
-49.235.240.141
-49.235.240.21
  49.235.240.251
  49.235.241.211
-49.235.244.115
-49.235.244.227
  49.235.247.198
-49.235.249.185
  49.235.25.117
  49.235.250.113
  49.235.250.156
  49.235.250.94
  49.235.251.162
  49.235.251.241
-49.235.251.53
  49.235.252.236
  49.235.252.43
  49.235.253.61
  49.235.253.75
  49.235.254.16
  49.235.255.186
+49.235.26.232
  49.235.26.37
  49.235.28.96
-49.235.29.226
  49.235.29.59
  49.235.31.168
-49.235.31.77
  49.235.34.147
-49.235.35.133
  49.235.35.65
-49.235.37.232
  49.235.38.46
-49.235.39.217
  49.235.39.232
  49.235.41.58
-49.235.41.95
-49.235.46.18
  49.235.61.192
-49.235.62.81
-49.235.64.147
-49.235.64.36
+49.235.62.91
  49.235.65.73
  49.235.66.14
-49.235.66.32
  49.235.69.80
  49.235.7.60
  49.235.70.92
-49.235.73.150
  49.235.73.19
  49.235.73.82
  49.235.74.168
@@ -120836,26 +114252,17 @@
  49.235.74.82
  49.235.74.86
  49.235.75.158
-49.235.75.19
  49.235.75.232
  49.235.76.77
-49.235.76.84
  49.235.78.54
  49.235.83.108
-49.235.83.156
  49.235.84.101
-49.235.85.117
  49.235.86.34
  49.235.87.70
  49.235.89.99
  49.235.9.47
-49.235.90.166
  49.235.90.244
-49.235.90.32
-49.235.91.145
  49.235.91.35
-49.235.92.208
-49.235.93.192
  49.235.93.34
  49.235.93.87
  49.235.94.136
@@ -120863,54 +114270,46 @@
  49.235.95.38
  49.235.96.146
  49.235.98.68
-49.235.99.215
  49.236.192.13
  49.236.192.136
  49.236.193.70
-49.236.195.150
  49.236.214.166
  49.238.142.12
  49.245.120.242
  49.245.121.144
  49.245.17.152
+49.245.26.80
  49.245.30.212
  49.245.51.223
  49.245.9.231
  49.245.93.188
  49.245.93.79
-49.246.115.248
  49.246.115.41
+49.246.3.246
  49.246.80.34
  49.247.135.55
  49.247.19.204
-49.247.193.105
-49.247.196.128
  49.247.204.78
  49.247.208.185
-49.247.21.169
  49.247.211.113
  49.247.213.18
-49.247.214.61
  49.247.215.43
+49.247.24.0
+49.247.24.96
  49.248.106.61
  49.248.109.74
  49.248.141.14
  49.248.148.165
-49.248.215.5
-49.248.3.10
  49.248.32.110
  49.248.84.138
-49.249.232.74
  49.249.237.226
  49.249.239.198
-49.255.35.114
  49.255.93.10
  49.3.20.161
  49.3.224.99
  49.3.44.137
-49.36.39.18
-49.36.43.172
  49.36.6.64
+49.36.7.32
  49.37.141.72
  49.37.150.15
  49.37.217.158
@@ -120918,7 +114317,6 @@
  49.4.31.138
  49.4.4.72
  49.48.33.168
-49.48.92.113
  49.49.193.84
  49.5.14.242
  49.50.105.62
@@ -121026,8 +114424,7 @@
  49.64.15.14
  49.64.158.5
  49.64.176.51
-49.64.211.109
-49.65.1.134
+49.64.32.184
  49.65.187.1
  49.65.234.216
  49.65.235.79
@@ -121049,10 +114446,8 @@
  49.68.131.148
  49.68.131.194
  49.68.131.71
-49.68.135.158
  49.68.145.177
-49.68.145.80
-49.68.146.242
+49.68.146.34
  49.68.147.111
  49.68.147.54
  49.68.151.194
@@ -121067,6 +114462,7 @@
  49.68.207.139
  49.68.207.198
  49.68.210.112
+49.68.211.238
  49.68.212.86
  49.68.213.49
  49.68.221.151
@@ -121080,7 +114476,6 @@
  49.68.233.212
  49.68.234.25
  49.68.235.19
-49.68.235.70
  49.68.236.50
  49.68.239.114
  49.68.241.132
@@ -121144,20 +114539,18 @@
  49.72.124.85
  49.72.207.3
  49.72.212.22
-49.72.51.199
  49.72.53.130
  49.73.235.149
  49.73.237.127
  49.73.76.177
  49.73.84.175
  49.74.105.153
+49.74.105.175
  49.74.219.26
  49.74.81.13
-49.75.111.97
-49.75.59.161
+49.75.129.214
  49.76.11.253
  49.76.55.60
-49.77.183.66
  49.77.58.72
  49.77.58.97
  49.77.59.206
@@ -121165,10 +114558,9 @@
  49.80.105.209
  49.80.107.212
  49.80.122.175
-49.80.99.107
-49.80.99.231
-49.80.99.48
+49.80.99.149
  49.81.100.163
+49.81.101.237
  49.81.102.69
  49.81.103.42
  49.81.103.62
@@ -121192,6 +114584,7 @@
  49.81.253.7
  49.81.31.126
  49.81.40.151
+49.81.44.252
  49.81.47.122
  49.81.47.189
  49.81.48.99
@@ -121210,6 +114603,7 @@
  49.82.14.78
  49.82.192.122
  49.82.200.238
+49.82.205.125
  49.82.212.34
  49.82.213.160
  49.82.222.107
@@ -121231,10 +114625,10 @@
  49.85.179.51
  49.85.226.163
  49.85.54.87
+49.85.96.185
  49.86.76.68
  49.86.77.124
  49.87.123.82
-49.87.171.112
  49.87.201.232
  49.87.250.42
  49.87.46.40
@@ -121246,12 +114640,14 @@
  49.88.112.113
  49.88.112.115
  49.88.112.60
+49.88.112.65
  49.88.112.68
  49.88.112.69
  49.88.112.70
  49.88.112.72
  49.88.112.73
  49.88.112.75
+49.88.112.76
  49.88.112.77
  49.88.115.6
  49.88.121.163
@@ -121261,9 +114657,10 @@
  49.88.222.145
  49.88.234.66
  49.88.63.19
+49.88.64.39
+49.88.67.130
  49.89.103.106
  49.89.115.124
-49.89.128.140
  49.89.137.129
  49.89.137.242
  49.89.137.7
@@ -121342,6 +114739,7 @@
  4e44fa06b81c.ngrok.io
  4e76363340283f5a51a7a038273b2b34-dot-dbenitonline.ey.r.appspot.com
  4efa7aed6eaefc9b1ac13e.xyz
+4efa7aed6eaefc9b1ac14e.xyz
  4efa7aed6eaefc9b1ac8e.xyz
  4elements.es
  4eomkeale.s3-ap-northeast-1.amazonaws.com
@@ -121355,6 +114753,7 @@
  4freemovie.gq
  4g-paypal.com
  4g7po.codesandbox.io
+4gbinternethediye.xyz
  4ghandloom.com
  4glory.net
  4gq3tkuok7dzmo6ek1ejqm.creativetutors.com
@@ -121449,14 +114848,13 @@
  5.1.34.90
  5.1.53.46
  5.10.206.195
+5.10.54.127
  5.10.68.248
  5.10.76.30
  5.10.8.44
-5.100.131.211
-5.100.142.254
+5.100.140.126
  5.100.228.206
  5.100.231.237
-5.101.107.183
  5.101.107.190
  5.101.119.90
  5.101.123.24
@@ -121479,6 +114877,7 @@
  5.102.193.168
  5.102.203.152
  5.102.205.76
+5.102.225.145
  5.102.239.208
  5.102.242.91
  5.102.246.190
@@ -121500,14 +114899,13 @@
  5.105.138.40
  5.105.194.192
  5.105.63.108
+5.107.161.223
  5.109.108.84
  5.109.247.91
  5.11.136.208
  5.11.176.55
  5.11.219.241
  5.11.36.57
-5.115.57.184
-5.12.102.97
  5.12.119.215
  5.12.183.152
  5.12.3.136
@@ -121522,7 +114920,6 @@
  5.13.120.117
  5.13.146.187
  5.130.168.9
-5.132.98.251
  5.133.11.116
  5.133.11.117
  5.133.11.118
@@ -121534,7 +114931,6 @@
  5.133.65.82
  5.134.61.34
  5.134.70.109
-5.135.101.228
  5.135.120.247
  5.135.123.36
  5.135.123.38
@@ -121542,16 +114938,12 @@
  5.135.14.247
  5.135.154.68
  5.135.156.68
+5.135.159.65
  5.135.160.228
  5.135.161.7
  5.135.164.201
-5.135.164.227
-5.135.165.51
-5.135.165.55
  5.135.166.43
-5.135.169.130
  5.135.174.215
-5.135.176.163
  5.135.176.208
  5.135.177.202
  5.135.177.5
@@ -121564,15 +114956,13 @@
  5.135.183.232
  5.135.183.49
  5.135.184.46
-5.135.185.27
  5.135.186.15
-5.135.186.52
  5.135.189.124
  5.135.199.2
  5.135.199.29
-5.135.224.151
  5.135.23.3
  5.135.237.216
+5.135.238.217
  5.135.34.152
  5.135.65.145
  5.135.72.184
@@ -121580,15 +114970,15 @@
  5.135.94.191
  5.136.231.106
  5.137.10.210
-5.137.112.199
  5.137.134.119
+5.137.15.41
  5.137.226.67
  5.137.241.92
  5.137.246.33
+5.138.158.136
  5.138.173.24
  5.138.220.125
  5.138.239.162
-5.138.243.31
  5.138.3.194
  5.14.114.35
  5.14.146.130
@@ -121611,7 +115001,7 @@
  5.141.29.137
  5.141.80.242
  5.141.81.106
-5.141.86.107
+5.143.65.235
  5.143.93.69
  5.144.130.12
  5.144.176.130
@@ -121623,12 +115013,13 @@
  5.144.90.27
  5.144.91.21
  5.145.10.122
-5.146.192.127
-5.146.192.134
-5.146.192.140
-5.146.192.162
+5.146.192.149
+5.146.192.158
+5.146.192.161
+5.146.192.164
  5.147.153.51
-5.147.98.84
+5.147.156.59
+5.147.97.159
  5.148.122.130
  5.148.188.179
  5.148.32.227
@@ -121640,7 +115031,6 @@
  5.149.254.109
  5.149.254.67
  5.149.64.194
-5.149.94.177
  5.15.147.94
  5.15.150.212
  5.15.58.64
@@ -121652,19 +115042,20 @@
  5.150.236.83
  5.150.239.205
  5.150.240.82
+5.150.249.254
  5.151.118.100
  5.151.118.159
  5.151.118.213
  5.152.0.128
  5.152.0.200
  5.152.0.210
-5.152.148.141
  5.152.158.4
  5.152.159.31
  5.152.171.152
  5.152.203.117
  5.152.203.118
  5.152.206.196
+5.152.207.100
  5.152.207.195
  5.152.222.99
  5.153.140.179
@@ -121685,18 +115076,20 @@
  5.157.104.252
  5.157.105.89
  5.157.123.232
+5.157.14.109
  5.157.14.253
  5.157.16.74
  5.157.17.61
  5.157.19.136
-5.157.19.157
-5.157.19.170
+5.157.19.147
+5.157.19.165
  5.157.19.183
  5.157.19.2
  5.157.19.243
  5.157.19.254
  5.157.19.38
  5.157.19.69
+5.157.26.235
  5.157.26.248
  5.157.27.127
  5.157.27.60
@@ -121709,18 +115102,13 @@
  5.157.43.186
  5.157.43.30
  5.157.5.114
-5.157.5.135
+5.157.5.117
  5.157.5.155
-5.157.5.225
-5.157.5.232
  5.157.52.147
  5.157.56.55
  5.157.56.62
  5.157.58.118
  5.157.7.35
-5.157.8.146
-5.157.8.183
-5.157.8.190
  5.158.123.153
  5.158.187.169
  5.158.236.116
@@ -121734,6 +115122,7 @@
  5.16.13.38
  5.160.103.202
  5.160.103.50
+5.160.110.116
  5.160.111.103
  5.160.111.157
  5.160.111.60
@@ -121741,10 +115130,9 @@
  5.160.122.86
  5.160.130.205
  5.160.131.207
+5.160.173.189
  5.160.178.142
  5.160.185.90
-5.160.240.203
-5.160.240.69
  5.160.243.112
  5.160.243.115
  5.160.243.142
@@ -121780,6 +115168,7 @@
  5.165.7.165
  5.165.73.230
  5.165.87.199
+5.166.172.190
  5.166.235.209
  5.166.245.63
  5.166.53.231
@@ -123837,8 +117226,8 @@
  5.17.89.13
  5.172.17.90
  5.172.204.194
-5.172.232.32
  5.175.225.107
+5.175.40.57
  5.175.74.113
  5.178.135.226
  5.178.193.43
@@ -123847,29 +117236,31 @@
  5.178.68.215
  5.178.68.221
  5.18.252.15
-5.180.150.193
  5.180.150.238
  5.180.211.73
+5.180.220.101
  5.180.220.107
  5.180.220.124
-5.180.220.125
-5.180.220.130
+5.180.220.149
  5.180.220.16
-5.180.220.160
  5.180.220.166
+5.180.220.172
  5.180.220.178
  5.180.220.190
-5.180.220.220
-5.180.220.65
+5.180.220.196
+5.180.220.53
+5.180.220.76
  5.180.220.82
  5.180.246.122
  5.180.246.126
+5.180.246.242
  5.180.247.160
  5.180.78.156
  5.181.135.190
  5.181.156.106
  5.181.156.226
  5.181.156.240
+5.181.156.5
  5.181.170.229
  5.181.171.116
  5.181.171.190
@@ -123878,9 +117269,7 @@
  5.181.238.5
  5.181.4.201
  5.181.4.247
-5.181.51.114
  5.181.93.140
-5.182.141.61
  5.182.209.102
  5.182.209.115
  5.182.209.147
@@ -123905,16 +117294,16 @@
  5.182.245.36
  5.182.26.126
  5.182.26.129
-5.182.32.223
  5.182.39.17
  5.183.200.70
+5.183.253.102
  5.183.253.13
  5.183.253.155
+5.183.253.16
  5.183.253.164
  5.183.253.179
-5.183.253.184
-5.183.253.192
  5.183.253.204
+5.183.253.212
  5.183.253.250
  5.183.253.85
  5.183.253.98
@@ -123926,25 +117315,27 @@
  5.183.92.139
  5.183.92.140
  5.183.92.145
+5.183.92.146
  5.183.92.158
-5.183.92.163
+5.183.92.175
+5.183.92.193
+5.183.92.199
  5.183.92.235
  5.183.92.32
  5.183.92.37
  5.183.92.38
  5.183.92.44
-5.183.92.56
+5.183.92.62
  5.183.92.67
  5.183.92.74
+5.183.92.86
  5.183.93.14
  5.183.94.27
  5.185.66.236
  5.186.57.163
  5.186.60.13
-5.187.21.13
  5.187.55.242
  5.187.69.208
-5.187.7.67
  5.187.70.110
  5.187.75.16
  5.187.75.183
@@ -123953,13 +117344,11 @@
  5.188.11.114
  5.188.11.115
  5.188.11.165
-5.188.114.146
  5.188.118.119
  5.188.118.120
  5.188.118.40
  5.188.159.48
  5.188.168.127
-5.188.206.0
  5.188.206.201
  5.188.206.211
  5.188.206.38
@@ -123974,14 +117363,17 @@
  5.188.210.226
  5.188.210.245
  5.188.210.46
+5.188.210.5
  5.188.210.59
  5.188.210.63
-5.188.210.8
  5.188.210.84
  5.188.211.10
+5.188.211.15
+5.188.211.16
  5.188.211.21
  5.188.211.24
  5.188.211.46
+5.188.216.100
  5.188.216.119
  5.188.216.156
  5.188.216.197
@@ -123994,17 +117386,23 @@
  5.188.217.125
  5.188.217.223
  5.188.217.244
+5.188.217.247
  5.188.218.24
+5.188.219.175
  5.188.219.196
  5.188.231.10
  5.188.231.44
  5.188.33.194
  5.188.35.57
-5.188.35.74
-5.188.35.75
-5.188.35.76
+5.188.35.61
+5.188.35.71
+5.188.35.72
  5.188.35.78
-5.188.4.165
+5.188.39.131
+5.188.39.133
+5.188.39.134
+5.188.39.136
+5.188.39.139
  5.188.48.5
  5.188.48.7
  5.188.56.53
@@ -124013,8 +117411,8 @@
  5.188.56.60
  5.188.62.140
  5.188.62.147
+5.188.62.174
  5.188.62.179
-5.188.62.214
  5.188.62.24
  5.188.62.33
  5.188.84.115
@@ -124049,6 +117447,7 @@
  5.189.130.21
  5.189.130.228
  5.189.130.92
+5.189.131.153
  5.189.132.254
  5.189.133.231
  5.189.135.139
@@ -124067,7 +117466,6 @@
  5.189.149.2
  5.189.150.245
  5.189.151.183
-5.189.153.240
  5.189.154.139
  5.189.156.185
  5.189.158.174
@@ -124101,47 +117499,42 @@
  5.19.173.178
  5.19.249.126
  5.19.253.43
+5.190.141.13
  5.190.187.191
-5.190.189.224
  5.190.189.72
  5.190.209.3
  5.190.213.116
+5.190.227.253
  5.190.243.147
-5.190.81.154
  5.190.81.27
  5.194.187.106
  5.195.224.127
+5.196.100.210
  5.196.101.213
  5.196.102.147
  5.196.110.170
  5.196.114.196
  5.196.117.224
-5.196.121.32
  5.196.121.87
  5.196.127.124
  5.196.148.75
-5.196.162.140
  5.196.167.44
  5.196.184.114
  5.196.195.139
  5.196.198.147
  5.196.215.231
-5.196.218.152
  5.196.218.24
-5.196.225.45
+5.196.23.219
  5.196.255.171
  5.196.27.37
  5.196.29.108
  5.196.35.138
-5.196.38.14
  5.196.54.15
  5.196.55.201
  5.196.58.96
  5.196.59.57
  5.196.63.113
-5.196.63.250
  5.196.64.109
-5.196.64.61
  5.196.65.141
  5.196.68.118
  5.196.68.145
@@ -124152,8 +117545,8 @@
  5.196.72.11
  5.196.72.70
  5.196.73.52
-5.196.74.23
  5.196.75.140
+5.196.75.178
  5.196.75.208
  5.196.75.231
  5.196.75.47
@@ -124164,10 +117557,10 @@
  5.196.82.5
  5.196.82.7
  5.196.83.78
+5.196.83.88
  5.196.88.214
  5.196.89.154
  5.196.89.191
-5.196.94.193
  5.196.95.80
  5.197.6.136
  5.199.130.127
@@ -124176,12 +117569,12 @@
  5.199.143.127
  5.199.171.58
  5.199.211.197
+5.199.236.193
  5.2.131.11
  5.2.137.13
  5.2.143.3
  5.2.147.208
  5.2.155.101
-5.2.160.174
  5.2.164.75
  5.2.180.254
  5.2.188.23
@@ -124192,6 +117585,7 @@
  5.2.249.195
  5.2.67.229
  5.2.70.145
+5.2.70.147
  5.2.72.101
  5.2.72.110
  5.2.72.113
@@ -124229,8 +117623,6 @@
  5.202.240.5
  5.202.242.134
  5.202.242.93
-5.202.243.163
-5.202.245.158
  5.202.40.236
  5.202.45.134
  5.202.45.213
@@ -124239,16 +117631,15 @@
  5.202.45.54
  5.202.45.63
  5.202.45.90
+5.202.46.134
  5.202.46.146
  5.202.46.15
  5.202.46.150
  5.202.46.153
  5.202.46.177
-5.202.46.182
  5.202.46.185
  5.202.46.197
  5.202.46.228
-5.202.46.252
  5.202.46.34
  5.202.46.65
  5.202.46.72
@@ -124256,7 +117647,7 @@
  5.202.47.101
  5.202.47.108
  5.202.47.116
-5.202.47.12
+5.202.47.13
  5.202.47.141
  5.202.47.154
  5.202.47.157
@@ -124264,14 +117655,13 @@
  5.202.47.165
  5.202.47.191
  5.202.47.248
-5.202.47.30
-5.202.47.58
+5.202.47.31
  5.202.47.78
  5.202.47.81
  5.202.47.90
+5.202.77.133
  5.206.224.138
  5.206.224.171
-5.206.224.188
  5.206.224.216
  5.206.224.240
  5.206.224.64
@@ -124285,7 +117675,6 @@
  5.206.230.62
  5.206.232.190
  5.206.236.45
-5.206.45.110
  5.206.65.112
  5.206.88.106
  5.21.61.143
@@ -124296,7 +117685,6 @@
  5.225.220.76
  5.226.168.31
  5.226.70.68
-5.227.121.184
  5.227.225.56
  5.228.17.55
  5.228.232.101
@@ -124310,6 +117698,7 @@
  5.235.186.38
  5.235.187.108
  5.235.235.125
+5.236.93.8
  5.236.96.72
  5.238.200.17
  5.238.209.34
@@ -124323,7 +117712,6 @@
  5.248.241.239
  5.248.86.134
  5.249.105.238
-5.249.145.245
  5.249.147.195
  5.249.147.91
  5.249.148.162
@@ -124336,13 +117724,11 @@
  5.252.193.211
  5.252.194.137
  5.252.194.29
-5.252.224.135
  5.253.147.151
  5.253.18.139
  5.253.18.191
  5.253.204.3
  5.253.204.4
-5.253.25.170
  5.253.25.217
  5.253.26.96
  5.253.50.184
@@ -124351,9 +117737,7 @@
  5.253.84.209
  5.253.86.13
  5.253.86.183
-5.253.86.207
  5.254.101.226
-5.254.118.159
  5.254.132.73
  5.254.56.74
  5.254.67.148
@@ -124384,13 +117768,15 @@
  5.26.140.158
  5.26.166.245
  5.26.61.184
+5.26.88.123
  5.26.90.208
  5.27.226.176
  5.27.242.217
+5.28.155.201
  5.28.62.85
  5.29.165.21
+5.3.248.44
  5.3.6.82
-5.3.87.8
  5.32.175.72
  5.32.176.101
  5.32.176.104
@@ -124401,21 +117787,17 @@
  5.32.25.94
  5.32.68.226
  5.32.71.134
-5.34.132.122
  5.34.137.53
  5.34.158.102
  5.34.178.126
-5.34.179.21
  5.34.180.177
  5.34.181.13
  5.34.181.17
  5.34.183.97
  5.34.221.226
  5.34.244.239
-5.36.118.235
-5.36.120.114
  5.36.123.12
-5.36.163.87
+5.37.236.199
  5.38.176.31
  5.39.101.15
  5.39.11.99
@@ -124433,7 +117815,6 @@
  5.39.24.170
  5.39.24.175
  5.39.31.208
-5.39.5.14
  5.39.5.5
  5.39.64.29
  5.39.66.58
@@ -124441,11 +117822,8 @@
  5.39.74.106
  5.39.74.166
  5.39.74.233
-5.39.75.36
  5.39.76.105
-5.39.76.12
  5.39.76.28
-5.39.77.117
  5.39.77.167
  5.39.78.212
  5.39.81.217
@@ -124461,7 +117839,6 @@
  5.39.91.173
  5.39.91.73
  5.39.94.46
-5.39.94.77
  5.39.95.38
  5.39.97.155
  5.40.80.162
@@ -124470,8 +117847,8 @@
  5.44.169.215
  5.44.203.155
  5.44.25.146
+5.44.40.77
  5.44.5.170
-5.45.104.77
  5.45.108.241
  5.45.110.20
  5.45.124.42
@@ -124487,13 +117864,10 @@
  5.45.83.14
  5.45.84.166
  5.50.141.208
-5.51.111.195
  5.51.60.216
-5.53.114.209
  5.53.138.156
  5.53.142.228
  5.54.102.184
-5.55.100.55
  5.55.205.30
  5.55.253.99
  5.55.95.60
@@ -124505,7 +117879,6 @@
  5.56.133.45
  5.56.133.57
  5.56.18.35
-5.56.185.115
  5.56.20.2
  5.56.200.234
  5.56.253.193
@@ -124528,11 +117901,9 @@
  5.59.143.43
  5.59.145.129
  5.59.35.26
-5.61.30.54
  5.61.50.213
  5.62.1.79
  5.62.18.108
-5.62.18.84
  5.62.19.37
  5.62.19.46
  5.62.19.54
@@ -124540,14 +117911,15 @@
  5.62.19.61
  5.62.20.21
  5.62.20.48
-5.62.34.13
+5.62.20.57
  5.62.37.16
  5.62.39.232
  5.62.39.37
  5.62.39.53
+5.62.43.167
  5.62.43.60
  5.62.43.61
-5.62.57.47
+5.62.56.50
  5.62.58.51
  5.62.59.87
  5.62.60.53
@@ -124559,16 +117931,13 @@
  5.63.10.198
  5.63.122.134
  5.63.146.172
-5.63.154.186
  5.63.158.232
-5.63.162.11
  5.63.165.178
  5.63.166.139
  5.63.166.140
  5.63.187.116
  5.63.188.194
  5.63.37.200
-5.63.40.168
  5.63.88.202
  5.64.86.165
  5.65.28.81
@@ -124576,10 +117945,7 @@
  5.66.138.88
  5.66.146.24
  5.66.162.199
-5.67.162.211
-5.68.154.203
  5.68.53.151
-5.68.58.210
  5.69.192.61
  5.69.89.34
  5.70.201.29
@@ -124589,6 +117955,7 @@
  5.71.186.2
  5.71.50.175
  5.71.54.23
+5.74.228.249
  5.76.101.29
  5.76.107.64
  5.76.146.186
@@ -124597,15 +117964,12 @@
  5.77.254.236
  5.77.35.249
  5.79.105.33
-5.79.109.175
  5.79.109.46
  5.79.109.48
  5.79.123.3
  5.79.165.108
-5.79.176.204
  5.79.245.111
  5.79.42.20
-5.79.66.162
  5.79.66.20
  5.79.68.161
  5.79.68.55
@@ -124632,6 +117996,7 @@
  5.8.16.77
  5.8.16.78
  5.8.16.83
+5.8.16.85
  5.8.16.89
  5.8.18.31
  5.8.18.88
@@ -124641,10 +118006,8 @@
  5.8.51.104
  5.8.88.75
  5.80.210.170
-5.81.225.205
  5.83.160.77
  5.83.161.153
-5.83.161.27
  5.83.161.68
  5.83.162.160
  5.83.162.221
@@ -124652,24 +118015,19 @@
  5.83.94.201
  5.88.124.86
  5.88.130.165
-5.88.132.235
-5.88.141.168
  5.88.141.217
  5.88.155.130
-5.88.165.109
  5.88.184.182
  5.88.185.249
  5.88.201.222
  5.88.23.250
  5.88.91.141
-5.89.10.81
  5.89.139.190
  5.89.175.250
  5.89.222.241
  5.89.232.197
  5.89.243.30
  5.89.33.136
-5.89.35.84
  5.89.60.42
  5.89.73.226
  5.9.104.197
@@ -124684,9 +118042,9 @@
  5.9.111.70
  5.9.111.84
  5.9.112.207
-5.9.112.210
  5.9.113.114
  5.9.113.217
+5.9.115.207
  5.9.115.210
  5.9.118.158
  5.9.118.57
@@ -124736,6 +118094,7 @@
  5.9.37.73
  5.9.41.181
  5.9.43.250
+5.9.44.125
  5.9.44.13
  5.9.44.82
  5.9.48.243
@@ -124744,6 +118103,7 @@
  5.9.50.87
  5.9.52.19
  5.9.54.133
+5.9.59.10
  5.9.59.178
  5.9.6.170
  5.9.6.51
@@ -124761,6 +118121,7 @@
  5.9.79.150
  5.9.8.150
  5.9.8.28
+5.9.81.230
  5.9.82.162
  5.9.82.188
  5.9.82.194
@@ -124778,17 +118139,13 @@
  5.9.97.173
  5.9.98.178
  5.9.99.120
-5.90.19.24
-5.90.192.2
  5.90.200.48
  5.90.202.98
-5.90.205.51
-5.90.216.77
-5.90.58.124
+5.90.42.119
  5.90.70.151
  5.90.85.40
-5.91.167.172
-5.91.19.222
+5.91.2.99
+5.91.21.234
  5.94.20.9
  5.94.228.106
  5.95.239.9
@@ -124799,7 +118156,7 @@
  5.zxczj.top
  50-87-224-50.unifiedlayer.com
  50.0.51.253
-50.100.113.207
+50.0.71.24
  50.101.20.243
  50.101.241.158
  50.106.51.98
@@ -124820,7 +118177,6 @@
  50.116.16.87
  50.116.18.107
  50.116.18.198
-50.116.22.61
  50.116.26.51
  50.116.26.72
  50.116.3.218
@@ -124911,6 +118267,7 @@
  50.197.162.169
  50.197.210.138
  50.197.38.230
+50.197.5.36
  50.198.160.225
  50.199.46.20
  50.199.81.66
@@ -124963,17 +118320,14 @@
  50.23.43.242
  50.23.69.44
  50.23.76.241
-50.230.96.15
  50.232.204.114
  50.232.60.196
  50.233.148.74
-50.233.228.147
  50.233.42.98
  50.234.173.102
  50.234.212.4
  50.235.28.146
  50.235.67.4
-50.235.70.202
  50.235.92.14
  50.235.92.65
  50.236.133.10
@@ -124984,7 +118338,6 @@
  50.237.128.182
  50.237.206.138
  50.237.206.174
-50.238.46.94
  50.240.188.72
  50.240.190.22
  50.240.254.245
@@ -124994,7 +118347,6 @@
  50.243.2.110
  50.244.173.237
  50.244.25.90
-50.244.37.249
  50.244.9.1
  50.245.107.73
  50.245.153.217
@@ -125004,6 +118356,7 @@
  50.245.46.181
  50.246.120.125
  50.246.253.213
+50.247.127.77
  50.247.168.180
  50.247.168.184
  50.247.168.185
@@ -125025,12 +118378,9 @@
  50.251.29.57
  50.251.31.229
  50.253.187.214
-50.253.211.61
  50.253.49.189
  50.254.135.209
  50.254.218.37
-50.254.86.98
-50.255.211.173
  50.255.64.233
  50.26.216.137
  50.27.184.225
@@ -125045,6 +118395,7 @@
  50.28.59.10
  50.28.84.148
  50.28.9.177
+50.3.136.182
  50.3.137.10
  50.3.137.128
  50.3.137.244
@@ -125054,15 +118405,15 @@
  50.3.177.76
  50.3.192.35
  50.3.197.128
-50.3.197.240
+50.3.197.138
  50.3.197.28
  50.3.74.72
+50.3.84.77
  50.3.89.90
  50.3.91.103
  50.30.24.217
  50.30.240.245
  50.30.37.150
-50.30.84.219
  50.30.93.94
  50.31.10.228
  50.31.138.103
@@ -125070,7 +118421,6 @@
  50.31.147.175
  50.31.30.22
  50.31.96.11
-50.32.143.179
  50.33.148.138
  50.34.39.72
  50.34.65.217
@@ -125080,14 +118430,13 @@
  50.4.193.55
  50.4.38.160
  50.4.46.52
-50.4.69.254
-50.4.86.76
  50.40.77.62
  50.45.232.189
  50.46.218.6
  50.5.78.127
  50.53.142.12
  50.53.235.174
+50.53.239.161
  50.53.250.162
  50.56.109.107
  50.56.114.172
@@ -125105,6 +118454,7 @@
  50.59.191.53
  50.59.209.166
  50.59.209.30
+50.60.138.114
  50.62.133.47
  50.62.160.157
  50.62.161.140
@@ -125136,13 +118486,12 @@
  50.66.45.43
  50.66.82.129
  50.67.14.107
-50.67.178.164
  50.67.234.213
  50.67.40.214
  50.67.49.110
  50.67.52.41
  50.68.104.92
-50.68.200.101
+50.68.113.194
  50.7.138.133
  50.7.177.59
  50.7.184.58
@@ -125160,7 +118509,6 @@
  50.76.148.93
  50.77.133.114
  50.77.8.169
-50.78.3.141
  50.80.224.218
  50.81.111.72
  50.82.157.158
@@ -125180,6 +118528,7 @@
  50.87.38.190
  50.88.129.220
  50.88.177.32
+50.88.20.178
  50.90.3.116
  50.90.45.100
  50.91.114.38
@@ -125224,6 +118573,7 @@
  50pm4.com
  50porcentomaga-com.umbler.net
  50pyahooupdaate.weebly.com
+50xwy-68i1ft.com
  51-iblog.com
  51.103.130.57
  51.103.131.40
@@ -125231,6 +118581,7 @@
  51.103.138.172
  51.103.138.56
  51.103.139.79
+51.103.142.186
  51.103.142.75
  51.103.145.92
  51.103.147.125
@@ -125239,13 +118590,11 @@
  51.103.153.39
  51.103.156.200
  51.103.160.81
-51.103.28.183
+51.103.19.12
  51.103.31.232
-51.103.34.211
  51.103.36.201
  51.103.36.90
  51.103.72.31
-51.104.0.170
  51.104.208.167
  51.104.208.250
  51.104.242.17
@@ -125260,12 +118609,14 @@
  51.11.33.122
  51.116.112.193
  51.116.115.221
+51.116.132.231
  51.116.169.192
  51.116.174.17
-51.116.178.178
  51.116.180.53
+51.116.182.108
  51.116.189.50
  51.116.189.84
+51.116.191.149
  51.120.94.14
  51.120.95.194
  51.124.89.203
@@ -125280,38 +118631,26 @@
  51.136.50.73
  51.137.108.191
  51.137.120.192
-51.137.134.191
-51.137.145.162
-51.137.145.183
-51.137.66.104
-51.137.79.150
  51.140.15.164
  51.140.179.45
  51.140.228.189
  51.140.229.192
-51.140.241.43
  51.140.48.231
  51.140.67.211
  51.141.0.227
-51.141.101.225
  51.141.161.253
  51.141.167.27
-51.141.39.94
  51.141.76.176
  51.141.79.141
-51.141.84.21
  51.141.85.23
  51.143.103.117
  51.143.130.33
+51.143.15.34
  51.144.106.161
  51.144.140.130
-51.144.227.77
  51.144.60.77
-51.144.70.37
  51.144.73.114
-51.145.215.214
  51.145.233.219
-51.145.242.1
  51.148.153.60
  51.148.160.195
  51.15.1.221
@@ -125329,6 +118668,7 @@
  51.15.106.26
  51.15.106.32
  51.15.107.160
+51.15.107.220
  51.15.108.147
  51.15.108.244
  51.15.109.211
@@ -125351,9 +118691,7 @@
  51.15.116.49
  51.15.117.149
  51.15.117.187
-51.15.118.114
  51.15.118.15
-51.15.118.211
  51.15.118.212
  51.15.118.30
  51.15.118.86
@@ -125372,8 +118710,6 @@
  51.15.124.7
  51.15.124.85
  51.15.125.138
-51.15.125.53
-51.15.126.127
  51.15.127.75
  51.15.13.130
  51.15.133.6
@@ -125388,9 +118724,7 @@
  51.15.141.251
  51.15.141.66
  51.15.142.107
-51.15.144.136
  51.15.145.148
-51.15.145.62
  51.15.147.154
  51.15.147.166
  51.15.148.90
@@ -125406,20 +118740,12 @@
  51.15.157.211
  51.15.157.96
  51.15.158.125
-51.15.158.217
-51.15.158.253
-51.15.158.28
  51.15.159.90
-51.15.160.190
  51.15.160.56
  51.15.162.102
-51.15.163.63
-51.15.163.69
-51.15.163.70
  51.15.164.127
  51.15.165.15
  51.15.166.138
-51.15.170.129
  51.15.171.192
  51.15.171.227
  51.15.171.31
@@ -125429,12 +118755,8 @@
  51.15.178.69
  51.15.179.65
  51.15.18.197
-51.15.180.120
  51.15.180.168
-51.15.180.219
  51.15.181.38
-51.15.181.72
-51.15.182.179
  51.15.185.78
  51.15.186.6
  51.15.187.240
@@ -125443,13 +118765,9 @@
  51.15.192.111
  51.15.192.164
  51.15.192.76
-51.15.193.63
  51.15.194.168
-51.15.194.51
  51.15.197.244
-51.15.197.4
  51.15.199.181
-51.15.20.70
  51.15.202.246
  51.15.203.122
  51.15.204.155
@@ -125458,11 +118776,7 @@
  51.15.205.46
  51.15.207.196
  51.15.207.54
-51.15.207.74
-51.15.209.100
  51.15.209.105
-51.15.209.136
-51.15.209.81
  51.15.21.149
  51.15.210.208
  51.15.211.170
@@ -125483,7 +118797,6 @@
  51.15.223.100
  51.15.224.0
  51.15.225.210
-51.15.226.137
  51.15.227.169
  51.15.227.214
  51.15.227.254
@@ -125499,13 +118812,11 @@
  51.15.237.138
  51.15.239.164
  51.15.240.54
-51.15.241.102
  51.15.242.181
  51.15.243.117
  51.15.243.125
  51.15.243.63
  51.15.244.212
-51.15.245.32
  51.15.246.38
  51.15.247.124
  51.15.248.110
@@ -125540,7 +118851,6 @@
  51.15.46.11
  51.15.46.149
  51.15.46.174
-51.15.46.184
  51.15.46.217
  51.15.46.230
  51.15.46.75
@@ -125634,7 +118944,6 @@
  51.15.79.187
  51.15.80.14
  51.15.80.200
-51.15.80.231
  51.15.81.22
  51.15.81.62
  51.15.82.156
@@ -125644,7 +118953,6 @@
  51.15.83.222
  51.15.84.122
  51.15.84.127
-51.15.84.255
  51.15.85.108
  51.15.85.16
  51.15.86.162
@@ -125653,7 +118961,6 @@
  51.15.89.198
  51.15.89.237
  51.15.9.224
-51.15.90.185
  51.15.90.235
  51.15.90.245
  51.15.90.34
@@ -125675,12 +118982,12 @@
  51.15.97.222
  51.15.97.236
  51.15.98.144
-51.15.99.106
  51.15.99.180
  51.15.99.240
  51.154.110.24
  51.154.131.18
  51.154.136.60
+51.154.14.19
  51.154.25.79
  51.154.46.234
  51.154.53.96
@@ -125698,7 +119005,6 @@
  51.158.107.41
  51.158.108.123
  51.158.108.135
-51.158.108.186
  51.158.108.231
  51.158.110.129
  51.158.111.124
@@ -125711,7 +119017,6 @@
  51.158.114.176
  51.158.114.63
  51.158.116.101
-51.158.117.176
  51.158.117.215
  51.158.117.35
  51.158.118.22
@@ -125722,16 +119027,14 @@
  51.158.120.115
  51.158.120.58
  51.158.120.84
+51.158.121.33
  51.158.122.158
-51.158.122.211
  51.158.123.145
  51.158.123.35
  51.158.124.238
  51.158.124.242
  51.158.125.96
-51.158.145.216
  51.158.147.13
-51.158.152.44
  51.158.153.179
  51.158.153.18
  51.158.153.222
@@ -125773,7 +119076,6 @@
  51.158.176.210
  51.158.177.157
  51.158.178.26
-51.158.181.157
  51.158.181.44
  51.158.182.162
  51.158.182.165
@@ -125798,16 +119100,14 @@
  51.158.190.116
  51.158.190.194
  51.158.190.34
-51.158.190.54
+51.158.20.108
  51.158.20.200
-51.158.22.177
  51.158.23.225
  51.158.24.215
  51.158.28.129
  51.158.29.101
+51.158.29.191
  51.158.29.207
-51.158.30.109
-51.158.30.119
  51.158.31.156
  51.158.31.190
  51.158.64.175
@@ -125826,18 +119126,18 @@
  51.158.70.76
  51.158.70.82
  51.158.71.206
-51.158.73.27
  51.158.77.121
  51.158.79.55
  51.158.97.57
  51.158.98.121
-51.158.98.224
  51.158.98.80
-51.158.99.0
  51.158.99.3
  51.158.99.51
  51.158.99.68
  51.159.0.145
+51.159.0.181
+51.159.0.185
+51.159.0.200
  51.159.128.101
  51.159.128.165
  51.159.128.235
@@ -125847,7 +119147,6 @@
  51.159.131.47
  51.159.132.118
  51.159.132.226
-51.159.132.83
  51.159.133.169
  51.159.133.230
  51.159.134.172
@@ -125893,7 +119192,6 @@
  51.159.148.63
  51.159.149.130
  51.159.149.241
-51.159.150.13
  51.159.150.15
  51.159.151.174
  51.159.151.64
@@ -125920,7 +119218,6 @@
  51.159.161.111
  51.159.161.137
  51.159.161.202
-51.159.161.235
  51.159.162.188
  51.159.162.25
  51.159.162.30
@@ -125948,7 +119245,6 @@
  51.159.168.44
  51.159.169.172
  51.159.169.208
-51.159.169.28
  51.159.169.74
  51.159.171.165
  51.159.171.245
@@ -125966,7 +119262,6 @@
  51.159.177.141
  51.159.177.189
  51.159.177.231
-51.159.178.112
  51.159.178.27
  51.159.178.52
  51.159.178.80
@@ -126009,12 +119304,13 @@
  51.159.19.128
  51.159.190.151
  51.159.190.65
-51.159.191.134
  51.159.191.19
  51.159.191.236
  51.159.191.32
  51.159.191.51
  51.159.2.240
+51.159.2.44
+51.159.2.69
  51.159.20.44
  51.159.22.160
  51.159.22.164
@@ -126026,68 +119322,53 @@
  51.159.3.222
  51.159.30.99
  51.159.36.139
-51.159.52.209
-51.159.53.167
-51.159.53.169
-51.159.53.170
+51.159.53.164
+51.159.53.166
  51.159.56.35
-51.159.6.76
  51.159.64.86
-51.159.67.165
  51.159.93.108
  51.159.93.121
+51.159.93.127
+51.159.93.131
  51.159.93.240
-51.159.93.80
  51.159.94.210
  51.159.95.8
  51.161.11.103
  51.161.11.160
-51.161.11.70
  51.161.116.175
  51.161.118.180
  51.161.119.98
  51.161.12.231
  51.161.32.211
-51.161.34.239
  51.161.36.145
  51.161.40.229
  51.161.43.235
  51.161.45.174
-51.161.45.238
-51.161.45.65
-51.161.51.147
-51.161.51.150
  51.161.52.46
  51.161.52.56
  51.161.57.155
  51.161.62.153
  51.161.68.186
  51.161.68.187
-51.161.8.70
  51.161.82.98
  51.161.84.86
  51.161.9.155
  51.171.96.142
-51.174.201.169
  51.174.207.190
  51.174.28.217
+51.174.45.216
  51.174.76.107
  51.175.224.155
  51.175.84.243
  51.178.104.131
  51.178.136.52
  51.178.137.106
-51.178.137.139
  51.178.137.159
  51.178.138.1
  51.178.140.134
  51.178.142.175
-51.178.142.220
-51.178.144.21
  51.178.144.91
  51.178.156.248
-51.178.165.152
-51.178.169.200
  51.178.17.63
  51.178.176.38
  51.178.183.213
@@ -126096,20 +119377,18 @@
  51.178.225.200
  51.178.24.61
  51.178.245.177
+51.178.251.63
  51.178.27.206
  51.178.27.237
-51.178.28.196
  51.178.29.191
  51.178.29.39
  51.178.30.102
-51.178.30.154
  51.178.41.60
  51.178.42.105
  51.178.42.14
  51.178.43.216
  51.178.43.9
  51.178.45.204
-51.178.46.95
  51.178.47.46
  51.178.48.2
  51.178.48.212
@@ -126131,7 +119410,6 @@
  51.178.50.200
  51.178.50.205
  51.178.50.24
-51.178.50.244
  51.178.50.70
  51.178.51.10
  51.178.51.125
@@ -126142,26 +119420,18 @@
  51.178.51.223
  51.178.51.228
  51.178.51.32
-51.178.51.36
  51.178.51.61
  51.178.51.79
-51.178.52.185
  51.178.52.245
-51.178.52.56
  51.178.52.84
  51.178.53.233
  51.178.53.84
-51.178.55.147
-51.178.55.56
-51.178.55.92
-51.178.58.30
  51.178.63.225
+51.178.75.140
  51.178.80.229
  51.178.81.75
-51.178.82.80
  51.178.83.124
  51.178.83.144
-51.178.86.49
  51.178.86.97
  51.178.87.42
  51.178.9.100
@@ -126176,10 +119446,8 @@
  51.195.103.56
  51.195.128.217
  51.195.133.181
-51.195.136.14
  51.195.136.190
-51.195.138.52
-51.195.139.140
+51.195.136.233
  51.195.147.192
  51.195.148.18
  51.195.148.67
@@ -126214,8 +119482,6 @@
  51.195.166.161
  51.195.167.73
  51.195.17.118
-51.195.21.179
-51.195.28.121
  51.195.33.22
  51.195.33.40
  51.195.40.43
@@ -126226,10 +119492,8 @@
  51.195.45.196
  51.195.47.153
  51.195.47.79
-51.195.50.197
  51.195.53.6
  51.195.58.105
-51.195.58.133
  51.195.6.99
  51.195.61.13
  51.195.62.87
@@ -126248,13 +119512,11 @@
  51.195.91.162
  51.195.91.163
  51.195.91.166
-51.210.102.82
  51.210.103.96
  51.210.105.39
  51.210.106.68
  51.210.107.15
  51.210.107.217
-51.210.107.84
  51.210.109.104
  51.210.109.128
  51.210.11.180
@@ -126266,11 +119528,10 @@
  51.210.14.124
  51.210.148.31
  51.210.151.134
-51.210.151.242
  51.210.159.130
+51.210.162.127
  51.210.176.199
  51.210.179.20
-51.210.179.230
  51.210.182.187
  51.210.183.93
  51.210.209.56
@@ -126333,26 +119594,20 @@
  51.210.34.62
  51.210.40.91
  51.210.42.196
-51.210.44.194
  51.210.45.112
-51.210.47.193
  51.210.5.171
  51.210.61.169
-51.210.7.247
  51.210.7.64
  51.210.8.151
  51.210.80.127
  51.210.9.10
  51.210.96.169
  51.210.96.35
+51.210.97.29
  51.210.98.10
  51.210.99.195
  51.211.183.85
-51.218.31.109
  51.222.0.40
-51.222.12.106
-51.222.12.137
-51.222.12.55
  51.222.13.24
  51.222.14.28
  51.222.14.70
@@ -126360,24 +119615,20 @@
  51.222.25.185
  51.222.26.176
  51.222.26.189
-51.222.29.24
  51.222.29.39
-51.222.48.59
  51.222.56.152
  51.222.8.122
  51.222.9.153
+51.223.25.228
  51.235.117.247
  51.235.56.203
  51.235.70.91
  51.235.82.71
  51.254.100.220
-51.254.100.56
  51.254.101.227
  51.254.113.107
-51.254.113.128
  51.254.114.105
  51.254.114.46
-51.254.116.201
  51.254.117.33
  51.254.118.224
  51.254.120.159
@@ -126392,7 +119643,6 @@
  51.254.134.58
  51.254.141.10
  51.254.141.18
-51.254.141.211
  51.254.141.216
  51.254.141.247
  51.254.141.30
@@ -126423,7 +119673,6 @@
  51.254.220.97
  51.254.221.100
  51.254.221.95
-51.254.222.108
  51.254.222.185
  51.254.222.68
  51.254.23.227
@@ -126454,12 +119703,10 @@
  51.254.49.109
  51.254.49.110
  51.254.49.111
-51.254.49.156
  51.254.49.96
  51.254.49.97
  51.254.49.98
  51.254.49.99
-51.254.51.182
  51.254.63.223
  51.254.71.120
  51.254.75.176
@@ -126472,6 +119719,7 @@
  51.254.97.23
  51.254.99.229
  51.255.101.157
+51.255.105.122
  51.255.106.231
  51.255.106.85
  51.255.109.160
@@ -126490,17 +119738,14 @@
  51.255.109.173
  51.255.109.174
  51.255.109.175
-51.255.130.74
  51.255.142.69
  51.255.149.249
  51.255.149.50
-51.255.160.51
  51.255.161.222
  51.255.163.60
  51.255.164.193
  51.255.165.160
  51.255.167.128
-51.255.168.152
  51.255.168.254
  51.255.17.160
  51.255.170.237
@@ -126508,7 +119753,6 @@
  51.255.172.209
  51.255.172.77
  51.255.173.222
-51.255.173.41
  51.255.173.70
  51.255.194.29
  51.255.194.3
@@ -126526,23 +119770,19 @@
  51.255.216.43
  51.255.216.45
  51.255.223.40
-51.255.230.67
  51.255.28.53
  51.255.35.41
-51.255.35.58
  51.255.36.85
  51.255.36.88
  51.255.38.226
  51.255.42.170
  51.255.42.173
  51.255.45.144
-51.255.47.133
  51.255.49.59
  51.255.51.249
  51.255.51.28
  51.255.53.27
  51.255.64.196
-51.255.64.220
  51.255.64.58
  51.255.69.109
  51.255.75.16
@@ -126552,25 +119792,18 @@
  51.255.85.181
  51.255.85.26
  51.255.87.121
-51.255.9.160
  51.255.95.26
  51.38.101.119
  51.38.103.163
  51.38.105.215
  51.38.111.42
-51.38.112.45
  51.38.124.206
  51.38.125.235
  51.38.126.75
-51.38.126.92
  51.38.127.227
  51.38.128.30
  51.38.129.120
  51.38.129.49
-51.38.129.74
-51.38.130.205
-51.38.130.242
-51.38.131.68
  51.38.140.11
  51.38.140.16
  51.38.140.21
@@ -126581,32 +119814,22 @@
  51.38.150.171
  51.38.16.217
  51.38.162.232
-51.38.167.85
  51.38.168.26
-51.38.176.42
  51.38.179.113
  51.38.185.101
-51.38.185.121
-51.38.186.244
  51.38.186.53
-51.38.187.198
  51.38.187.226
  51.38.187.74
  51.38.188.101
-51.38.188.20
  51.38.188.63
-51.38.189.138
  51.38.189.20
  51.38.191.126
  51.38.21.125
+51.38.211.30
  51.38.214.71
  51.38.215.58
-51.38.225.124
  51.38.225.57
-51.38.230.10
-51.38.231.78
  51.38.233.93
-51.38.235.100
  51.38.237.230
  51.38.238.165
  51.38.238.205
@@ -126617,25 +119840,20 @@
  51.38.36.9
  51.38.37.254
  51.38.41.205
-51.38.41.239
  51.38.41.38
  51.38.42.226
  51.38.48.127
  51.38.48.186
-51.38.49.17
  51.38.49.5
  51.38.51.198
-51.38.51.200
  51.38.54.187
  51.38.58.134
  51.38.64.136
-51.38.65.175
  51.38.65.2
  51.38.68.83
  51.38.70.175
  51.38.70.243
  51.38.71.101
-51.38.71.36
  51.38.71.88
  51.38.80.114
  51.38.80.133
@@ -126657,7 +119875,6 @@
  51.52.178.178
  51.6.146.148
  51.6.164.145
-51.68.11.203
  51.68.11.211
  51.68.11.231
  51.68.121.169
@@ -126665,9 +119882,7 @@
  51.68.122.147
  51.68.122.155
  51.68.123.192
-51.68.123.198
  51.68.123.65
-51.68.127.137
  51.68.139.151
  51.68.139.16
  51.68.140.104
@@ -126676,9 +119891,7 @@
  51.68.143.201
  51.68.143.212
  51.68.149.166
-51.68.149.168
  51.68.149.169
-51.68.149.170
  51.68.149.174
  51.68.149.177
  51.68.149.178
@@ -126694,23 +119907,19 @@
  51.68.172.217
  51.68.172.59
  51.68.173.78
-51.68.174.177
  51.68.174.179
  51.68.174.34
  51.68.180.4
-51.68.187.251
  51.68.189.69
  51.68.190.223
-51.68.196.163
  51.68.197.174
  51.68.197.96
  51.68.198.113
  51.68.198.75
-51.68.199.188
+51.68.202.104
  51.68.204.150
  51.68.207.75
  51.68.208.252
-51.68.212.114
  51.68.212.168
  51.68.212.44
  51.68.212.73
@@ -126722,15 +119931,10 @@
  51.68.215.174
  51.68.215.249
  51.68.224.53
-51.68.226.159
-51.68.227.98
-51.68.228.127
  51.68.229.177
-51.68.229.73
  51.68.230.213
  51.68.245.130
  51.68.251.200
-51.68.251.202
  51.68.251.9
  51.68.253.19
  51.68.33.31
@@ -126739,32 +119943,25 @@
  51.68.44.13
  51.68.44.143
  51.68.44.154
-51.68.47.226
  51.68.5.179
  51.68.61.17
  51.68.71.239
-51.68.80.255
-51.68.84.36
  51.68.85.93
  51.68.86.247
  51.68.88.26
-51.68.89.100
  51.68.90.171
  51.68.90.244
  51.68.91.191
-51.68.94.177
  51.68.94.206
+51.68.97.209
  51.7.245.8
  51.75.120.36
-51.75.121.252
  51.75.122.213
  51.75.123.107
-51.75.124.215
  51.75.126.115
  51.75.129.231
  51.75.131.235
  51.75.140.153
-51.75.142.122
  51.75.142.24
  51.75.144.239
  51.75.144.43
@@ -126782,59 +119979,41 @@
  51.75.160.57
  51.75.161.72
  51.75.162.18
-51.75.162.236
  51.75.164.255
  51.75.169.151
  51.75.17.122
  51.75.170.50
  51.75.18.212
  51.75.18.215
-51.75.19.157
  51.75.19.175
  51.75.191.176
-51.75.195.25
  51.75.196.154
-51.75.201.137
  51.75.202.218
  51.75.205.10
-51.75.206.210
-51.75.206.42
-51.75.207.61
-51.75.208.177
-51.75.208.179
-51.75.208.181
-51.75.208.183
  51.75.209.226
  51.75.210.192
  51.75.210.209
  51.75.23.183
  51.75.23.214
-51.75.23.62
-51.75.233.37
  51.75.24.200
  51.75.24.26
  51.75.242.135
+51.75.242.212
  51.75.246.176
  51.75.247.170
-51.75.248.241
  51.75.249.224
  51.75.254.172
  51.75.255.250
-51.75.28.134
  51.75.28.25
-51.75.29.61
-51.75.30.199
-51.75.30.238
  51.75.33.122
  51.75.33.127
-51.75.37.30
  51.75.39.125
-51.75.41.225
  51.75.45.100
  51.75.47.125
  51.75.5.52
  51.75.52.118
  51.75.52.127
+51.75.53.141
  51.75.53.167
  51.75.55.212
  51.75.55.53
@@ -126844,54 +120023,35 @@
  51.75.66.142
  51.75.66.172
  51.75.66.92
-51.75.69.184
-51.75.69.196
  51.75.69.90
-51.75.70.30
  51.75.71.111
-51.75.73.114
-51.75.73.211
-51.75.76.201
-51.75.78.128
-51.75.83.77
  51.75.86.211
-51.75.87.232
  51.75.90.164
  51.75.92.67
  51.77.0.80
  51.77.108.33
  51.77.108.43
-51.77.109.213
  51.77.109.98
-51.77.111.30
  51.77.112.168
  51.77.117.99
  51.77.119.42
  51.77.135.89
  51.77.136.116
  51.77.137.211
-51.77.137.230
  51.77.137.6
  51.77.140.110
  51.77.140.111
  51.77.140.36
  51.77.141.154
-51.77.144.50
  51.77.146.156
-51.77.146.170
  51.77.147.5
-51.77.147.95
  51.77.148.7
-51.77.148.77
  51.77.149.232
  51.77.150.118
  51.77.150.203
-51.77.151.147
  51.77.151.175
  51.77.152.20
  51.77.152.209
-51.77.158.176
-51.77.163.177
  51.77.163.186
  51.77.193.204
  51.77.193.245
@@ -126899,19 +120059,16 @@
  51.77.200.101
  51.77.200.139
  51.77.201.36
-51.77.201.5
  51.77.202.151
  51.77.210.17
  51.77.210.201
  51.77.211.228
  51.77.211.8
  51.77.212.179
-51.77.212.235
  51.77.213.136
  51.77.213.174
  51.77.214.118
  51.77.215.0
-51.77.215.18
  51.77.215.207
  51.77.215.227
  51.77.220.183
@@ -126920,9 +120077,7 @@
  51.77.223.62
  51.77.226.110
  51.77.226.180
-51.77.226.68
  51.77.230.131
-51.77.230.48
  51.77.230.49
  51.77.231.236
  51.77.237.100
@@ -126932,9 +120087,7 @@
  51.77.246.155
  51.77.249.201
  51.77.34.213
-51.77.34.244
  51.77.39.255
-51.77.41.246
  51.77.52.201
  51.77.53.133
  51.77.53.174
@@ -126948,10 +120101,9 @@
  51.77.73.38
  51.77.73.39
  51.77.75.127
-51.77.9.78
-51.77.92.101
  51.77.94.244
  51.77.95.120
+51.77.98.150
  51.79.100.13
  51.79.111.220
  51.79.123.249
@@ -126960,61 +120112,44 @@
  51.79.141.240
  51.79.142.10
  51.79.145.108
-51.79.145.158
  51.79.146.10
  51.79.146.163
  51.79.147.177
  51.79.153.192
  51.79.153.194
  51.79.153.197
-51.79.156.248
+51.79.157.254
  51.79.159.172
-51.79.159.27
  51.79.160.138
  51.79.160.193
-51.79.161.170
-51.79.173.212
  51.79.173.61
  51.79.184.129
  51.79.184.130
  51.79.184.133
  51.79.184.136
  51.79.186.138
-51.79.187.211
  51.79.197.112
  51.79.197.204
  51.79.197.205
  51.79.199.209
-51.79.29.32
  51.79.38.73
  51.79.42.147
  51.79.44.52
  51.79.49.178
-51.79.50.172
  51.79.52.2
-51.79.53.106
  51.79.53.134
  51.79.53.139
  51.79.53.145
  51.79.53.146
-51.79.54.234
  51.79.55.141
-51.79.55.87
  51.79.60.149
-51.79.60.165
-51.79.66.190
  51.79.66.198
-51.79.67.79
  51.79.68.147
  51.79.69.153
-51.79.70.223
  51.79.74.205
-51.79.74.209
  51.79.82.75
  51.79.83.129
  51.79.84.101
-51.79.84.48
-51.79.85.142
  51.79.85.154
  51.79.86.173
  51.79.86.174
@@ -127036,13 +120171,13 @@
  51.81.28.244
  51.81.29.60
  51.81.31.168
+51.81.31.66
  51.81.34.189
-51.81.34.227
  51.81.34.79
-51.81.40.0
  51.81.43.50
  51.81.46.100
  51.81.46.170
+51.81.53.144
  51.81.53.34
  51.81.56.15
  51.81.56.49
@@ -127055,30 +120190,24 @@
  51.81.83.124
  51.81.83.161
  51.81.84.238
-51.81.85.219
  51.83.104.120
  51.83.105.108
  51.83.110.20
-51.83.125.8
  51.83.126.77
  51.83.128.210
  51.83.128.81
-51.83.129.158
  51.83.129.228
  51.83.129.84
  51.83.131.110
  51.83.131.123
  51.83.131.234
  51.83.132.19
-51.83.133.17
-51.83.133.24
  51.83.134.17
  51.83.134.233
-51.83.135.98
-51.83.136.100
  51.83.136.109
  51.83.139.55
  51.83.139.56
+51.83.158.207
  51.83.165.190
  51.83.171.11
  51.83.171.12
@@ -127090,11 +120219,8 @@
  51.83.186.98
  51.83.187.201
  51.83.189.0
-51.83.191.217
  51.83.191.229
  51.83.191.230
-51.83.193.144
-51.83.20.0
  51.83.200.164
  51.83.200.179
  51.83.200.213
@@ -127106,8 +120232,6 @@
  51.83.212.16
  51.83.216.234
  51.83.216.235
-51.83.248.45
-51.83.251.120
  51.83.32.141
  51.83.33.156
  51.83.33.202
@@ -127115,27 +120239,16 @@
  51.83.40.227
  51.83.41.120
  51.83.41.129
+51.83.41.131
  51.83.42.108
-51.83.42.185
-51.83.42.66
-51.83.44.111
-51.83.44.53
  51.83.45.246
  51.83.45.65
-51.83.57.157
  51.83.67.9
  51.83.68.213
-51.83.70.93
-51.83.72.243
-51.83.73.109
-51.83.73.127
  51.83.74.126
  51.83.74.203
-51.83.75.97
  51.83.76.25
-51.83.76.88
  51.83.77.224
-51.83.77.93
  51.83.97.245
  51.83.97.44
  51.83.98.104
@@ -127143,7 +120256,6 @@
  51.89.10.253
  51.89.100.108
  51.89.103.32
-51.89.111.21
  51.89.119.120
  51.89.119.154
  51.89.13.174
@@ -127152,7 +120264,6 @@
  51.89.148.169
  51.89.148.30
  51.89.148.69
-51.89.149.213
  51.89.149.241
  51.89.150.123
  51.89.151.62
@@ -127183,99 +120294,74 @@
  51.89.228.61
  51.89.23.175
  51.89.23.74
-51.89.235.195
  51.89.235.94
  51.89.25.118
  51.89.25.120
  51.89.32.83
  51.89.36.180
  51.89.40.32
-51.89.44.231
  51.89.50.146
  51.89.57.116
-51.89.57.30
  51.89.6.79
  51.89.62.241
-51.89.68.141
-51.89.68.142
-51.89.72.175
  51.89.76.220
-51.89.90.5
-51.89.94.204
  51.89.97.101
  51.9.226.191
-51.9.247.170
  51.91.10.114
  51.91.100.109
  51.91.100.120
-51.91.100.19
  51.91.100.52
  51.91.101.143
  51.91.101.174
  51.91.102.100
-51.91.102.99
  51.91.105.165
  51.91.105.6
  51.91.108.15
  51.91.108.57
-51.91.108.98
-51.91.109.220
-51.91.11.53
-51.91.11.62
-51.91.110.170
  51.91.110.51
  51.91.111.160
  51.91.111.73
  51.91.116.128
  51.91.120.67
-51.91.122.223
-51.91.122.253
  51.91.123.111
  51.91.123.119
  51.91.123.132
  51.91.123.213
  51.91.123.217
  51.91.123.235
-51.91.125.136
  51.91.125.195
+51.91.127.200
  51.91.127.201
-51.91.134.227
+51.91.127.63
+51.91.136.28
  51.91.140.218
-51.91.151.124
-51.91.157.101
-51.91.157.114
  51.91.157.255
-51.91.158.178
-51.91.159.152
  51.91.159.46
  51.91.189.201
  51.91.190.80
-51.91.193.112
  51.91.197.15
  51.91.197.151
  51.91.204.85
  51.91.212.159
  51.91.214.66
+51.91.214.67
  51.91.229.147
  51.91.248.152
  51.91.248.196
  51.91.249.178
-51.91.250.197
  51.91.250.49
-51.91.251.20
+51.91.251.4
  51.91.255.147
  51.91.28.19
-51.91.56.130
  51.91.56.133
  51.91.62.130
  51.91.66.179
  51.91.66.183
  51.91.67.153
  51.91.68.164
+51.91.76.214
  51.91.76.3
  51.91.77.103
-51.91.77.104
-51.91.78.238
  51.91.8.125
  51.91.8.222
  51.91.80.172
@@ -127284,8 +120370,6 @@
  51.91.80.232
  51.91.89.182
  51.91.94.23
-51.91.96.96
-51.91.97.153
  51.91.99.233
  51.fi
  510-365.net
@@ -127359,7 +120443,7 @@
  52.11.74.157
  52.11.87.3
  52.116.133.6
-52.116.141.133
+52.117.124.2
  52.117.174.43
  52.117.176.186
  52.117.70.157
@@ -127371,32 +120455,22 @@
  52.13.177.203
  52.13.22.56
  52.13.58.244
-52.130.66.36
  52.130.73.105
  52.130.73.214
-52.130.74.149
  52.130.75.15
-52.130.75.167
  52.130.75.32
  52.130.79.154
  52.130.84.117
-52.130.85.214
  52.130.85.229
  52.130.85.31
  52.130.89.37
  52.130.91.56
-52.130.93.119
-52.136.209.91
  52.137.4.23
  52.137.50.53
  52.138.0.111
-52.138.11.255
-52.138.17.218
  52.138.19.29
  52.138.20.234
-52.138.36.5
  52.138.63.1
-52.139.235.176
  52.139.32.205
  52.14.119.155
  52.14.12.6
@@ -127407,6 +120481,7 @@
  52.14.149.21
  52.14.159.97
  52.14.171.234
+52.14.172.117
  52.14.18.129
  52.14.180.106
  52.14.181.46
@@ -127422,15 +120497,15 @@
  52.14.87.72
  52.141.35.112
  52.142.15.195
-52.142.20.219
  52.142.25.231
  52.142.47.9
  52.142.51.155
  52.142.51.178
+52.142.57.56
  52.142.61.128
  52.143.119.200
  52.143.120.60
-52.143.155.107
+52.143.161.78
  52.143.64.116
  52.144.111.69
  52.144.114.197
@@ -127449,21 +120524,17 @@
  52.147.55.113
  52.148.136.67
  52.148.152.19
-52.148.171.218
-52.148.245.233
  52.148.246.119
  52.148.95.111
  52.149.129.116
  52.149.152.236
  52.149.152.94
  52.149.157.60
-52.149.164.103
-52.149.164.15
  52.149.180.228
-52.149.221.77
  52.149.225.8
  52.149.231.162
  52.15.103.61
+52.15.105.249
  52.15.105.94
  52.15.115.119
  52.15.138.15
@@ -127478,13 +120549,11 @@
  52.15.215.225
  52.15.229.145
  52.15.51.23
-52.15.53.94
  52.15.65.174
  52.15.65.61
  52.15.69.67
  52.15.87.18
  52.15.98.118
-52.151.1.24
  52.151.117.83
  52.151.28.106
  52.151.3.138
@@ -127494,12 +120563,10 @@
  52.152.160.138
  52.152.222.71
  52.152.238.18
-52.154.72.37
  52.156.134.132
  52.156.17.5
  52.156.78.167
  52.156.8.150
-52.157.110.87
  52.157.154.150
  52.158.134.58
  52.158.237.191
@@ -127512,7 +120579,6 @@
  52.16.230.146
  52.160.126.89
  52.160.70.41
-52.160.81.85
  52.161.12.190
  52.161.12.230
  52.161.13.30
@@ -127523,7 +120589,6 @@
  52.162.152.156
  52.162.179.16
  52.162.221.100
-52.162.242.4
  52.162.252.164
  52.162.48.32
  52.162.88.107
@@ -127531,6 +120596,7 @@
  52.163.127.48
  52.163.205.229
  52.163.223.126
+52.163.227.137
  52.163.243.190
  52.163.63.49
  52.164.124.121
@@ -127540,7 +120606,6 @@
  52.165.32.203
  52.165.33.244
  52.165.33.245
-52.165.46.242
  52.165.91.103
  52.166.219.191
  52.166.232.140
@@ -127552,7 +120617,6 @@
  52.167.130.164
  52.167.156.52
  52.167.163.88
-52.167.167.174
  52.167.59.41
  52.168.11.129
  52.168.138.134
@@ -127568,7 +120632,6 @@
  52.169.137.135
  52.169.159.90
  52.169.184.206
-52.169.204.119
  52.169.224.12
  52.169.231.15
  52.169.238.66
@@ -127590,42 +120653,39 @@
  52.17.98.211
  52.170.1.130
  52.170.145.93
+52.170.154.153
  52.170.2.45
  52.170.2.8
  52.170.204.40
  52.170.207.230
  52.170.248.124
  52.170.44.161
+52.170.46.39
  52.170.72.140
  52.171.198.169
  52.171.211.43
+52.171.34.184
  52.172.133.147
  52.172.157.44
-52.172.182.11
-52.172.194.247
-52.172.218.96
  52.172.39.41
-52.172.4.141
  52.172.46.238
  52.172.49.158
  52.173.143.59
  52.173.37.67
  52.173.74.94
-52.174.107.119
  52.174.143.11
  52.174.154.83
  52.174.162.66
-52.174.197.18
  52.174.236.181
  52.174.86.197
  52.175.150.108
  52.175.201.251
  52.175.214.30
  52.175.217.141
-52.175.229.221
  52.175.239.154
  52.175.245.207
  52.175.250.50
+52.175.57.208
  52.176.44.70
  52.176.45.66
  52.176.5.136
@@ -127635,14 +120695,12 @@
  52.177.173.19
  52.177.187.62
  52.177.204.195
-52.177.218.15
  52.177.63.152
  52.177.67.238
-52.178.134.11
  52.178.166.4
  52.178.74.26
-52.179.18.244
-52.179.208.169
+52.179.10.117
+52.179.190.233
  52.179.7.104
  52.18.100.70
  52.18.140.176
@@ -127663,7 +120721,6 @@
  52.18.74.70
  52.18.93.108
  52.18.96.122
-52.180.168.48
  52.183.143.164
  52.183.29.122
  52.183.36.137
@@ -127677,10 +120734,9 @@
  52.184.25.218
  52.184.27.87
  52.185.160.122
-52.185.170.115
  52.185.173.240
  52.185.205.1
-52.185.206.79
+52.186.11.118
  52.186.13.110
  52.186.139.119
  52.186.139.193
@@ -127690,35 +120746,27 @@
  52.186.161.95
  52.186.168.228
  52.186.84.111
-52.187.107.50
-52.187.107.66
  52.187.117.17
  52.187.121.163
  52.187.130.77
-52.187.132.240
-52.187.175.223
  52.187.56.107
  52.188.0.112
  52.188.113.116
  52.188.121.92
-52.188.144.216
  52.188.144.67
-52.188.145.22
  52.188.147.170
  52.188.15.144
  52.188.153.135
  52.188.17.49
  52.188.172.62
  52.188.173.238
-52.188.174.102
-52.188.204.215
+52.188.2.141
  52.188.206.190
  52.188.49.145
  52.188.54.163
  52.188.62.199
  52.188.69.174
  52.188.9.234
-52.189.219.87
  52.189.224.153
  52.19.127.128
  52.19.136.130
@@ -127732,15 +120780,12 @@
  52.19.75.131
  52.19.80.88
  52.19.87.193
-52.191.134.23
  52.191.135.197
  52.191.137.182
-52.191.14.95
+52.191.138.141
  52.191.163.162
  52.191.164.137
  52.191.166.171
-52.191.173.54
-52.191.174.199
  52.191.184.80
  52.191.254.47
  52.192.233.133
@@ -127773,7 +120818,6 @@
  52.201.156.205
  52.201.168.117
  52.201.213.138
-52.201.215.175
  52.201.233.86
  52.201.237.186
  52.201.245.248
@@ -127799,7 +120843,6 @@
  52.205.251.56
  52.205.252.146
  52.205.253.80
-52.205.52.8
  52.205.63.185
  52.205.63.186
  52.205.63.187
@@ -127813,7 +120856,6 @@
  52.207.210.41
  52.207.215.127
  52.207.217.145
-52.207.232.2
  52.207.244.140
  52.207.249.12
  52.207.90.161
@@ -127878,8 +120920,6 @@
  52.216.176.45
  52.216.184.165
  52.217.4.38
-52.22.92.110
-52.220.107.132
  52.220.26.62
  52.221.178.246
  52.221.182.149
@@ -127888,25 +120928,22 @@
  52.221.188.170
  52.221.188.192
  52.221.188.21
-52.221.190.253
  52.221.190.254
  52.221.194.33
  52.221.196.86
  52.221.196.94
  52.221.203.250
-52.221.207.47
  52.221.207.95
  52.221.215.57
  52.221.217.53
-52.221.219.39
  52.221.220.84
-52.221.230.198
  52.221.235.57
  52.221.237.210
  52.221.237.237
  52.221.239.141
  52.221.241.178
  52.221.246.21
+52.221.254.146
  52.221.37.242
  52.221.96.166
  52.222.123.169
@@ -127918,14 +120955,12 @@
  52.222.83.158
  52.222.99.255
  52.224.126.72
-52.224.13.205
  52.224.164.31
  52.224.176.178
  52.224.240.150
  52.224.66.246
  52.228.64.198
  52.229.121.159
-52.229.159.182
  52.229.159.234
  52.229.206.131
  52.229.52.83
@@ -127952,13 +120987,10 @@
  52.231.167.166
  52.231.201.248
  52.231.24.143
-52.231.25.195
  52.231.31.223
-52.231.54.157
  52.231.92.23
  52.232.131.17
  52.232.246.85
-52.232.40.230
  52.233.45.15
  52.234.224.154
  52.235.18.52
@@ -127966,9 +120998,7 @@
  52.235.33.148
  52.235.41.149
  52.235.57.242
-52.237.118.225
  52.237.165.184
-52.237.198.200
  52.237.198.242
  52.237.35.40
  52.237.76.206
@@ -127988,15 +121018,12 @@
  52.243.59.150
  52.243.59.86
  52.247.113.177
-52.247.124.192
-52.247.13.206
  52.247.194.12
  52.247.203.36
  52.247.242.84
  52.247.32.160
  52.247.5.19
  52.247.62.50
-52.249.176.231
  52.249.251.173
  52.25.100.167
  52.25.120.160
@@ -128007,32 +121034,23 @@
  52.25.22.228
  52.25.234.47
  52.25.237.167
-52.25.248.172
-52.25.3.158
  52.25.41.202
  52.25.81.249
  52.250.110.193
-52.250.15.227
  52.250.19.179
  52.251.122.62
  52.251.41.13
  52.251.89.82
  52.252.0.233
-52.252.106.242
-52.252.109.30
  52.252.118.108
  52.252.149.224
  52.252.149.83
  52.252.7.14
  52.254.21.159
-52.254.51.5
-52.254.84.141
  52.255.143.183
  52.255.145.245
  52.255.147.248
-52.255.149.161
  52.255.159.205
-52.255.160.246
  52.255.162.101
  52.255.167.164
  52.255.168.119
@@ -128046,7 +121064,6 @@
  52.26.213.125
  52.26.213.168
  52.26.231.30
-52.26.6.212
  52.26.73.79
  52.26.90.98
  52.26.94.102
@@ -128109,7 +121126,6 @@
  52.32.14.175
  52.32.151.246
  52.32.175.134
-52.32.184.145
  52.32.190.37
  52.32.227.216
  52.32.228.109
@@ -128316,7 +121332,6 @@
  52.55.145.210
  52.55.26.148
  52.55.55.225
-52.55.55.57
  52.56.129.223
  52.56.131.44
  52.56.177.155
@@ -128410,12 +121425,11 @@
  52.64.208.82
  52.65.123.63
  52.65.124.200
+52.65.9.93
  52.66.166.112
  52.66.175.84
  52.66.198.66
  52.66.203.211
-52.66.204.102
-52.66.89.157
  52.67.135.8
  52.67.18.175
  52.67.242.2
@@ -128427,7 +121441,6 @@
  52.7.132.235
  52.7.223.23
  52.7.242.207
-52.7.29.53
  52.70.119.124
  52.70.129.232
  52.70.144.244
@@ -128450,7 +121463,6 @@
  52.76.234.230
  52.76.3.43
  52.77.156.14
-52.77.203.212
  52.77.210.2
  52.77.221.65
  52.77.224.177
@@ -128459,7 +121471,6 @@
  52.77.229.203
  52.77.232.238
  52.77.233.168
-52.77.239.20
  52.77.243.47
  52.78.107.210
  52.78.108.196
@@ -128494,14 +121505,9 @@
  52.8.83.81
  52.80.223.199
  52.80.245.201
-52.80.50.144
  52.80.58.248
-52.81.208.12
  52.81.248.215
-52.81.39.140
  52.81.56.33
-52.82.100.177
-52.82.58.193
  52.86.11.253
  52.86.176.3
  52.87.117.72
@@ -128539,9 +121545,7 @@
  52.88.210.48
  52.88.40.28
  52.88.61.136
-52.88.77.4
  52.89.103.221
-52.89.115.194
  52.89.150.155
  52.89.190.35
  52.89.235.254
@@ -128557,7 +121561,6 @@
  52.90.100.167
  52.90.106.50
  52.90.202.39
-52.90.211.135
  52.90.212.201
  52.90.231.255
  52.90.43.54
@@ -128631,7 +121634,6 @@
  53bd1jlpoqoivnq.sted.cc
  53d734c934b2f8a9b2c6342a06cef40fd75ce61d.info
  54.144.146.181
-54.144.220.228
  54.144.25.149
  54.144.25.178
  54.144.91.180
@@ -128681,13 +121683,13 @@
  54.149.195.17
  54.149.216.165
  54.149.225.220
+54.149.235.139
  54.149.238.229
  54.149.245.167
  54.149.253.167
  54.149.72.167
  54.149.77.6
  54.149.85.173
-54.151.3.183
  54.151.4.73
  54.152.103.104
  54.152.118.146
@@ -128705,7 +121707,6 @@
  54.153.120.224
  54.153.214.107
  54.153.5.104
-54.153.86.214
  54.153.94.156
  54.154.104.217
  54.154.173.134
@@ -128741,7 +121742,6 @@
  54.159.221.201
  54.159.237.129
  54.159.24.235
-54.160.107.74
  54.160.137.46
  54.160.181.152
  54.160.91.239
@@ -128754,7 +121754,6 @@
  54.161.67.194
  54.161.79.141
  54.162.108.115
-54.162.155.109
  54.162.158.198
  54.162.48.19
  54.162.88.156
@@ -128815,7 +121814,6 @@
  54.169.27.112
  54.169.33.195
  54.169.76.68
-54.169.79.161
  54.169.8.123
  54.169.9.44
  54.169.98.151
@@ -128869,13 +121867,13 @@
  54.174.83.249
  54.175.103.155
  54.175.130.245
-54.175.145.27
  54.175.148.135
  54.175.151.236
  54.175.199.188
  54.175.230.166
  54.175.242.98
  54.175.248.246
+54.175.28.78
  54.175.29.6
  54.175.72.156
  54.175.93.145
@@ -128888,15 +121886,11 @@
  54.178.157.112
  54.178.207.38
  54.179.1.51
-54.179.133.202
-54.179.134.17
  54.179.160.149
  54.179.177.183
-54.179.179.201
  54.180.137.207
  54.180.143.88
  54.180.146.55
-54.183.104.36
  54.183.113.171
  54.183.120.61
  54.183.120.75
@@ -128904,7 +121898,6 @@
  54.183.129.80
  54.183.13.28
  54.183.142.219
-54.183.154.81
  54.183.155.178
  54.183.161.206
  54.183.169.192
@@ -128921,7 +121914,6 @@
  54.184.20.64
  54.184.22.217
  54.184.246.214
-54.184.43.29
  54.185.108.174
  54.185.121.52
  54.185.134.34
@@ -128937,25 +121929,21 @@
  54.186.240.17
  54.186.244.149
  54.186.34.136
-54.186.68.50
  54.187.117.98
  54.187.154.214
  54.187.172.238
  54.187.209.170
  54.187.209.53
  54.187.211.30
-54.187.225.131
  54.187.231.46
  54.187.254.124
  54.187.53.138
  54.187.97.161
-54.188.106.141
  54.188.160.243
  54.188.180.102
  54.189.184.168
  54.189.196.167
  54.189.69.226
-54.189.74.250
  54.190.164.29
  54.190.2.74
  54.190.218.83
@@ -128964,7 +121952,6 @@
  54.190.38.179
  54.190.60.185
  54.190.63.200
-54.190.85.98
  54.191.100.103
  54.191.103.168
  54.191.132.149
@@ -128976,7 +121963,6 @@
  54.191.239.193
  54.191.27.18
  54.191.69.79
-54.193.0.73
  54.193.102.124
  54.193.21.31
  54.193.216.255
@@ -129024,7 +122010,6 @@
  54.199.164.163
  54.199.173.66
  54.199.31.91
-54.199.45.55
  54.200.0.21
  54.200.126.149
  54.200.145.18
@@ -129093,7 +122078,6 @@
  54.204.71.240
  54.204.92.105
  54.205.112.93
-54.205.135.198
  54.205.16.153
  54.205.184.74
  54.205.203.140
@@ -129101,6 +122085,7 @@
  54.205.244.248
  54.205.4.133
  54.205.57.98
+54.206.135.25
  54.206.217.88
  54.207.103.100
  54.207.112.141
@@ -129124,7 +122109,6 @@
  54.210.222.174
  54.211.111.188
  54.211.118.177
-54.211.137.101
  54.211.149.59
  54.211.2.83
  54.211.30.171
@@ -129157,7 +122141,7 @@
  54.214.124.68
  54.214.126.186
  54.214.137.101
-54.214.151.169
+54.214.150.147
  54.214.163.35
  54.214.196.93
  54.214.197.107
@@ -129168,13 +122152,11 @@
  54.215.1.130
  54.215.117.219
  54.215.19.78
-54.215.206.99
  54.215.218.133
  54.215.229.110
  54.215.56.201
  54.216.107.216
  54.216.162.102
-54.216.227.92
  54.217.136.122
  54.217.30.92
  54.218.10.179
@@ -129185,7 +122167,6 @@
  54.218.179.141
  54.218.18.131
  54.218.204.204
-54.218.204.31
  54.218.22.223
  54.218.221.167
  54.218.236.63
@@ -129212,8 +122193,6 @@
  54.221.27.148
  54.221.84.53
  54.222.161.1
-54.222.217.21
-54.223.120.159
  54.223.61.142
  54.224.128.129
  54.224.130.89
@@ -129222,7 +122201,6 @@
  54.224.95.8
  54.225.107.110
  54.225.113.207
-54.225.63.82
  54.226.178.241
  54.226.19.210
  54.226.203.78
@@ -129259,7 +122237,6 @@
  54.234.255.239
  54.234.38.217
  54.234.63.235
-54.234.74.41
  54.235.20.153
  54.235.232.110
  54.235.237.165
@@ -129301,6 +122278,7 @@
  54.242.58.140
  54.242.80.51
  54.243.100.79
+54.243.213.174
  54.243.22.192
  54.243.3.112
  54.243.92.3
@@ -129327,19 +122305,15 @@
  54.245.155.47
  54.245.155.78
  54.245.155.81
-54.245.167.122
  54.245.180.77
-54.245.199.243
  54.245.223.205
  54.245.37.134
-54.245.38.46
  54.245.49.155
  54.245.51.27
  54.245.55.114
  54.245.75.3
  54.246.224.246
  54.247.184.250
-54.248.102.20
  54.249.206.111
  54.249.59.190
  54.251.134.94
@@ -129350,19 +122324,15 @@
  54.251.65.228
  54.252.149.96
  54.252.194.142
-54.252.231.158
  54.253.15.33
-54.254.140.76
  54.254.144.51
  54.254.155.189
  54.254.163.190
  54.254.164.81
  54.254.181.28
-54.254.183.101
  54.254.203.106
  54.254.213.170
  54.254.218.44
-54.254.233.196
  54.254.24.192
  54.254.67.231
  54.254.75.70
@@ -129375,18 +122345,13 @@
  54.255.223.29
  54.255.234.79
  54.255.73.190
-54.255.94.23
  54.36.108.162
  54.36.109.237
  54.36.112.254
  54.36.117.1
  54.36.120.120
  54.36.123.206
-54.36.148.63
-54.36.149.20
-54.36.159.106
-54.36.163.141
-54.36.163.142
+54.36.148.74
  54.36.164.130
  54.36.165.239
  54.36.165.34
@@ -129394,51 +122359,33 @@
  54.36.172.26
  54.36.177.3
  54.36.180.236
-54.36.182.244
+54.36.181.100
  54.36.185.106
  54.36.185.108
  54.36.185.139
-54.36.189.113
  54.36.19.138
  54.36.190.245
  54.36.205.105
  54.36.230.40
  54.36.232.247
  54.36.241.186
-54.36.33.58
  54.36.4.19
  54.36.4.98
  54.36.42.250
-54.36.49.125
  54.36.61.64
  54.36.62.114
  54.36.81.28
-54.36.98.129
  54.37.0.57
  54.37.11.58
-54.37.121.239
-54.37.13.107
  54.37.130.135
  54.37.131.204
-54.37.136.213
-54.37.136.87
-54.37.138.225
-54.37.14.3
  54.37.141.106
  54.37.143.192
-54.37.149.233
  54.37.150.194
-54.37.151.239
-54.37.153.80
  54.37.154.113
-54.37.154.248
  54.37.156.188
-54.37.157.88
  54.37.159.12
-54.37.159.45
  54.37.16.241
-54.37.163.11
-54.37.165.17
  54.37.17.21
  54.37.180.130
  54.37.19.108
@@ -129453,43 +122400,34 @@
  54.37.194.43
  54.37.197.64
  54.37.197.67
-54.37.204.154
  54.37.204.183
  54.37.205.241
  54.37.209.37
  54.37.21.211
  54.37.224.163
-54.37.224.62
-54.37.226.123
-54.37.229.128
  54.37.232.108
  54.37.232.115
-54.37.233.192
  54.37.235.108
  54.37.235.183
+54.37.240.253
  54.37.253.161
  54.37.253.178
  54.37.254.11
  54.37.42.48
  54.37.64.149
  54.37.64.178
-54.37.65.3
  54.37.66.7
  54.37.68.191
-54.37.68.33
  54.37.70.24
  54.37.71.203
  54.37.71.204
  54.37.71.207
-54.37.71.235
-54.37.75.158
  54.37.75.210
  54.37.77.236
  54.37.78.107
  54.37.79.48
  54.37.79.7
  54.37.85.202
-54.37.86.192
  54.38.110.35
  54.38.123.225
  54.38.123.235
@@ -129499,28 +122437,18 @@
  54.38.143.245
  54.38.143.246
  54.38.148.185
-54.38.155.245
  54.38.156.28
  54.38.156.63
-54.38.158.17
  54.38.158.224
-54.38.159.56
-54.38.167.129
  54.38.177.175
  54.38.177.230
  54.38.18.211
-54.38.180.185
-54.38.180.53
  54.38.180.93
  54.38.183.181
  54.38.185.131
  54.38.186.173
  54.38.186.60
  54.38.186.84
-54.38.187.5
-54.38.188.105
-54.38.188.118
-54.38.188.93
  54.38.190.187
  54.38.190.48
  54.38.191.85
@@ -129534,14 +122462,11 @@
  54.38.236.24
  54.38.237.0
  54.38.237.6
-54.38.240.23
  54.38.240.34
  54.38.241.162
-54.38.242.206
  54.38.253.1
-54.38.33.178
  54.38.36.210
-54.38.42.63
+54.38.4.8
  54.38.49.46
  54.38.52.137
  54.38.53.251
@@ -129551,7 +122476,6 @@
  54.38.65.127
  54.38.65.215
  54.38.65.55
-54.38.70.93
  54.38.81.231
  54.38.82.57
  54.38.94.63
@@ -129563,18 +122487,15 @@
  54.39.131.45
  54.39.133.203
  54.39.133.91
-54.39.138.246
-54.39.138.249
-54.39.138.251
  54.39.145.123
  54.39.147.2
  54.39.149.152
-54.39.151.44
  54.39.156.171
-54.39.16.153
  54.39.16.26
  54.39.16.73
+54.39.17.3
  54.39.172.214
+54.39.19.50
  54.39.197.109
  54.39.215.23
  54.39.215.32
@@ -129592,7 +122513,6 @@
  54.39.237.154
  54.39.237.156
  54.39.237.157
-54.39.238.84
  54.39.243.49
  54.39.247.141
  54.39.40.35
@@ -129600,7 +122520,6 @@
  54.39.50.204
  54.39.66.201
  54.39.68.254
-54.39.7.70
  54.39.72.83
  54.39.94.188
  54.39.98.233
@@ -129617,7 +122536,6 @@
  54.67.20.148
  54.67.29.114
  54.67.33.184
-54.67.39.30
  54.67.7.134
  54.68.135.82
  54.68.152.243
@@ -129650,7 +122568,6 @@
  54.76.241.64
  54.76.45.143
  54.77.11.114
-54.77.121.239
  54.77.21.77
  54.77.210.148
  54.77.216.217
@@ -129670,11 +122587,13 @@
  54.81.213.161
  54.81.223.190
  54.81.58.144
+54.82.113.212
  54.82.185.0
  54.82.194.154
  54.82.227.198
  54.82.229.41
  54.82.237.124
+54.82.72.6
  54.83.140.45
  54.83.141.106
  54.83.149.13
@@ -129711,7 +122630,6 @@
  54.87.250.249
  54.87.80.90
  54.87.90.203
-54.88.107.179
  54.88.147.198
  54.88.220.157
  54.88.255.250
@@ -129760,7 +122678,6 @@
  54.93.87.122
  54.93.91.251
  54.93.96.87
-54.94.250.84
  54.95.0.160
  54.95.190.219
  54.95.39.208
@@ -129808,6 +122725,7 @@
  55sabpa156hunzlktx.000webhostapp.com
  55tupro.com
  56053f86f376b88b00c51e7264a835894d884a71.info
+561a64443c3279181.temporary.link
  562336.realestate-page-43418697691-veganomundo.com
  563j.com
  564984165165.com
@@ -129835,9 +122753,9 @@
  57bofa75.bofa0serivceb.com
  57d3e30e.duckdns.org
  57vd9.app.link
-58.102.31.36
-58.106.192.132
-58.106.192.49
+58.106.192.109
+58.106.192.135
+58.106.192.81
  58.108.233.121
  58.11.163.174
  58.11.29.131
@@ -129866,7 +122784,6 @@
  58.120.27.153
  58.121.108.44
  58.122.119.36
-58.124.169.148
  58.124.180.125
  58.124.248.42
  58.125.191.4
@@ -129874,13 +122791,11 @@
  58.126.223.166
  58.126.42.93
  58.127.186.231
-58.127.98.156
  58.130.120.224
  58.131.104.7
  58.132.203.179
  58.137.160.183
  58.137.160.94
-58.137.218.6
  58.140.67.144
  58.141.122.109
  58.141.144.18
@@ -129894,17 +122809,13 @@
  58.142.200.124bin.sh
  58.142.231.188
  58.142.243.112
-58.142.54.2
  58.142.60.80
-58.143.116.179
  58.143.142.142
  58.143.189.75
  58.143.198.47
  58.143.198.47bin.sh
-58.143.41.144
  58.144.208.152
  58.145.1.198
-58.146.200.33
  58.146.211.140
  58.146.221.133
  58.146.230.24
@@ -129964,12 +122875,9 @@
  58.153.62.86
  58.153.63.208
  58.158.0.86
-58.16.145.208
  58.16.186.6
-58.16.187.26
  58.16.204.238
  58.16.209.251
-58.16.221.245
  58.16.34.3
  58.16.48.190
  58.162.143.57
@@ -129977,11 +122885,8 @@
  58.162.229.173
  58.163.156.65
  58.167.160.142
-58.17.121.220
  58.17.185.231
  58.17.200.197
-58.17.243.151
-58.17.250.96
  58.17.43.15
  58.17.58.103
  58.17.81.70
@@ -129991,16 +122896,17 @@
  58.171.38.26
  58.176.167.115
  58.176.213.64
+58.176.226.23
  58.176.43.99
  58.176.45.132
  58.176.70.47
  58.177.13.195
  58.177.139.102
+58.177.144.89
  58.177.46.171
  58.177.5.220
  58.177.86.10
  58.177.91.169
-58.178.197.169
  58.179.129.102
  58.179.192.105
  58.179.21.69
@@ -130012,7 +122918,6 @@
  58.18.133.165
  58.18.149.136
  58.18.172.102
-58.18.200.241
  58.18.215.26
  58.18.35.20
  58.18.36.130
@@ -130033,6 +122938,7 @@
  58.182.39.210
  58.182.67.11
  58.182.69.38
+58.182.72.92
  58.184.252.3
  58.185.183.60
  58.186.102.106
@@ -130051,7 +122957,6 @@
  58.186.58.65
  58.186.64.12
  58.186.68.14
-58.186.75.103
  58.186.79.9
  58.187.115.69
  58.187.117.207
@@ -130068,19 +122973,19 @@
  58.187.209.93
  58.187.22.51
  58.187.22.53
+58.187.230.37
  58.187.30.99
  58.187.57.100
+58.187.58.148
  58.187.88.252
  58.187.97.200
  58.187.97.233
-58.19.160.143
  58.19.180.59
  58.19.246.22
  58.191.20.194
  58.196.135.54
  58.20.108.76
  58.20.128.66
-58.20.129.76
  58.20.231.162
  58.20.243.15
  58.20.248.119
@@ -130088,9 +122993,7 @@
  58.20.30.100
  58.20.30.77
  58.20.41.53
-58.20.52.71
  58.20.52.90
-58.20.52.99
  58.20.54.143
  58.20.91.67
  58.208.14.219
@@ -130105,17 +123008,14 @@
  58.21.144.244
  58.21.187.169
  58.21.234.93
+58.21.247.227
  58.21.249.47
  58.21.9.241
  58.210.128.130
-58.210.154.140
  58.210.163.242
  58.210.172.118
  58.210.173.182
-58.210.190.30
  58.210.193.22
-58.210.197.234
-58.210.197.238
  58.210.200.82
  58.210.207.141
  58.210.239.86
@@ -130124,16 +123024,13 @@
  58.210.38.210
  58.210.49.222
  58.210.64.98
-58.210.77.245
  58.210.82.238
  58.210.82.250
  58.210.88.98
  58.210.89.180
  58.211.134.18
  58.211.134.98
-58.211.144.220
  58.211.153.58
-58.211.191.20
  58.211.199.156
  58.211.199.157
  58.211.222.162
@@ -130145,7 +123042,6 @@
  58.211.55.206
  58.211.82.170
  58.211.91.18
-58.211.96.178
  58.211.96.226
  58.212.103.19
  58.212.59.53
@@ -130157,7 +123053,7 @@
  58.213.155.227
  58.213.189.227
  58.213.189.35
-58.213.198.74
+58.213.26.18
  58.213.48.218
  58.213.48.219
  58.213.51.35
@@ -130173,14 +123069,13 @@
  58.213.91.11
  58.213.91.12
  58.213.91.13
-58.213.91.18
  58.213.91.6
  58.213.91.7
  58.213.91.8
  58.213.91.9
+58.214.0.42
  58.214.10.242
  58.214.11.123
-58.214.189.107
  58.214.254.57
  58.214.27.130
  58.214.36.86
@@ -130188,10 +123083,8 @@
  58.215.10.98
  58.215.120.178
  58.215.120.180
-58.215.121.36
  58.215.142.167
  58.215.182.162
-58.215.186.183
  58.215.201.86
  58.215.221.82
  58.215.235.146
@@ -130227,7 +123120,6 @@
  58.216.176.214
  58.216.199.243
  58.216.199.246
-58.216.202.62
  58.216.207.110
  58.216.216.74
  58.216.51.206
@@ -130250,8 +123142,8 @@
  58.218.199.80
  58.218.200.199
  58.218.200.95
-58.218.201.132
  58.218.204.51
+58.218.239.164
  58.218.239.75
  58.218.251.214
  58.218.26.111
@@ -130268,13 +123160,11 @@
  58.220.10.171
  58.220.109.222
  58.220.204.246
-58.220.232.9
  58.220.248.189
  58.220.25.132
  58.220.25.155
  58.220.25.2
  58.220.33.99
-58.220.39.133
  58.220.39.196
  58.220.39.204
  58.220.39.205
@@ -130287,7 +123177,7 @@
  58.220.56.3
  58.220.56.64
  58.220.87.226
-58.220.95.56
+58.220.95.78
  58.220.95.91
  58.220.95.92
  58.221.101.182
@@ -130318,6 +123208,7 @@
  58.221.47.236
  58.221.5.238
  58.221.55.195
+58.221.59.48
  58.221.60.119
  58.221.60.232
  58.221.62.191
@@ -130330,7 +123221,6 @@
  58.221.72.119
  58.221.72.168
  58.221.72.170
-58.221.84.90
  58.221.86.238
  58.221.92.122
  58.221.97.91
@@ -130361,7 +123251,6 @@
  58.229.208.244
  58.23.111.130
  58.23.122.244
-58.23.153.21
  58.23.222.242
  58.23.245.24
  58.23.247.73
@@ -130384,17 +123273,14 @@
  58.240.196.6
  58.240.217.78
  58.240.231.114
-58.240.54.136
  58.240.9.11
  58.240.96.50
  58.241.135.9
  58.241.150.125
  58.241.230.77
-58.241.58.150
  58.242.169.14
  58.242.197.25
  58.242.224.152
-58.242.30.32
  58.242.59.139
  58.242.99.10
  58.243.121.118
@@ -130430,10 +123316,8 @@
  58.244.98.9
  58.244.99.236
  58.245.169.185
-58.245.180.195
  58.245.217.14
  58.245.97.116
-58.246.124.194
  58.246.134.186
  58.246.136.250
  58.246.180.114
@@ -130441,16 +123325,16 @@
  58.246.4.50
  58.246.68.6
  58.246.71.26
+58.246.88.83
  58.246.88.84
  58.246.91.155
-58.246.94.230
  58.247.10.90
  58.247.120.118
  58.247.69.39
  58.248.104.122
+58.248.112.246
  58.248.117.15
  58.248.145.35
-58.248.150.137
  58.248.17.84
  58.248.173.230
  58.248.208.148
@@ -130458,40 +123342,35 @@
  58.248.225.28
  58.248.83.223
  58.248.99.230
-58.249.13.109
-58.249.18.213
-58.249.22.206
-58.249.55.68
-58.250.0.73
-58.250.164.150
+58.249.11.129
+58.249.13.165
+58.249.21.64
+58.249.73.74
  58.250.176.94
  58.250.21.56
  58.250.250.161
  58.250.27.18
  58.250.40.54
  58.250.44.53
-58.250.89.46
  58.251.218.28
  58.251.218.97
  58.252.110.59
  58.252.135.50
  58.252.4.137
+58.252.66.190
  58.252.68.5
-58.252.8.115
+58.253.17.205
  58.254.220.116
  58.254.35.146
  58.254.35.178
+58.255.63.127
  58.255.77.17
  58.26.4.68
  58.26.9.234
  58.27.201.105
  58.27.207.42
-58.27.213.9
-58.27.231.67
  58.27.247.70
-58.27.90.166
  58.27.95.2
-58.27.99.112
  58.29.20.121
  58.29.26.73
  58.29.84.41
@@ -130502,16 +123381,15 @@
  58.32.217.195
  58.32.252.162
  58.33.107.221
+58.33.114.50
  58.33.114.54
  58.33.118.50
  58.33.124.4
  58.33.158.12
  58.33.160.139
-58.33.166.187
  58.33.174.50
  58.33.174.83
  58.33.183.225
-58.33.31.172
  58.33.31.82
  58.33.35.82
  58.33.49.196
@@ -130525,19 +123403,14 @@
  58.37.183.99
  58.37.204.241
  58.37.21.252
-58.37.213.74
-58.37.214.154
-58.37.225.126
  58.37.36.163
  58.37.56.83
  58.37.58.49
  58.39.143.22
  58.39.177.96
  58.40.124.174
-58.40.142.226
  58.40.66.114
  58.40.66.150
-58.40.86.138
  58.42.193.33
  58.42.195.137
  58.42.208.205
@@ -130545,7 +123418,6 @@
  58.42.237.24
  58.42.238.188
  58.42.241.254
-58.44.148.127
  58.44.193.117
  58.44.193.13
  58.44.193.90
@@ -130559,7 +123431,6 @@
  58.46.66.57
  58.48.103.238
  58.48.109.62
-58.48.152.45
  58.48.160.162
  58.48.168.166
  58.48.84.6
@@ -130568,7 +123439,6 @@
  58.49.116.78
  58.49.147.37
  58.49.147.7
-58.49.160.175
  58.49.210.174
  58.49.210.194
  58.49.24.100
@@ -130584,22 +123454,18 @@
  58.49.94.230
  58.50.131.7
  58.51.62.109
-58.51.94.54
  58.52.120.202
  58.52.179.215
  58.53.128.136
  58.53.128.61
-58.53.93.57
-58.54.249.210
+58.53.146.36
  58.55.100.45
  58.55.48.181
  58.55.50.141
  58.56.112.167
-58.56.140.242
  58.56.140.62
  58.56.164.66
  58.56.166.66
-58.56.200.58
  58.56.22.117
  58.56.32.238
  58.56.40.210
@@ -130607,12 +123473,10 @@
  58.56.51.208
  58.56.56.174
  58.56.66.199
-58.56.83.240
  58.57.100.34
  58.57.15.29
  58.57.18.70
  58.57.182.202
-58.57.183.170
  58.57.38.150
  58.57.4.199
  58.57.4.238
@@ -130630,24 +123494,21 @@
  58.60.109.242
  58.60.232.220
  58.60.232.221
-58.61.141.41
+58.61.140.144
  58.61.142.194
  58.61.28.210
  58.61.38.185
+58.61.51.195
  58.62.18.194
-58.62.207.50
-58.62.207.52
  58.63.128.250
  58.63.245.235
  58.63.246.93
  58.64.129.145
  58.64.129.15
-58.64.129.5
  58.64.136.6
  58.64.155.101
  58.64.157.136
  58.64.158.186
-58.64.167.7
  58.64.171.69
  58.64.178.77
  58.64.193.132
@@ -130657,7 +123518,6 @@
  58.64.200.176
  58.64.200.178
  58.64.204.170
-58.64.215.151
  58.65.136.170
  58.65.153.246
  58.65.160.103
@@ -130667,8 +123527,6 @@
  58.65.218.108
  58.65.218.138
  58.65.74.28
-58.67.221.184
-58.68.234.182
  58.69.161.161
  58.69.161.45
  58.69.165.197
@@ -130683,11 +123541,11 @@
  58.71.29.162
  58.71.56.2
  58.71.87.58
-58.72.165.20
  58.72.165.43
  58.74.76.18
  58.74.76.19
  58.75.126.235
+58.76.151.189
  58.76.151.51
  58.76.162.134
  58.76.165.110
@@ -130699,15 +123557,14 @@
  58.79.249.220
  58.79.4.230
  58.79.77.159
-58.8.141.249
  58.8.141.42
  58.8.143.108
+58.8.143.230
  58.8.2.250
  58.8.218.53
  58.8.232.214
  58.8.78.89
  58.80.109.59
-58.82.151.242
  58.82.170.50
  58.82.170.6
  58.82.212.192
@@ -130720,7 +123577,6 @@
  58.84.31.133
  58.84.31.149
  58.84.31.169
-58.84.31.17
  58.84.31.173
  58.84.31.201
  58.84.31.209
@@ -130728,15 +123584,12 @@
  58.84.31.217
  58.84.31.25
  58.84.31.33
-58.84.31.41
  58.84.31.57
  58.84.31.65
-58.84.31.81
  58.84.31.9
  58.84.31.97
  58.87.106.44
  58.87.108.16
-58.87.110.106
  58.87.110.244
  58.87.113.103
  58.87.114.13
@@ -130752,16 +123605,12 @@
  58.87.57.132
  58.87.65.57
  58.87.65.87
-58.87.66.249
  58.87.66.82
  58.87.67.126
  58.87.67.159
  58.87.67.226
-58.87.68.211
  58.87.69.15
-58.87.70.210
  58.87.72.225
-58.87.75.178
  58.87.75.219
  58.87.76.77
  58.87.77.59
@@ -130772,16 +123621,13 @@
  58.87.88.72
  58.87.90.156
  58.87.94.75
-58.87.97.166
  58.9.182.62
  58.9.45.27
  58.9.99.67
  58.96.175.218
-58.96.21.92
  58.96.211.50
  58.96.87.111
  58.97.195.80
-58.97.199.138
  58.97.201.228
  58.97.203.208
  58.97.205.164
@@ -130794,7 +123640,6 @@
  58.97.228.85
  58.97.228.94
  58.97.230.162
-58.97.230.18
  58.97.59.204
  58.97.72.83
  58.97.8.10
@@ -130834,8 +123679,8 @@
  59.1.174.31
  59.1.241.138
  59.1.28.42
+59.10.1.159
  59.10.157.106
-59.10.5.156
  59.10.99.194
  59.100.12.173
  59.100.168.219
@@ -130846,15 +123691,12 @@
  59.103.122.74
  59.103.138.87
  59.103.164.174
-59.103.203.241
  59.103.254.36
  59.104.192.30
  59.106.141.147
  59.106.171.70
-59.108.143.83
  59.108.35.198
  59.108.53.146
-59.108.66.247
  59.108.94.125
  59.11.107.13
  59.11.127.119
@@ -130870,16 +123712,14 @@
  59.11.215.130
  59.11.224.245
  59.11.248.116
+59.11.49.4
  59.110.0.79
  59.110.1.58
  59.110.12.12
  59.110.12.129
  59.110.152.98
  59.110.153.239
-59.110.159.125
-59.110.216.153
  59.110.218.147
-59.110.232.197
  59.110.50.141
  59.110.54.10
  59.111.103.165
@@ -130891,7 +123731,6 @@
  59.115.121.197
  59.115.127.208
  59.115.36.115
-59.115.37.225
  59.12.114.123
  59.12.173.227
  59.12.175.208
@@ -130899,17 +123738,14 @@
  59.120.120.1
  59.120.143.120
  59.120.154.13
-59.120.189.230
  59.120.189.234
  59.120.19.198
  59.120.192.91
  59.120.20.152
  59.120.212.241
  59.120.221.107
-59.120.227.134
+59.120.231.151
  59.120.239.204
-59.120.244.230
-59.120.249.3
  59.120.5.154
  59.120.51.157
  59.120.51.68
@@ -130917,10 +123753,11 @@
  59.120.55.33
  59.120.91.73
  59.120.95.244
-59.120.97.108
  59.120.97.131
  59.124.108.82
  59.124.126.108
+59.124.139.7
+59.124.156.130
  59.124.159.4
  59.124.168.155
  59.124.170.48
@@ -130947,23 +123784,20 @@
  59.124.74.53
  59.124.74.56
  59.124.84.112
-59.124.90.112
  59.124.90.113
-59.124.90.231
  59.124.93.169
  59.124.94.145
  59.125.131.111
  59.125.142.63
  59.125.145.88
-59.125.155.188
-59.125.160.248
  59.125.179.172
  59.125.179.173
  59.125.185.252
  59.125.187.220
  59.125.189.76
  59.125.196.15
-59.125.200.51
+59.125.2.121
+59.125.2.63
  59.125.204.199
  59.125.213.86
  59.125.214.115
@@ -130988,10 +123822,12 @@
  59.126.0.8
  59.126.1.160
  59.126.1.251
+59.126.1.71
  59.126.10.11
  59.126.10.235
  59.126.100.130
  59.126.100.240
+59.126.100.30
  59.126.102.96
  59.126.104.54
  59.126.104.9
@@ -131013,7 +123849,6 @@
  59.126.116.37
  59.126.119.133
  59.126.119.185
-59.126.12.71
  59.126.123.238
  59.126.124.201
  59.126.125.198
@@ -131039,7 +123874,6 @@
  59.126.148.236
  59.126.149.208
  59.126.15.5
-59.126.151.78
  59.126.152.146
  59.126.152.28
  59.126.153.75
@@ -131061,12 +123895,14 @@
  59.126.164.111
  59.126.164.45
  59.126.164.65
+59.126.167.171
  59.126.168.147
  59.126.168.192
  59.126.169.188
  59.126.169.60
  59.126.17.102
  59.126.170.121
+59.126.170.152
  59.126.170.234
  59.126.171.70
  59.126.172.201
@@ -131074,7 +123910,6 @@
  59.126.174.200
  59.126.176.246
  59.126.176.34
-59.126.177.171
  59.126.177.66
  59.126.178.22
  59.126.179.191
@@ -131126,7 +123961,6 @@
  59.126.211.238
  59.126.212.218
  59.126.212.61
-59.126.213.154
  59.126.213.67
  59.126.214.135
  59.126.214.249
@@ -131140,6 +123974,7 @@
  59.126.22.118
  59.126.22.127
  59.126.22.160
+59.126.22.243
  59.126.220.175
  59.126.221.124
  59.126.223.157
@@ -131147,6 +123982,7 @@
  59.126.224.211
  59.126.224.65
  59.126.228.123
+59.126.228.233
  59.126.228.69
  59.126.23.39
  59.126.230.11
@@ -131203,6 +124039,7 @@
  59.126.35.23
  59.126.37.211
  59.126.37.27
+59.126.38.151
  59.126.38.199
  59.126.38.35
  59.126.39.118
@@ -131229,7 +124066,6 @@
  59.126.57.157
  59.126.58.152
  59.126.58.62
-59.126.6.190
  59.126.60.100
  59.126.60.88
  59.126.61.14
@@ -131247,7 +124083,6 @@
  59.126.72.247
  59.126.72.4
  59.126.73.37
-59.126.74.104
  59.126.76.12
  59.126.79.33
  59.126.8.12
@@ -131279,7 +124114,6 @@
  59.126.95.119
  59.126.97.128
  59.126.99.96
-59.127.1.12
  59.127.10.102
  59.127.10.30
  59.127.102.103
@@ -131297,6 +124131,7 @@
  59.127.112.98
  59.127.114.146
  59.127.115.240
+59.127.116.238
  59.127.119.166
  59.127.119.213
  59.127.119.4
@@ -131316,7 +124151,6 @@
  59.127.130.244
  59.127.130.99
  59.127.131.106
-59.127.131.146
  59.127.131.230
  59.127.131.65
  59.127.133.132
@@ -131346,7 +124180,6 @@
  59.127.152.29
  59.127.153.208
  59.127.153.35
-59.127.153.57
  59.127.155.164
  59.127.155.211
  59.127.156.126
@@ -131395,7 +124228,6 @@
  59.127.192.55
  59.127.193.144
  59.127.194.167
-59.127.195.93
  59.127.196.232
  59.127.197.26
  59.127.197.48
@@ -131414,7 +124246,6 @@
  59.127.211.202
  59.127.211.252
  59.127.213.18
-59.127.213.249
  59.127.217.127
  59.127.217.202
  59.127.217.99
@@ -131434,6 +124265,7 @@
  59.127.225.134
  59.127.225.189
  59.127.225.196
+59.127.225.228
  59.127.226.19
  59.127.227.40
  59.127.228.140
@@ -131491,6 +124323,7 @@
  59.127.51.206
  59.127.51.27
  59.127.52.44
+59.127.52.59
  59.127.53.80
  59.127.55.147
  59.127.55.212
@@ -131502,9 +124335,11 @@
  59.127.59.197
  59.127.60.3
  59.127.61.150
+59.127.61.232
  59.127.62.65
  59.127.62.82
  59.127.64.54
+59.127.64.75
  59.127.65.21
  59.127.65.78
  59.127.66.49
@@ -131537,7 +124372,6 @@
  59.127.92.227
  59.127.92.35
  59.127.93.103
-59.127.93.59
  59.127.94.85
  59.127.95.245
  59.127.96.179
@@ -131553,19 +124387,17 @@
  59.14.106.226
  59.14.204.17
  59.14.204.39
-59.14.34.130
  59.14.35.164
  59.14.48.55
  59.144.139.18
  59.144.48.34
  59.145.111.67
  59.145.221.103
-59.148.130.205
+59.147.165.20
  59.148.18.126
  59.148.18.13
  59.148.18.42
  59.148.19.1
-59.148.20.142
  59.148.20.65
  59.148.203.50
  59.148.253.194
@@ -131575,7 +124407,6 @@
  59.149.115.177
  59.149.135.248
  59.149.145.94
-59.149.152.242
  59.149.202.190
  59.149.205.222
  59.149.60.131
@@ -131591,10 +124422,8 @@
  59.151.199.157
  59.151.201.62
  59.151.205.154
-59.151.207.150
  59.151.208.34
  59.151.212.127
-59.151.219.183
  59.151.223.10
  59.151.224.169
  59.151.224.38
@@ -131602,6 +124431,7 @@
  59.151.236.62
  59.151.239.36
  59.151.245.158
+59.151.246.125
  59.151.246.19
  59.151.247.12
  59.151.249.7
@@ -131618,9 +124448,8 @@
  59.152.246.226
  59.152.251.30
  59.152.59.234
-59.152.62.189
  59.152.62.40
-59.152.98.163
+59.153.113.60
  59.153.121.161
  59.153.121.162
  59.153.121.164
@@ -131629,13 +124458,12 @@
  59.153.121.184
  59.153.121.188
  59.153.121.190
-59.153.17.186
  59.153.18.90
  59.153.84.253
  59.153.96.138
-59.153.97.133
  59.153.97.156
  59.156.74.162
+59.16.127.221
  59.16.133.69
  59.16.163.247
  59.16.203.131
@@ -131650,13 +124478,11 @@
  59.17.121.71
  59.17.53.198
  59.17.56.114
-59.172.61.66
  59.173.115.51
  59.173.12.166
  59.173.12.193
  59.173.12.194
  59.173.12.97
-59.173.123.47
  59.174.151.114
  59.174.51.108
  59.174.78.222
@@ -131664,7 +124490,6 @@
  59.175.142.10
  59.175.148.84
  59.175.148.91
-59.175.195.10
  59.175.228.60
  59.177.36.227
  59.177.36.77
@@ -131673,7 +124498,6 @@
  59.177.37.32
  59.177.39.166
  59.177.39.212
-59.177.75.52
  59.177.76.131
  59.177.76.158
  59.177.76.57
@@ -131695,7 +124519,7 @@
  59.18.193.139
  59.18.194.137
  59.18.234.87
-59.180.177.166
+59.180.148.109
  59.181.106.18
  59.181.121.95
  59.181.122.64bin.sh
@@ -131706,9 +124530,9 @@
  59.187.220.142
  59.187.241.176
  59.187.241.3
+59.187.242.46
  59.188.133.34
  59.188.221.251
-59.188.250.42
  59.188.254.70
  59.188.71.147
  59.188.73.200
@@ -131716,20 +124540,19 @@
  59.19.13.153
  59.19.150.135
  59.19.237.137
-59.19.255.104
  59.19.29.102
+59.19.61.171
  59.19.7.235
-59.19.79.107
  59.2.130.157
  59.2.148.57
  59.2.189.129
+59.2.42.166
  59.2.47.114
  59.2.52.25
  59.2.54.82
  59.2.57.163
  59.2.60.60
  59.20.217.160
-59.20.239.58
  59.20.252.136
  59.20.40.237
  59.20.41.192
@@ -131742,10 +124565,12 @@
  59.21.157.235
  59.21.252.181
  59.21.253.234
+59.21.31.115
  59.21.86.35
  59.22.107.93
  59.22.233.81
  59.22.26.131
+59.22.55.86
  59.22.9.39
  59.23.108.205
  59.23.13.47
@@ -131759,8 +124584,10 @@
  59.24.1.84
  59.24.10.146
  59.24.233.144
+59.24.42.106
  59.24.45.55
  59.24.49.35
+59.25.128.100
  59.25.141.125
  59.25.142.68
  59.25.169.207
@@ -131768,7 +124595,6 @@
  59.25.222.24
  59.25.244.193
  59.26.214.148
-59.26.23.148
  59.26.245.188
  59.26.90.68
  59.27.101.41
@@ -131782,7 +124608,9 @@
  59.27.95.144
  59.28.108.216
  59.28.117.37
+59.28.13.240
  59.28.138.76
+59.28.212.215
  59.28.24.197
  59.28.42.77
  59.28.44.229
@@ -131801,11 +124629,11 @@
  59.3.110.118
  59.3.117.32
  59.3.117.32bin.sh
+59.3.119.108
  59.3.138.131
  59.3.138.132
  59.3.138.134
  59.3.138.141
-59.3.138.161
  59.3.138.177
  59.3.161.21
  59.3.180.151
@@ -131820,7 +124648,6 @@
  59.3.4.233
  59.3.50.111
  59.3.81.15
-59.3.93.107
  59.3.94.190
  59.30.109.93
  59.30.12.254
@@ -131829,12 +124656,10 @@
  59.30.46.57
  59.31.163.141
  59.31.167.83
-59.31.255.134
  59.31.57.133
  59.31.61.106
  59.31.61.107
  59.31.90.206
-59.33.252.252
  59.33.32.170
  59.33.32.67
  59.33.37.158
@@ -131845,18 +124670,17 @@
  59.34.77.125
  59.34.84.142
  59.34.86.7
+59.35.20.156
  59.35.20.67
  59.35.232.8
  59.35.232.82
  59.35.233.171
  59.35.233.21
  59.35.233.93
-59.35.234.148
  59.35.234.69
  59.35.234.99
  59.35.235.122
  59.35.235.67
-59.36.138.138
  59.36.148.69
  59.36.161.241
  59.36.162.23
@@ -131888,7 +124712,6 @@
  59.36.83.116
  59.37.161.161
  59.37.162.194
-59.37.204.7
  59.37.21.50
  59.37.22.82
  59.37.47.26
@@ -131903,7 +124726,6 @@
  59.4.151.52
  59.4.98.61
  59.40.79.114
-59.40.80.174
  59.40.80.90
  59.40.82.82
  59.41.125.163
@@ -131914,12 +124736,13 @@
  59.42.192.90
  59.42.206.228
  59.42.207.212
-59.42.214.20
+59.42.38.178
  59.42.38.75
-59.42.7.166
+59.42.88.53
  59.42.88.65
  59.42.88.84
  59.42.89.65
+59.44.150.165
  59.44.175.19
  59.44.206.198
  59.44.37.156
@@ -131953,9 +124776,7 @@
  59.46.150.229
  59.46.169.194
  59.46.173.153
-59.46.52.62
  59.46.53.210
-59.46.70.107
  59.46.90.180
  59.46.90.74
  59.46.96.14
@@ -131964,6 +124785,7 @@
  59.47.118.113
  59.47.120.39
  59.47.121.133
+59.47.140.174
  59.47.229.130
  59.47.232.115
  59.47.232.84
@@ -131978,6 +124800,7 @@
  59.48.150.2
  59.48.172.222
  59.48.173.146
+59.48.174.2
  59.48.240.250
  59.48.38.210
  59.49.100.50
@@ -131988,7 +124811,9 @@
  59.49.77.49
  59.49.96.215
  59.5.133.114
+59.5.16.69
  59.5.171.159
+59.5.192.126
  59.5.198.75
  59.5.230.140
  59.5.230.140bin.sh
@@ -131998,7 +124823,6 @@
  59.50.85.195
  59.51.113.56
  59.51.24.34
-59.51.65.17
  59.52.10.72
  59.52.225.242
  59.52.78.185
@@ -132009,11 +124833,12 @@
  59.54.54.226
  59.55.128.147
  59.55.128.170
-59.55.39.4
+59.55.38.83
  59.55.39.53
  59.55.74.250
  59.55.74.40
  59.56.103.1
+59.56.103.2
  59.56.103.91
  59.56.106.103
  59.56.110.66
@@ -132033,17 +124858,18 @@
  59.57.13.188
  59.57.13.92
  59.57.182.18
+59.57.182.68
  59.57.183.113
  59.57.183.187
+59.57.253.66
  59.57.32.31
  59.58.139.126
  59.58.150.93
+59.58.164.194
  59.58.208.168
-59.58.249.157
  59.59.41.82
  59.59.44.203
  59.59.68.131
-59.59.83.249
  59.6.147.79
  59.6.180.232
  59.6.21.41
@@ -132051,32 +124877,24 @@
  59.6.23.172
  59.60.191.210
  59.60.31.210
-59.60.55.225
-59.60.9.236
  59.61.10.134
  59.61.13.184
  59.61.160.125
-59.61.192.20
+59.61.207.6
  59.61.241.46
-59.61.75.82
-59.61.83.118
  59.61.9.191
  59.63.139.5
  59.63.163.165
-59.63.163.49
  59.63.199.198
  59.63.200.69
  59.63.203.138
  59.63.204.130
-59.63.204.135
  59.63.204.76
  59.63.206.201
  59.63.206.206
  59.63.207.6
  59.63.208.191
-59.63.208.76
  59.63.212.100
-59.63.215.209
  59.63.222.226
  59.63.224.116
  59.63.225.114
@@ -132087,7 +124905,6 @@
  59.72.109.90
  59.72.114.79
  59.72.122.148
-59.72.61.214
  59.74.41.40
  59.74.41.52
  59.74.41.58
@@ -132101,8 +124918,6 @@
  59.8.166.12
  59.8.221.41
  59.8.91.185
-59.80.34.108
-59.80.34.110
  59.83.229.100
  59.84.226.80
  59.85.127.116
@@ -132110,21 +124925,15 @@
  59.86.247.6
  59.86.69.220
  59.88.200.64
-59.88.228.152
-59.88.228.66
-59.88.229.67
-59.88.229.79
-59.88.230.103
  59.88.251.217
  59.88.57.0
  59.88.57.35
  59.88.59.23
  59.88.59.82
  59.89.118.170
+59.9.106.52
  59.9.157.71
  59.9.16.131
-59.9.172.140
-59.9.210.52
  59.9.243.192
  59.9.41.157
  59.9.77.181
@@ -132139,6 +124948,7 @@
  59.91.200.247
  59.91.200.26
  59.91.201.103
+59.91.201.107
  59.91.201.109
  59.91.201.145
  59.91.201.185
@@ -132149,118 +124959,105 @@
  59.91.203.11
  59.91.203.115
  59.91.203.148
+59.91.203.17
  59.91.203.47
  59.91.203.96
  59.91.204.239
  59.91.204.29
  59.91.204.5
  59.91.204.52
-59.91.22.252
+59.92.180.131
+59.92.180.142
  59.92.180.55
-59.92.181.135
-59.92.181.77
-59.92.182.147
-59.92.182.151
-59.92.182.50
-59.92.216.127
+59.92.181.140
+59.92.181.149
+59.92.182.216
+59.92.182.221
  59.92.216.254
-59.92.217.204
-59.92.219.103
-59.92.219.237
-59.92.219.45
+59.92.217.134
+59.92.218.50
  59.92.5.201
  59.92.69.22
  59.92.74.46
  59.92.85.246
-59.93.16.41
+59.93.16.159
  59.93.17.15
-59.93.17.210
-59.93.236.149
-59.93.236.81
-59.93.238.95
-59.93.239.204
-59.93.239.237
-59.94.120.240
+59.93.17.95
+59.93.18.16
+59.93.18.208
+59.93.18.241
+59.93.18.251
+59.93.19.18
+59.93.237.119
+59.93.238.133
+59.93.238.208
  59.94.176.237
  59.94.176.30
-59.94.180.9
-59.94.181.247
-59.94.181.69
-59.94.182.106
+59.94.180.3
  59.94.182.158
-59.94.182.178
-59.94.182.46
-59.94.183.129
-59.94.183.140
  59.94.183.146
  59.94.183.173
+59.94.183.64
  59.95.103.13
-59.95.173.244
-59.95.173.59
-59.95.175.22
-59.95.175.5
+59.95.173.157
+59.95.174.166
+59.95.175.187
  59.95.96.42
-59.96.37.204
-59.96.37.6
-59.96.38.15
-59.96.38.198
+59.96.36.142
+59.96.36.85
+59.96.37.188
+59.96.37.64
+59.96.38.168
  59.96.38.234
-59.96.38.242
-59.96.39.200
-59.96.39.98
+59.96.38.76
+59.96.89.95
  59.97.168.179
-59.97.168.188
+59.97.168.45
  59.97.168.72
  59.97.169.135
  59.97.169.147
-59.97.169.175
-59.97.169.252
  59.97.169.64
  59.97.169.69
  59.97.169.86
-59.97.170.146
-59.97.170.246
  59.97.170.26
-59.97.171.124
-59.97.171.250
-59.97.172.148
-59.97.173.250
-59.97.174.192
-59.97.174.50
-59.97.175.12
-59.97.175.152
-59.97.175.31
+59.97.171.118
+59.97.171.248
+59.97.173.238
+59.97.173.253
+59.97.174.127
+59.97.174.225
+59.97.174.42
+59.97.175.65
  59.97.238.208
-59.99.137.30
-59.99.139.154
-59.99.40.177
+59.97.5.218
+59.99.138.201
+59.99.140.159
+59.99.192.228
  59.99.40.216
+59.99.40.237
+59.99.41.102
+59.99.41.148
  59.99.41.151
-59.99.41.160
  59.99.41.172
  59.99.41.55
  59.99.41.83
  59.99.42.0
-59.99.42.250
-59.99.43.121
+59.99.42.23
+59.99.43.115
  59.99.44.229
-59.99.44.45
-59.99.44.87
-59.99.45.144
-59.99.45.203
-59.99.45.24
-59.99.45.33
-59.99.45.81
-59.99.46.242
-59.99.47.120
-59.99.92.26
+59.99.44.237
+59.99.44.72
+59.99.44.77
+59.99.46.105
+59.99.46.123
+59.99.46.55
+59.99.46.67
+59.99.47.85
+59.99.47.88
  59.99.92.74
-59.99.93.76
-59.99.93.94
-59.99.94.215
-59.99.94.75
-59.99.95.144
-59.99.95.200
+59.99.92.75
+59.99.95.153
+59.99.95.176
  590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
@@ -132382,6 +125179,7 @@
  6.ldayl.com
  60.1.120.97
  60.1.122.243
+60.1.141.114
  60.10.134.52
  60.10.182.29
  60.10.193.68
@@ -132398,26 +125196,27 @@
  60.10.72.82
  60.108.128.186
  60.11.112.11
+60.11.114.36
+60.11.115.86
+60.11.222.33
  60.11.46.194
  60.11.51.92
  60.11.9.112
  60.113.117.109
  60.113.215.60
+60.114.10.36
  60.12.109.73
  60.12.109.78
  60.12.124.70
-60.12.155.216
  60.12.168.222
  60.12.17.82
  60.12.175.138
  60.12.214.184
  60.12.218.186
-60.12.221.84
  60.12.26.9
  60.12.33.9
  60.12.5.27
  60.125.114.64
-60.126.37.246
  60.13.126.151
  60.13.146.20
  60.13.194.103
@@ -132443,6 +125242,7 @@
  60.148.120.11
  60.15.117.151
  60.15.140.107
+60.15.140.167
  60.15.170.110
  60.15.194.186
  60.15.251.149
@@ -132453,16 +125253,16 @@
  60.16.195.247
  60.16.197.67
  60.16.209.190
-60.16.242.159
  60.16.51.42
  60.16.84.139
+60.16.86.190
  60.16.89.28
  60.16.89.67
  60.16.92.122
  60.16.93.214
+60.16.94.203
  60.160.21.37
  60.160.21.8
-60.160.225.39
  60.160.8.185
  60.161.13.29
  60.161.13.44
@@ -132478,11 +125278,8 @@
  60.162.191.86
  60.164.188.49
  60.164.208.135
-60.164.241.193
  60.164.249.167
  60.164.249.51
-60.164.250.12
-60.164.251.217
  60.164.251.91
  60.164.50.150
  60.165.219.14
@@ -132498,44 +125295,29 @@
  60.166.78.28
  60.167.176.156
  60.167.176.184
-60.167.176.189
  60.167.176.194
-60.167.176.212
-60.167.176.217
-60.167.176.219
-60.167.176.227
-60.167.176.247
-60.167.176.250
  60.167.176.253
  60.167.177.107
  60.167.177.111
-60.167.177.121
  60.167.177.15
-60.167.177.154
  60.167.177.159
-60.167.177.16
  60.167.177.172
  60.167.177.23
  60.167.177.25
  60.167.177.27
-60.167.177.31
+60.167.177.28
  60.167.177.40
  60.167.177.63
-60.167.177.74
  60.167.177.99
  60.167.178.161
  60.167.178.170
-60.167.178.182
  60.167.178.21
  60.167.178.33
  60.167.178.4
  60.167.178.45
  60.167.178.50
-60.167.178.67
-60.167.178.69
  60.167.178.95
  60.167.179.27
-60.167.180.160
  60.167.180.193
  60.167.180.204
  60.167.180.83
@@ -132544,6 +125326,7 @@
  60.167.182.147
  60.167.182.149
  60.167.182.169
+60.167.182.170
  60.167.182.184
  60.167.182.209
  60.167.188.207
@@ -132561,19 +125344,23 @@
  60.168.131.29
  60.168.132.4
  60.168.150.207
+60.168.165.188
  60.169.66.243
  60.17.148.145
  60.17.185.64
  60.17.56.7
  60.170.101.25
+60.170.152.46
  60.170.166.177
  60.170.166.189
  60.170.166.72
  60.170.189.102
+60.170.189.85
  60.170.218.225
  60.170.255.63
  60.170.27.76
  60.171.117.206
+60.171.124.70
  60.171.124.72
  60.171.163.216
  60.171.203.85
@@ -132584,6 +125371,7 @@
  60.172.47.2
  60.172.48.159
  60.172.50.164
+60.172.85.136
  60.173.152.45
  60.173.156.55
  60.173.156.98
@@ -132608,18 +125396,17 @@
  60.174.55.78
  60.174.66.254
  60.174.72.198
+60.174.92.50
  60.174.95.143
  60.175.1.242
  60.175.12.255
  60.175.124.27
  60.175.153.105
  60.175.198.48
-60.175.236.162
  60.175.88.60
  60.175.90.102
  60.176.151.157
  60.176.215.56
-60.176.248.67
  60.177.125.171
  60.177.27.77
  60.178.118.240
@@ -132633,10 +125420,9 @@
  60.18.184.72
  60.18.184.90
  60.18.59.113
-60.18.68.16
-60.182.193.106
+60.182.118.48
  60.182.231.213
-60.183.196.33
+60.182.98.154
  60.183.200.95
  60.183.3.161
  60.183.82.69
@@ -132644,14 +125430,13 @@
  60.184.48.210
  60.184.63.2
  60.184.95.135
-60.185.135.65
  60.185.159.249
  60.185.177.107
-60.185.46.201
  60.186.118.84
  60.186.123.187
  60.186.199.37
  60.186.4.151
+60.186.98.46
  60.189.149.202
  60.189.158.113
  60.189.178.111
@@ -132667,7 +125452,6 @@
  60.189.78.213
  60.189.78.44
  60.189.79.72
-60.19.12.39
  60.19.138.118
  60.19.140.11
  60.19.141.167
@@ -132716,7 +125500,6 @@
  60.191.167.198
  60.191.187.235
  60.191.19.35
-60.191.20.213
  60.191.215.212
  60.191.223.52
  60.191.223.6
@@ -132748,6 +125531,7 @@
  60.2.145.75
  60.2.154.228
  60.2.180.230
+60.2.190.82
  60.2.202.202
  60.2.221.34
  60.2.224.234
@@ -132760,8 +125544,8 @@
  60.2.99.246
  60.20.110.43
  60.20.128.152
+60.20.135.177
  60.20.226.242
-60.20.236.214
  60.20.238.251
  60.20.81.211
  60.205.140.63
@@ -132775,7 +125559,6 @@
  60.206.193.1
  60.207.25.156
  60.208.105.196
-60.208.125.106
  60.208.128.251
  60.208.131.178
  60.208.146.253
@@ -132790,6 +125573,7 @@
  60.209.132.86
  60.209.136.34
  60.209.145.37
+60.209.154.175
  60.209.160.144
  60.209.161.195
  60.209.165.19
@@ -132822,6 +125606,7 @@
  60.211.105.221
  60.211.110.32
  60.211.176.106
+60.211.18.106
  60.211.181.178
  60.211.218.78
  60.211.22.227
@@ -132837,14 +125622,12 @@
  60.212.106.214
  60.212.107.162
  60.212.107.162bin.sh
-60.212.123.181
  60.212.124.131
  60.212.143.63
  60.212.153.164
  60.212.166.205
  60.212.175.113
  60.212.180.197
-60.212.191.66
  60.212.202.25
  60.212.219.216
  60.212.225.141
@@ -132858,8 +125641,10 @@
  60.212.37.57
  60.212.59.85
  60.212.64.132
+60.212.68.30
  60.212.82.32
  60.213.121.185
+60.213.168.215
  60.213.171.219
  60.213.177.63
  60.213.184.26
@@ -132874,13 +125659,13 @@
  60.214.132.222
  60.214.143.78
  60.214.144.94
-60.214.198.246
-60.214.203.184
+60.214.147.82
  60.214.205.148
  60.214.205.22
  60.214.205.49
  60.214.209.221
  60.214.211.202
+60.214.216.192
  60.214.216.34
  60.214.225.11
  60.214.227.206
@@ -132896,7 +125681,6 @@
  60.215.171.23
  60.215.190.176
  60.215.195.37
-60.215.200.147
  60.215.202.140
  60.215.203.48
  60.215.205.208
@@ -132923,14 +125707,15 @@
  60.217.61.34
  60.217.64.137
  60.217.64.237
-60.218.117.23
  60.218.134.59
  60.218.191.222
  60.218.206.187
+60.218.29.239
  60.218.9.115
  60.218.96.106
  60.219.103.106
  60.219.129.25
+60.219.133.38
  60.219.171.134
  60.22.126.140
  60.22.209.125
@@ -132953,9 +125738,7 @@
  60.220.187.75
  60.220.226.102
  60.220.242.92
-60.220.247.89
  60.220.38.208
-60.221.225.136
  60.221.240.167
  60.221.49.134
  60.221.49.97
@@ -132966,10 +125749,10 @@
  60.223.90.60
  60.223.92.76
  60.224.132.108
-60.225.184.113
  60.228.245.111
  60.23.115.171
  60.23.124.81
+60.23.125.162
  60.23.54.94
  60.23.60.39
  60.23.73.24
@@ -132989,19 +125772,22 @@
  60.241.53.60
  60.241.77.93
  60.243.114.66
+60.243.123.33
  60.243.149.14
  60.243.48.133
+60.243.49.105
  60.243.50.35
+60.243.6.199
  60.244.109.18
  60.244.121.125
  60.244.133.13
-60.244.143.71
  60.244.146.157
  60.245.29.43
  60.245.57.91
  60.246.17.218
  60.246.171.51
  60.246.177.49
+60.246.2.153
  60.246.207.230
  60.246.235.84
  60.246.43.179
@@ -133035,6 +125821,7 @@
  60.249.134.102
  60.249.143.61
  60.249.145.25
+60.249.178.193
  60.249.178.194
  60.249.179.136
  60.249.180.159
@@ -133042,6 +125829,7 @@
  60.249.197.246
  60.249.206.148
  60.249.21.218
+60.249.217.225
  60.249.220.97
  60.249.220.99
  60.249.24.88
@@ -133078,6 +125866,7 @@
  60.250.235.138
  60.250.244.210
  60.250.246.221
+60.250.29.230
  60.250.58.142
  60.250.75.139
  60.250.77.209
@@ -133090,27 +125879,25 @@
  60.251.151.163
  60.251.154.152
  60.251.182.60
-60.251.183.90
  60.251.203.123
  60.251.203.79
  60.251.219.120
  60.251.229.205
  60.251.42.155
-60.251.45.100
  60.251.52.67
  60.251.58.88
  60.251.60.100
  60.251.60.96
  60.251.80.75
  60.251.80.77
+60.251.80.78
  60.253.14.166
+60.253.15.104
  60.253.34.48
-60.253.39.56
  60.253.39.88
  60.253.42.72
  60.253.42.95
  60.253.43.137
-60.253.43.41
  60.253.43.58
  60.253.44.152
  60.253.44.172
@@ -133121,6 +125908,7 @@
  60.253.47.20
  60.253.49.27
  60.253.50.5
+60.253.51.127
  60.253.51.57
  60.253.60.52
  60.253.62.43
@@ -133129,7 +125917,6 @@
  60.253.8.81
  60.254.104.107
  60.254.48.81
-60.254.50.162
  60.255.137.82
  60.255.144.162
  60.255.171.4
@@ -133154,6 +125941,7 @@
  60.29.185.195
  60.29.215.161
  60.29.31.98
+60.3.140.83
  60.3.160.242
  60.3.208.37
  60.30.249.6
@@ -133166,7 +125954,7 @@
  60.4.220.89
  60.48.1.149
  60.48.102.97
-60.48.48.176
+60.48.231.179
  60.48.51.165
  60.49.0.221
  60.49.104.110
@@ -133175,13 +125963,12 @@
  60.5.139.234
  60.5.45.85
  60.50.28.188
+60.50.30.158
  60.50.30.177
-60.50.52.199
  60.50.99.134
  60.51.101.89
  60.51.107.238
  60.51.111.99
-60.51.166.197
  60.51.170.105
  60.51.228.233
  60.51.36.129
@@ -133189,8 +125976,9 @@
  60.51.39.186
  60.51.4.203
  60.52.0.144
-60.52.146.245
+60.52.27.207
  60.52.32.114
+60.52.55.44
  60.52.84.101
  60.53.126.184
  60.53.203.3
@@ -133211,8 +125999,10 @@
  60.6.224.98
  60.6.253.151
  60.6.65.134
+60.66.209.229
  60.67.102.122
  60.7.139.43
+60.7.169.156
  60.7.198.3
  60.7.94.111
  60.73.33.73
@@ -133246,8 +126036,6 @@
  60minutesoffame.com
  60triple.com
  60xggrhtuemyoowf7.easy.co
-61.0.149.181
-61.0.152.166
  61.0.5.60
  61.1.34.158
  61.10.182.126
@@ -133282,10 +126070,12 @@
  61.12.82.102
  61.128.172.202
  61.129.112.168
+61.129.251.247
  61.129.33.220
  61.129.70.155
  61.130.110.234
  61.130.147.46
+61.130.239.74
  61.130.28.203
  61.130.98.66
  61.131.136.187
@@ -133293,6 +126083,7 @@
  61.131.207.66
  61.131.223.33
  61.131.228.76
+61.131.45.162
  61.131.45.173
  61.132.110.126
  61.132.116.202
@@ -133300,10 +126091,8 @@
  61.132.138.83
  61.132.138.84
  61.132.225.82
-61.132.226.64
  61.132.227.16
  61.132.228.103
-61.132.233.10
  61.132.35.119
  61.132.46.219
  61.132.52.19
@@ -133321,6 +126110,7 @@
  61.133.232.253
  61.133.232.254
  61.133.238.130
+61.133.77.176
  61.134.220.242
  61.134.23.106
  61.134.23.201
@@ -133345,9 +126135,11 @@
  61.136.79.32
  61.137.152.233
  61.137.159.194
+61.137.188.84
  61.137.204.102
  61.138.117.21
  61.138.28.45
+61.138.52.244
  61.138.95.30
  61.139.104.194
  61.139.105.163
@@ -133361,19 +126153,19 @@
  61.14.228.134
  61.140.13.161
  61.140.161.52
+61.140.161.92
  61.140.162.29
  61.140.162.30
  61.140.168.100
-61.140.62.214
  61.140.62.62
  61.140.73.133
  61.140.73.155
-61.141.125.103
+61.141.138.46
+61.141.139.226
  61.141.21.34
  61.141.222.94
  61.141.235.210
  61.141.236.46
-61.141.87.232
  61.142.20.25
  61.142.20.28
  61.142.20.29
@@ -133425,8 +126217,6 @@
  61.145.182.27
  61.145.185.121
  61.145.216.2
-61.145.33.99
-61.145.49.44
  61.146.118.104
  61.146.199.186
  61.146.72.252
@@ -133434,6 +126224,7 @@
  61.147.108.92
  61.147.115.140
  61.147.117.252
+61.147.167.252
  61.147.174.126
  61.147.198.90
  61.147.204.122
@@ -133444,8 +126235,10 @@
  61.147.69.71
  61.147.70.66
  61.148.149.130
+61.148.16.162
  61.148.16.94
  61.148.199.206
+61.148.202.54
  61.148.222.198
  61.148.45.74
  61.148.56.158
@@ -133483,13 +126276,13 @@
  61.154.164.241
  61.154.174.54
  61.154.197.13
-61.154.197.141
+61.154.197.142
+61.154.197.151
  61.154.64.227
-61.154.64.254
-61.154.64.34
  61.155.0.253
  61.155.106.14
  61.155.110.210
+61.155.137.205
  61.155.137.21
  61.155.138.100
  61.155.142.67
@@ -133510,6 +126303,7 @@
  61.155.58.254
  61.155.59.66
  61.155.65.43
+61.155.8.185
  61.156.112.88
  61.156.208.53
  61.156.209.109
@@ -133522,9 +126316,12 @@
  61.158.166.130
  61.158.167.184
  61.158.170.180
+61.158.171.37
  61.158.198.137
  61.159.128.198
+61.159.128.228
  61.159.167.45
+61.159.184.41
  61.16.138.118
  61.160.107.66
  61.160.196.28
@@ -133542,7 +126339,6 @@
  61.160.251.29
  61.160.251.98
  61.160.64.37
-61.160.85.118
  61.160.96.90
  61.161.149.246
  61.161.198.99
@@ -133557,22 +126353,21 @@
  61.162.66.193
  61.163.104.156
  61.163.123.82
-61.163.129.130
  61.163.136.104bin.sh
+61.163.138.253
  61.163.146.236
+61.163.147.143
+61.163.150.225
+61.163.150.234
  61.163.151.46
  61.163.156.160
-61.163.156.203
-61.163.158.196
  61.163.170.1
  61.163.192.28
  61.163.192.88
  61.163.198.215
  61.163.216.136
  61.163.218.33
-61.163.22.135
  61.163.36.4
-61.163.38.30
  61.163.4.246
  61.164.108.109
  61.164.145.8
@@ -133596,7 +126391,6 @@
  61.166.162.163
  61.166.162.165
  61.166.18.208
-61.166.18.7
  61.166.18.85
  61.166.19.120
  61.166.19.132
@@ -133605,8 +126399,9 @@
  61.167.119.234
  61.167.149.97
  61.167.98.130
-61.168.139.244
  61.168.139.52
+61.168.140.68
+61.168.171.116
  61.168.222.143
  61.171.17.64
  61.171.31.11
@@ -133615,7 +126410,12 @@
  61.172.244.198
  61.173.103.189
  61.173.28.251
-61.174.158.35
+61.174.154.244
+61.174.155.87
+61.174.158.147
+61.174.159.103
+61.174.159.156
+61.174.159.2
  61.174.16.174
  61.174.212.58
  61.174.243.25
@@ -133639,7 +126439,6 @@
  61.176.178.235
  61.176.190.63
  61.176.232.248
-61.176.243.212
  61.176.65.222
  61.177.124.55
  61.177.124.56
@@ -133649,7 +126448,6 @@
  61.177.152.42
  61.177.172.104
  61.177.172.107
-61.177.172.128
  61.177.172.13
  61.177.172.142
  61.177.172.158
@@ -133663,9 +126461,10 @@
  61.177.61.91
  61.178.103.138
  61.178.103.148
-61.178.136.152
  61.178.136.153
  61.178.171.158
+61.178.18.189
+61.178.18.191
  61.178.186.127
  61.178.190.219
  61.178.222.83
@@ -133682,7 +126481,6 @@
  61.179.181.123
  61.179.193.15
  61.179.219.114
-61.179.22.249
  61.179.247.228
  61.179.247.228bin.sh
  61.179.88.191
@@ -133721,7 +126519,6 @@
  61.183.74.26
  61.183.9.115
  61.183.9.17
-61.184.119.32
  61.184.136.164
  61.184.196.122
  61.184.203.26
@@ -133747,6 +126544,7 @@
  61.186.39.193
  61.187.10.130
  61.187.10.133
+61.187.147.23
  61.187.153.106
  61.188.18.141
  61.188.18.38
@@ -133770,12 +126568,12 @@
  61.19.202.212
  61.19.244.78
  61.19.246.238
+61.19.246.25
  61.19.249.103
  61.19.254.40
  61.19.255.69
  61.19.27.253
  61.19.30.156
-61.19.30.75
  61.19.40.50
  61.19.64.9
  61.19.65.30
@@ -133783,6 +126581,7 @@
  61.19.84.90
  61.19.85.10
  61.190.123.15
+61.190.161.198
  61.190.172.2
  61.190.18.46
  61.190.91.66
@@ -133792,26 +126591,24 @@
  61.191.23.19
  61.191.27.122
  61.191.55.33
+61.191.85.212
  61.192.26.120
  61.193.56.29
  61.194.24.197
-61.196.43.176
+61.198.30.73
+61.198.70.242
  61.2.140.193
  61.2.148.230
  61.2.176.194
  61.2.226.35
  61.2.243.4
-61.2.44.112
-61.2.44.156
-61.2.44.16
-61.2.45.126
-61.2.45.253
  61.213.118.28
  61.216.1.21
  61.216.103.142
  61.216.104.177
  61.216.105.119
  61.216.107.38
+61.216.111.48
  61.216.13.247
  61.216.130.60
  61.216.131.200
@@ -133836,13 +126633,13 @@
  61.216.51.177
  61.216.57.229
  61.216.63.214
-61.216.73.139
  61.216.81.44
  61.216.99.162
  61.216.99.93
  61.218.134.110
  61.218.134.112
  61.218.134.113
+61.218.247.84
  61.218.250.137
  61.218.253.144
  61.218.36.21
@@ -133853,7 +126650,6 @@
  61.219.144.118
  61.219.151.102
  61.219.155.151
-61.219.171.199
  61.219.171.213
  61.219.184.6
  61.219.215.42
@@ -133866,8 +126662,8 @@
  61.220.128.67
  61.220.142.90
  61.220.150.137
+61.220.172.121
  61.220.196.1
-61.220.213.140
  61.220.243.202
  61.220.35.110
  61.220.65.126
@@ -133891,6 +126687,7 @@
  61.222.241.229
  61.222.56.80
  61.222.59.232
+61.223.1.89
  61.223.126.28
  61.223.130.247
  61.223.15.203
@@ -133902,14 +126699,14 @@
  61.223.81.40
  61.224.104.61
  61.224.107.26
-61.224.58.128
+61.224.44.163
  61.224.68.208
  61.224.82.134
  61.224.83.54
-61.224.86.188
  61.224.86.241
  61.224.87.105
  61.224.9.89
+61.224.93.162
  61.227.128.7
  61.227.163.153
  61.227.180.80
@@ -133917,14 +126714,14 @@
  61.227.235.200
  61.227.239.149
  61.227.76.144
-61.228.131.149
+61.228.113.80
  61.228.36.185
+61.228.99.90
  61.230.113.187
  61.230.163.73
  61.230.170.34
  61.231.177.252
  61.231.178.179
-61.231.188.136
  61.231.188.174
  61.231.79.242
  61.232.206.226
@@ -133937,6 +126734,7 @@
  61.238.244.138
  61.238.25.198
  61.238.33.228
+61.238.48.95
  61.238.60.27
  61.238.90.1
  61.238.93.228
@@ -133952,6 +126750,7 @@
  61.240.12.110
  61.240.148.110
  61.240.148.35
+61.240.17.182
  61.240.30.230
  61.241.112.81
  61.241.170.149
@@ -133963,17 +126762,17 @@
  61.241.170.50
  61.241.171.170
  61.242.169.92
+61.244.186.241
  61.244.186.33
  61.244.247.105
  61.244.33.43
  61.244.70.248
  61.244.80.223
+61.245.177.13
  61.246.39.159
  61.246.7.145
  61.247.176.173
-61.247.178.158
  61.247.178.170
-61.247.182.113
  61.247.184.81
  61.247.25.46
  61.247.65.101
@@ -133994,6 +126793,7 @@
  61.32.154.211
  61.32.6.30
  61.33.119.226
+61.35.11.199
  61.35.177.110
  61.35.43.168
  61.37.212.83
@@ -134009,7 +126809,6 @@
  61.48.20.58
  61.48.217.219
  61.48.41.18
-61.48.52.102
  61.49.105.170
  61.49.49.22
  61.5.34.33
@@ -134030,20 +126829,20 @@
  61.51.95.234
  61.52.10.243
  61.52.100.125
+61.52.100.168
  61.52.100.185
  61.52.100.186
  61.52.101.0
  61.52.101.115
  61.52.101.202
  61.52.101.233
-61.52.101.255
+61.52.102.10
  61.52.102.130
  61.52.102.132
  61.52.102.51
+61.52.102.80
  61.52.102.81
-61.52.103.21
  61.52.103.229
-61.52.103.36
  61.52.11.23
  61.52.11.87
  61.52.128.79
@@ -134058,30 +126857,31 @@
  61.52.156.142
  61.52.156.236
  61.52.157.103
+61.52.157.252
  61.52.159.10
  61.52.159.163
  61.52.159.87
  61.52.162.105
-61.52.164.228
  61.52.168.37
  61.52.173.234
  61.52.173.246
  61.52.173.3
  61.52.173.78
-61.52.176.114
-61.52.176.188
+61.52.174.66
  61.52.177.101
  61.52.179.101
  61.52.180.133
+61.52.180.188
  61.52.181.100
  61.52.183.117
-61.52.184.147
-61.52.184.234
-61.52.186.136
  61.52.186.168
-61.52.187.8
+61.52.186.250
+61.52.187.227
+61.52.187.233
+61.52.190.240
  61.52.193.100
  61.52.193.144
+61.52.193.174
  61.52.194.108
  61.52.194.12
  61.52.194.214
@@ -134089,63 +126889,63 @@
  61.52.196.120
  61.52.196.177
  61.52.196.230
+61.52.197.202
  61.52.197.85
  61.52.198.11
-61.52.198.34
+61.52.198.39
  61.52.199.108
  61.52.199.216
-61.52.208.207
+61.52.2.187
+61.52.205.5
+61.52.208.104
  61.52.208.212
-61.52.208.23
+61.52.209.13
  61.52.209.246
-61.52.210.156
  61.52.210.37
  61.52.212.132
  61.52.213.164
-61.52.213.215
+61.52.214.164
  61.52.215.10
-61.52.215.125
-61.52.240.39
-61.52.241.131
+61.52.215.13
+61.52.240.108
  61.52.241.22
  61.52.241.23
  61.52.242.123
-61.52.246.59
+61.52.244.142
+61.52.244.51
  61.52.247.130
+61.52.28.103
  61.52.28.126
  61.52.28.79
  61.52.29.1
  61.52.31.197
-61.52.38.119
-61.52.40.222
-61.52.41.161
+61.52.31.244
+61.52.41.183
+61.52.41.55
  61.52.43.138
-61.52.43.75
-61.52.44.65
-61.52.48.12
+61.52.43.55
+61.52.45.235
  61.52.51.23
  61.52.51.252
-61.52.53.115
+61.52.52.63
+61.52.53.184
  61.52.56.13
  61.52.56.216
-61.52.57.177
-61.52.58.37
-61.52.59.27
+61.52.57.55
  61.52.6.11
  61.52.61.177
+61.52.63.216
  61.52.7.77
-61.52.73.141
+61.52.72.222
  61.52.73.35
-61.52.78.175
+61.52.74.30
  61.52.8.184
-61.52.86.165
  61.52.9.67
-61.52.9.80
  61.52.96.134
  61.52.96.149
  61.52.96.169
+61.52.96.191
  61.52.96.227
-61.52.96.247
  61.52.96.74
  61.52.97.246
  61.52.97.255
@@ -134158,71 +126958,82 @@
  61.52.99.204
  61.52.99.216
  61.52.99.51
+61.53.10.59
+61.53.103.41
  61.53.104.179
+61.53.107.12
  61.53.107.247
  61.53.108.82
  61.53.11.91
+61.53.117.98
+61.53.119.0
  61.53.119.67
  61.53.12.31
  61.53.120.132
-61.53.121.120
-61.53.121.81
+61.53.121.148
+61.53.121.82
+61.53.122.185
  61.53.122.34
  61.53.124.102
  61.53.124.186
-61.53.125.40
+61.53.125.48
+61.53.126.128
+61.53.126.222
  61.53.138.199
  61.53.138.21
  61.53.147.93
+61.53.15.86
+61.53.150.198
  61.53.151.235
-61.53.156.237
  61.53.171.205
-61.53.198.58
+61.53.199.115
  61.53.218.220
  61.53.220.189
+61.53.221.106
  61.53.241.13
-61.53.28.47
-61.53.40.105
-61.53.45.154
+61.53.40.180
  61.53.52.35
-61.53.57.111
  61.53.59.191
-61.53.65.251
+61.53.72.10
  61.53.72.40
+61.53.73.21
+61.53.74.101
  61.53.74.136
-61.53.74.33
  61.53.80.119
  61.53.80.80
-61.53.82.112
  61.53.83.1
  61.53.83.164
+61.53.83.177
+61.53.84.141
  61.53.84.45
  61.53.84.76
  61.53.85.11
-61.53.85.111
-61.53.85.229
  61.53.87.4
+61.53.90.167
  61.53.96.12
  61.53.97.196
  61.53.99.160
+61.54.167.84
  61.54.181.118
  61.54.2.103
-61.54.207.185
+61.54.200.22
+61.54.206.121
+61.54.215.225
  61.54.231.129
+61.54.234.142
  61.54.248.217
  61.54.249.180
-61.54.252.54
+61.54.40.133
  61.54.40.143
  61.54.42.210
  61.54.43.28
-61.54.50.209
+61.54.43.68
  61.54.60.226
  61.54.62.222
+61.54.62.94
  61.54.63.0
-61.54.63.23
-61.54.68.105
  61.54.69.34
-61.54.71.185
+61.54.71.165
  61.54.71.42
  61.54.77.82
  61.54.78.161
@@ -134254,7 +127065,8 @@
  61.6.147.172
  61.6.196.14
  61.6.198.2
-61.6.217.66
+61.6.200.125
+61.6.201.210
  61.6.235.228
  61.6.30.199
  61.6.37.23
@@ -134296,9 +127108,7 @@
  61.68.52.88
  61.69.205.187
  61.7.129.174
-61.7.138.13
  61.7.138.251
-61.7.138.58
  61.7.141.34
  61.7.142.39
  61.7.147.29
@@ -134309,6 +127119,7 @@
  61.7.170.53
  61.7.175.113
  61.7.175.189
+61.7.177.196
  61.7.177.237
  61.7.177.27
  61.7.177.74
@@ -134334,6 +127145,7 @@
  61.70.110.48
  61.70.110.59
  61.70.110.90
+61.70.118.57
  61.70.132.195
  61.70.132.80
  61.70.155.15
@@ -134343,7 +127155,7 @@
  61.70.69.146
  61.70.69.244
  61.70.69.37
-61.72.163.201
+61.72.188.38
  61.72.211.28
  61.72.255.26
  61.73.161.237
@@ -134358,7 +127170,9 @@
  61.74.55.99
  61.75.127.216
  61.75.144.220
+61.75.184.101
  61.75.204.124
+61.75.247.27
  61.75.36.225
  61.75.51.39
  61.75.80.29
@@ -134372,6 +127186,7 @@
  61.76.222.210
  61.76.59.148
  61.76.63.150
+61.76.68.57
  61.76.74.20
  61.77.108.68
  61.77.160.134
@@ -134380,7 +127195,6 @@
  61.77.161.94
  61.77.161.95
  61.77.161.99
-61.77.185.5
  61.77.200.15
  61.77.203.38
  61.77.34.77
@@ -134394,11 +127208,13 @@
  61.78.62.22
  61.78.79.217
  61.79.139.181
+61.79.144.132
  61.79.150.239
  61.79.229.112
  61.79.229.112bin.sh
  61.79.44.92
  61.79.45.100
+61.79.81.214
  61.8.3.157
  61.8.68.238
  61.8.75.186
@@ -134413,7 +127229,6 @@
  61.81.131.75
  61.81.145.5
  61.81.156.12
-61.81.205.169
  61.81.36.241
  61.81.4.142
  61.82.130.233
@@ -134421,22 +127236,25 @@
  61.82.192.48
  61.82.194.133
  61.82.196.102
+61.82.197.156
  61.82.206.154
  61.82.220.189
  61.83.210.246
  61.83.57.92
  61.83.97.157
  61.84.138.57
+61.84.143.139
  61.84.149.121
  61.84.150.39
  61.84.150.97
  61.84.185.86
  61.84.196.50
+61.84.203.117
  61.84.207.119
-61.84.207.175
  61.84.207.220
  61.84.208.245
  61.85.12.175
+61.85.149.34
  61.85.171.104
  61.85.19.99
  61.85.218.245
@@ -134444,11 +127262,11 @@
  61.85.229.238
  61.85.230.41
  61.85.46.47
-61.90.109.251
-61.90.98.3
+61.90.110.195
  61.91.183.86
  61.91.235.226
  61.91.32.50
+61.91.60.234
  61.91.79.40
  61.91.80.107
  61.92.121.91
@@ -134499,6 +127317,7 @@
  61gamei.com
  61z39.cn
  62.1.147.90
+62.1.178.89
  62.1.194.245
  62.1.235.173
  62.100.211.26
@@ -134511,15 +127330,13 @@
  62.103.31.24
  62.103.71.86
  62.103.74.230
-62.106.119.82
  62.106.122.90
  62.106.25.87
  62.107.200.30
  62.108.34.16
  62.108.34.51
+62.108.37.122
  62.108.37.126
-62.108.37.127
-62.108.37.89
  62.109.0.2
  62.109.10.150
  62.109.11.239
@@ -134530,6 +127347,7 @@
  62.109.2.52
  62.109.20.253
  62.11.178.216
+62.11.201.134
  62.11.49.184
  62.112.11.188
  62.112.194.132
@@ -134542,10 +127360,10 @@
  62.113.238.135
  62.113.238.136
  62.113.238.148
+62.113.24.90
  62.113.240.122
  62.113.251.95
  62.113.255.8
-62.113.31.68
  62.114.120.128
  62.114.122.175
  62.116.100.88
@@ -134601,7 +127419,6 @@
  62.141.66.110
  62.141.73.58
  62.141.78.34
-62.143.168.255
  62.143.188.176
  62.148.142.202
  62.148.157.105
@@ -134652,7 +127469,6 @@
  62.148.157.48
  62.148.157.56
  62.148.157.58
-62.148.157.61
  62.148.157.65
  62.148.157.68
  62.148.157.69
@@ -134672,9 +127488,7 @@
  62.149.20.10
  62.149.202.3
  62.149.29.131
-62.149.29.173
  62.149.29.185
-62.149.29.186
  62.149.29.48
  62.149.29.58
  62.149.5.18
@@ -134697,7 +127511,8 @@
  62.152.58.16
  62.153.103.153
  62.153.89.22
-62.158.166.96
+62.158.56.27
+62.16.103.46
  62.16.11.223
  62.16.153.164
  62.16.41.210
@@ -134715,13 +127530,11 @@
  62.169.203.59
  62.169.236.36
  62.169.4.158
-62.170.61.105
  62.171.129.32
  62.171.131.40
  62.171.132.224
  62.171.133.6
  62.171.135.115
-62.171.136.105
  62.171.136.116
  62.171.138.253
  62.171.142.162
@@ -134785,7 +127598,9 @@
  62.182.201.222
  62.182.203.253
  62.182.62.35
+62.182.80.58
  62.182.82.219
+62.182.91.183
  62.182.99.130
  62.183.98.181
  62.189.71.12
@@ -134793,6 +127608,7 @@
  62.193.138.129
  62.193.227.12
  62.193.230.2
+62.194.105.89
  62.194.125.15
  62.194.186.174
  62.194.33.100
@@ -134809,7 +127625,6 @@
  62.201.120.141
  62.201.210.134
  62.201.220.50
-62.201.222.243
  62.201.226.226
  62.201.233.59
  62.201.70.40
@@ -134839,7 +127654,6 @@
  62.210.111.45
  62.210.112.94
  62.210.113.143
-62.210.113.162
  62.210.113.228
  62.210.113.249
  62.210.114.45
@@ -134859,7 +127673,6 @@
  62.210.136.99
  62.210.139.12
  62.210.139.243
-62.210.139.42
  62.210.139.92
  62.210.14.172
  62.210.141.185
@@ -134875,7 +127688,6 @@
  62.210.148.87
  62.210.149.68
  62.210.15.203
-62.210.15.86
  62.210.151.81
  62.210.152.87
  62.210.152.90
@@ -134892,7 +127704,6 @@
  62.210.170.165
  62.210.172.123
  62.210.172.8
-62.210.177.105
  62.210.177.221
  62.210.177.34
  62.210.177.44
@@ -134905,7 +127716,6 @@
  62.210.181.11
  62.210.181.123
  62.210.185.4
-62.210.187.223
  62.210.188.102
  62.210.189.204
  62.210.189.40
@@ -134925,7 +127735,6 @@
  62.210.207.6
  62.210.207.63
  62.210.207.8
-62.210.208.225
  62.210.209.245
  62.210.209.54
  62.210.209.94
@@ -134943,19 +127752,19 @@
  62.210.250.66
  62.210.251.69
  62.210.252.160
-62.210.28.43
  62.210.29.130
  62.210.29.189
  62.210.31.10
  62.210.37.82
-62.210.38.183
  62.210.38.37
+62.210.38.39
  62.210.5.92
  62.210.5.96
  62.210.53.67
  62.210.57.132
  62.210.6.33
  62.210.69.173
+62.210.69.176
  62.210.69.211
  62.210.69.217
  62.210.70.74
@@ -134964,6 +127773,7 @@
  62.210.73.11
  62.210.73.65
  62.210.75.68
+62.210.79.117
  62.210.79.221
  62.210.8.216
  62.210.80.16
@@ -134993,11 +127803,9 @@
  62.210.94.159
  62.210.97.48
  62.210.99.100
-62.210.99.150
  62.210.99.221
  62.211.205.221
  62.212.10.250
-62.212.235.238
  62.212.239.118
  62.212.66.150
  62.212.73.210
@@ -135009,7 +127817,6 @@
  62.215.194.209
  62.215.44.113
  62.215.6.11
-62.216.205.95
  62.216.81.175
  62.216.93.204
  62.217.124.203
@@ -135024,6 +127831,7 @@
  62.219.3.58
  62.220.177.141
  62.220.177.75
+62.224.198.172
  62.228.152.100
  62.228.205.38
  62.23.15.92
@@ -135083,6 +127891,7 @@
  62.234.217.203
  62.234.218.151
  62.234.27.166
+62.234.3.187
  62.234.36.219
  62.234.42.203
  62.234.43.48
@@ -135105,6 +127914,7 @@
  62.234.87.235
  62.234.89.176
  62.234.94.202
+62.234.94.65
  62.234.96.102
  62.238.161.92
  62.239.8.236
@@ -135120,10 +127930,9 @@
  62.240.192.42
  62.240.192.43
  62.240.2.41
-62.240.28.15
  62.240.28.167
+62.240.28.18
  62.240.4.4
-62.241.133.234
  62.241.230.229
  62.244.140.37
  62.244.89.82
@@ -135150,7 +127959,6 @@
  62.28.253.197
  62.29.105.152
  62.29.105.33
-62.29.47.251
  62.30.166.116
  62.30.207.59
  62.30.7.67
@@ -135158,15 +127966,14 @@
  62.31.181.67
  62.31.181.68
  62.31.238.18
+62.31.75.71
  62.31.81.0
  62.33.103.24
-62.33.191.149
  62.33.207.196
  62.33.207.201
  62.33.207.202
  62.33.207.98
  62.33.241.37
-62.34.241.167
  62.34.67.100
  62.38.153.112
  62.38.222.98
@@ -135202,6 +128009,7 @@
  62.46.175.44
  62.46.201.248
  62.47.20.83
+62.47.5.189
  62.48.152.238
  62.48.212.197
  62.48.251.58
@@ -135252,6 +128060,7 @@
  62.76.235.138
  62.76.235.143
  62.76.235.81
+62.76.235.94
  62.76.5.154
  62.76.96.6
  62.77.152.150
@@ -135270,10 +128079,10 @@
  62.82.75.58
  62.83.78.94
  62.83.93.152
-62.84.220.138
  62.84.59.21
  62.84.75.50
  62.85.77.116
+62.85.92.153
  62.87.151.132
  62.87.151.186
  62.89.28.108
@@ -135293,8 +128102,6 @@
  62.97.41.107
  62.98.20.66
  62.99.178.46
-62.99.67.216
-62.99.79.77
  62.99.90.10
  620021.com
  6200294-dot-oaao-274308.uc.r.appspot.com
@@ -135366,8 +128173,6 @@
  63.143.38.226
  63.143.45.19
  63.143.86.253
-63.143.95.99
-63.143.96.181
  63.143.96.50
  63.143.98.57
  63.143.98.72
@@ -135384,7 +128189,6 @@
  63.150.5.15
  63.151.67.7
  63.151.9.74
-63.153.137.197
  63.153.241.58
  63.155.93.9
  63.159.154.209
@@ -135397,6 +128201,7 @@
  63.220.1.43
  63.223.106.188
  63.223.85.28
+63.224.249.240
  63.224.37.22
  63.225.118.132
  63.225.175.1
@@ -135432,7 +128237,6 @@
  63.250.32.210
  63.250.32.242
  63.250.32.244
-63.250.32.246
  63.250.32.76
  63.250.33.127
  63.250.33.135
@@ -135450,7 +128254,6 @@
  63.250.57.237
  63.250.59.50
  63.251.214.34
-63.254.150.30
  63.32.134.196
  63.32.157.30
  63.32.178.253
@@ -135462,26 +128265,11 @@
  63.32.57.156
  63.32.65.43
  63.33.204.91
-63.41.225.61
-63.41.36.219
  63.41.36.220
  63.41.9.206
  63.41.9.207
-63.41.9.210
  63.80.184.72
-63.80.191.117
-63.80.191.118
-63.80.191.119
-63.80.191.121
-63.80.191.122
-63.80.191.123
-63.80.191.124
-63.80.191.125
-63.80.191.126
-63.80.191.127
-63.80.191.128
  63.80.191.129
-63.80.191.130
  63.80.191.132
  63.80.191.133
  63.80.191.134
@@ -135490,19 +128278,14 @@
  63.80.191.137
  63.80.191.138
  63.80.191.139
-63.80.191.141
  63.80.191.142
-63.80.191.174
-63.80.191.175
-63.80.191.178
-63.80.191.179
-63.80.191.180
-63.80.191.181
-63.80.191.182
-63.80.191.183
-63.80.191.184
-63.80.191.185
-63.80.191.186
+63.80.191.144
+63.80.191.145
+63.80.191.147
+63.80.191.149
+63.80.191.150
+63.80.191.153
+63.80.191.155
  63.80.191.187
  63.80.191.188
  63.80.191.189
@@ -135525,32 +128308,17 @@
  63.80.191.78
  63.80.191.79
  63.80.191.81
-63.80.191.83
+63.80.191.82
+63.80.191.92
+63.80.191.95
+63.80.191.97
+63.80.191.98
  63.81.82.11
-63.81.82.113
-63.81.82.114
-63.81.82.115
-63.81.82.116
-63.81.82.118
-63.81.82.119
-63.81.82.120
-63.81.82.121
-63.81.82.122
-63.81.82.123
-63.81.82.125
-63.81.82.126
-63.81.82.127
+63.81.82.112
  63.81.82.128
  63.81.82.129
  63.81.82.130
  63.81.82.131
-63.81.82.132
-63.81.82.133
-63.81.82.134
-63.81.82.135
-63.81.82.136
-63.81.82.137
-63.81.82.138
  63.81.82.14
  63.81.82.140
  63.81.82.141
@@ -135564,26 +128332,31 @@
  63.81.82.150
  63.81.82.151
  63.81.82.152
+63.81.82.153
  63.81.82.154
-63.81.82.155
-63.81.82.188
-63.81.82.190
-63.81.82.191
-63.81.82.192
-63.81.82.193
-63.81.82.195
-63.81.82.23
-63.81.82.24
-63.81.82.26
+63.81.82.156
+63.81.82.160
+63.81.82.162
+63.81.82.163
+63.81.82.164
+63.81.82.166
+63.81.82.167
+63.81.82.168
+63.81.82.169
+63.81.82.170
+63.81.82.172
+63.81.82.18
+63.81.82.35
+63.81.82.36
+63.81.82.39
  63.81.82.42
-63.81.82.43
-63.81.82.44
  63.81.82.46
  63.81.82.47
  63.81.82.52
+63.81.82.53
+63.81.82.54
+63.81.82.59
  63.81.82.60
-63.81.82.65
-63.81.82.66
  63.81.82.68
  63.81.82.69
  63.81.82.70
@@ -135593,21 +128366,37 @@
  63.81.82.74
  63.81.82.75
  63.81.82.76
+63.81.82.77
  63.81.82.78
  63.81.82.79
-63.81.90.132
-63.81.90.133
+63.81.82.82
+63.81.82.83
+63.81.82.85
+63.81.82.86
+63.81.82.89
+63.81.82.91
+63.81.82.92
+63.81.82.94
+63.81.82.95
+63.81.82.97
  63.81.90.135
+63.81.90.144
+63.81.90.146
+63.81.90.147
+63.81.90.149
+63.81.90.150
  63.81.90.156
+63.81.90.164
+63.81.90.166
+63.81.90.167
  63.81.90.169
  63.81.90.170
-63.81.90.173
+63.81.90.171
  63.81.90.174
  63.81.90.177
  63.81.90.178
-63.81.90.188
-63.81.90.191
-63.81.90.192
+63.81.90.181
+63.81.90.186
  630068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  630124578416503-dot-wah-cgo-lsb.appspot.com
  6306481-0.alojamiento-web.es
@@ -135641,13 +128430,11 @@
  64.1.16.10
  64.110.24.162
  64.111.116.116
-64.111.120.226
  64.111.99.8
  64.113.32.29
  64.118.201.6
  64.118.84.7
  64.118.86.44
-64.118.86.47
  64.119.197.105
  64.119.81.233
  64.120.239.130
@@ -135656,7 +128443,6 @@
  64.121.26.99
  64.121.30.123
  64.124.100.52
-64.126.33.184
  64.128.143.65
  64.128.143.70
  64.13.225.150
@@ -135681,12 +128467,15 @@
  64.136.150.80
  64.136.151.100
  64.136.151.217
+64.136.151.240
  64.137.160.95
  64.137.161.176
  64.137.169.32
  64.137.176.70
  64.137.178.17
  64.137.178.3
+64.137.180.156
+64.137.181.217
  64.137.191.16
  64.137.206.52
  64.137.215.208
@@ -135702,21 +128491,24 @@
  64.140.169.42
  64.141.19.180
  64.145.76.122
+64.145.76.128
+64.145.76.14
+64.145.76.147
+64.145.76.153
  64.145.76.158
-64.145.76.170
+64.145.76.189
  64.145.76.38
-64.145.76.39
-64.145.76.45
  64.145.76.56
  64.145.76.57
  64.145.76.68
  64.145.76.75
  64.145.79.10
+64.145.79.15
  64.145.93.245
  64.145.94.10
-64.146.223.161
-64.146.223.193
-64.146.223.242
+64.145.94.4
+64.145.94.51
+64.145.94.9
  64.147.114.20
  64.147.6.186
  64.147.96.154
@@ -135744,30 +128536,27 @@
  64.18.250.92
  64.180.181.171
  64.180.196.13
-64.180.6.192
  64.180.80.127
  64.180.81.97
  64.182.235.13
  64.183.100.166
-64.183.168.162
  64.183.185.42
  64.183.252.250
  64.183.73.122
  64.184.36.243
  64.185.115.4
  64.185.14.18
-64.187.175.226
  64.187.217.234
  64.187.99.130
  64.188.19.107
  64.188.44.114
  64.189.249.37
+64.19.218.10
  64.190.203.117
  64.191.88.242
  64.197.196.174
  64.20.156.51
  64.20.34.152
-64.20.36.212
  64.20.36.237
  64.20.49.154
  64.201.134.235
@@ -135777,7 +128566,6 @@
  64.202.184.249
  64.202.186.227
  64.202.186.78
-64.202.187.246
  64.202.188.190
  64.202.188.205
  64.202.189.14
@@ -135799,11 +128587,10 @@
  64.225.112.216
  64.225.115.33
  64.225.116.243
-64.225.116.59
  64.225.117.206
  64.225.119.164
+64.225.12.23
  64.225.121.105
-64.225.121.121
  64.225.124.107
  64.225.126.22
  64.225.18.167
@@ -135864,7 +128651,6 @@
  64.227.101.45
  64.227.102.196
  64.227.104.19
-64.227.104.97
  64.227.105.229
  64.227.106.112
  64.227.106.15
@@ -135922,7 +128708,7 @@
  64.227.37.93
  64.227.38.194
  64.227.38.225
-64.227.38.252
+64.227.39.77
  64.227.40.76
  64.227.41.242
  64.227.41.250
@@ -135957,13 +128743,11 @@
  64.227.78.59
  64.227.78.60
  64.227.8.206
-64.227.80.206
  64.227.81.135
  64.227.84.155
  64.227.84.163
  64.227.88.175
  64.227.89.96
-64.227.91.117
  64.227.91.43
  64.227.93.129
  64.227.94.175
@@ -136000,6 +128784,7 @@
  64.239.69.157
  64.244.93.96
  64.25.215.250
+64.25.223.69
  64.253.12.117
  64.27.10.80
  64.27.7.215
@@ -136013,9 +128798,9 @@
  64.32.11.5
  64.32.11.52
  64.32.111.111
+64.32.122.146
  64.32.137.180
  64.32.30.130
-64.33.161.181
  64.33.68.176
  64.34.111.74
  64.34.161.16
@@ -136032,7 +128817,6 @@
  64.37.49.129
  64.38.225.100
  64.38.250.172
-64.39.90.88
  64.4.232.115
  64.4.243.184
  64.4.248.23
@@ -136044,18 +128828,20 @@
  64.40.250.5
  64.42.183.66
  64.43.143.140
+64.43.28.54
  64.44.133.131
  64.44.136.5
  64.44.40.66
  64.44.48.115
+64.44.48.172
  64.44.48.202
+64.44.48.249
  64.44.48.38
  64.44.48.81
  64.46.4.160
  64.46.6.37
  64.46.83.194
  64.50.161.60
-64.52.84.108
  64.52.84.166
  64.52.85.184
  64.52.85.67
@@ -136082,10 +128868,17 @@
  64.62.251.26
  64.62.252.163
  64.64.104.10
+64.64.225.130
  64.64.226.111
  64.64.227.224
  64.64.233.198
+64.64.234.113
  64.64.239.39
+64.64.240.225
+64.64.241.33
+64.64.242.67
+64.64.247.166
+64.66.17.16
  64.66.206.216
  64.67.24.39
  64.68.115.87
@@ -136214,10 +129007,13 @@
  64.85.173.128
  64.9.216.172
  64.90.194.108
-64.90.48.197
  64.90.49.164
+64.90.49.170
+64.90.49.179
+64.90.52.12
+64.90.52.142
+64.90.52.202
  64.91.224.243
-64.91.246.36
  64.91.248.243
  64.91.249.201
  64.91.249.207
@@ -136226,11 +129022,9 @@
  64.91.60.164
  64.91.60.84
  64.92.112.118
-64.93.127.114
  64.94.208.243
  64.95.102.36
  64.95.96.212
-64.95.96.217
  64.95.98.10
  64.95.98.11
  64.95.98.210
@@ -136254,7 +129048,6 @@
  649552219977630-dot-aql-rkl-evh.appspot.com
  64afe3595b5d8be9d60b91dae8c8bac4c1d83d72.info
  64bcf0cbd205160fc348d46e26baa31239b47dfa.info
-65.0.152.13
  65.0.177.21
  65.0.26.131
  65.0.26.31
@@ -136289,9 +129082,11 @@
  65.151.160.89
  65.155.32.102
  65.155.32.109
+65.155.32.118
  65.155.32.143
-65.155.32.149
  65.155.32.183
+65.155.32.209
+65.155.32.223
  65.155.32.42
  65.155.32.73
  65.158.126.62
@@ -136369,14 +129164,12 @@
  65.38.209.78
  65.41.155.160
  65.41.75.21
-65.43.215.203
+65.48.163.110
  65.49.10.143
  65.49.10.98
  65.49.108.248
  65.49.123.104
-65.49.138.204
  65.49.14.72
-65.49.142.57
  65.49.19.100
  65.49.19.102
  65.49.194.252
@@ -136454,13 +129247,12 @@
  65.49.52.162
  65.49.64.144
  65.49.71.68
-65.50.139.87
+65.50.142.134
  65.50.209.87
  65.51.251.217
  65.51.251.218
  65.52.123.63
  65.52.165.138
-65.52.179.163
  65.52.241.101
  65.52.32.40
  65.52.39.6
@@ -136472,6 +129264,7 @@
  65.64.8.59
  65.75.115.170
  65.75.128.151
+65.75.85.212
  65.75.93.36
  65.79.201.78
  65.79.201.79
@@ -136547,9 +129340,7 @@
  66.112.218.78
  66.113.184.161
  66.114.33.90
-66.115.142.4
  66.115.149.227
-66.115.149.229
  66.115.173.18
  66.117.3.211
  66.117.5.64
@@ -136560,9 +129351,10 @@
  66.118.164.146
  66.119.160.235
  66.119.169.237
-66.128.254.175
+66.128.241.179
  66.128.254.75
  66.128.255.153
+66.128.255.9
  66.128.34.136
  66.128.49.110
  66.128.50.218
@@ -136572,6 +129364,7 @@
  66.130.173.69
  66.130.183.142
  66.131.1.242
+66.131.100.5
  66.131.173.10
  66.131.216.79
  66.131.54.68
@@ -136599,6 +129392,7 @@
  66.150.70.216
  66.150.70.218
  66.150.70.235
+66.150.70.247
  66.150.71.11
  66.150.71.19
  66.150.71.20
@@ -136613,7 +129407,6 @@
  66.154.105.123
  66.154.112.136
  66.154.125.164
-66.158.196.23
  66.160.134.3
  66.160.136.2
  66.160.144.159
@@ -136629,16 +129422,13 @@
  66.160.201.122
  66.165.95.169
  66.168.40.18
-66.169.173.155
  66.169.226.99
  66.170.100.140
  66.171.177.230
  66.171.58.17
  66.171.8.55
  66.172.10.4
-66.172.100.237
  66.172.110.160
-66.172.111.150
  66.172.62.170
  66.172.62.33
  66.172.8.101
@@ -136668,6 +129458,7 @@
  66.186.10.67
  66.191.121.190
  66.191.142.68
+66.191.60.89
  66.192.70.36
  66.193.171.195
  66.193.171.202
@@ -136688,7 +129479,6 @@
  66.203.237.74
  66.206.13.51
  66.206.13.70
-66.206.237.99
  66.206.50.244
  66.206.52.5
  66.206.54.17
@@ -136708,20 +129498,22 @@
  66.209.100.230
  66.209.50.134
  66.209.69.165
-66.211.15.64
  66.212.133.130
  66.212.195.79
  66.212.54.146
  66.213.244.147
  66.214.138.114
+66.214.220.10
+66.214.76.49
  66.215.102.131
-66.215.195.141
+66.215.65.145
  66.216.127.211
  66.216.235.88
  66.218.60.80
  66.219.217.188
  66.220.12.90
  66.220.123.13
+66.220.13.139
  66.220.247.9
  66.220.31.111
  66.222.149.143
@@ -136783,6 +129575,7 @@
  66.240.237.172
  66.241.77.133
  66.242.215.2
+66.243.251.45
  66.244.236.248
  66.244.251.246
  66.248.202.132
@@ -136794,12 +129587,10 @@
  66.254.49.172
  66.27.69.145
  66.27.72.94
-66.27.73.7
  66.29.166.110
  66.30.148.140
  66.31.211.242
  66.33.212.122
-66.33.212.128
  66.33.219.12
  66.34.13.70
  66.34.200.215
@@ -136817,6 +129608,7 @@
  66.42.110.177
  66.42.116.123
  66.42.117.143
+66.42.127.172
  66.42.224.229
  66.42.36.97
  66.42.38.146
@@ -136827,10 +129619,10 @@
  66.42.53.154
  66.42.57.253
  66.42.58.34
+66.42.63.45
  66.42.66.102
  66.42.69.30
  66.42.73.236
-66.42.78.129
  66.42.80.98
  66.42.82.163
  66.42.83.35
@@ -136843,13 +129635,14 @@
  66.45.251.148
  66.45.255.91
  66.46.188.158
-66.49.131.65
  66.49.148.15
  66.50.187.118
  66.54.249.38
+66.54.98.231
  66.55.152.251
  66.55.161.16
  66.55.211.146
+66.57.242.110
  66.57.6.23
  66.58.181.13
  66.60.110.202
@@ -136901,7 +129694,6 @@
  66.70.223.27
  66.70.225.220
  66.70.228.168
-66.70.237.175
  66.70.238.23
  66.70.247.216
  66.71.188.11
@@ -136915,6 +129707,7 @@
  66.76.196.108
  66.76.27.71
  66.76.58.60
+66.76.90.70
  66.79.163.22
  66.8.203.16
  66.82.22.79
@@ -136931,9 +129724,9 @@
  66.90.118.42
  66.90.255.99
  66.91.238.2
+66.91.3.176
  66.96.10.225
  66.96.193.206
-66.96.206.135
  66.96.220.5
  66.96.228.119
  66.96.232.138
@@ -136982,7 +129775,6 @@
  67.134.17.67
  67.139.170.61
  67.140.204.16
-67.149.208.37
  67.149.215.139
  67.149.247.46
  67.149.32.99
@@ -137002,10 +129794,10 @@
  67.163.135.106
  67.163.161.107
  67.164.15.15
+67.166.182.55
  67.166.219.168
  67.166.23.54
  67.167.104.190
-67.167.234.78
  67.167.81.100
  67.168.119.246
  67.168.223.110
@@ -137015,11 +129807,13 @@
  67.170.193.219
  67.170.250.203
  67.170.72.219
+67.171.119.80
  67.173.127.128
  67.173.174.117
  67.173.5.122
  67.174.205.218
  67.175.194.37
+67.177.33.236
  67.180.251.161
  67.180.88.196
  67.183.251.230
@@ -137039,7 +129833,6 @@
  67.191.184.93
  67.191.206.122
  67.191.55.28
-67.191.74.66
  67.192.106.18
  67.192.120.182
  67.192.120.211
@@ -137058,7 +129851,10 @@
  67.198.140.87
  67.198.140.89
  67.198.140.92
+67.198.186.122
  67.198.205.4
+67.198.237.210
+67.198.237.212
  67.198.237.229
  67.199.146.71
  67.199.68.195
@@ -137073,9 +129869,6 @@
  67.204.21.1
  67.204.21.17
  67.205.108.141
-67.205.128.127
-67.205.128.232
-67.205.129.197
  67.205.131.191
  67.205.131.27
  67.205.132.105
@@ -137091,11 +129884,10 @@
  67.205.138.145
  67.205.138.198
  67.205.139.170
-67.205.14.157
  67.205.140.101
-67.205.140.145
  67.205.140.87
  67.205.141.165
+67.205.141.168
  67.205.141.85
  67.205.142.246
  67.205.142.48
@@ -137120,6 +129912,7 @@
  67.205.158.241
  67.205.158.248
  67.205.160.105
+67.205.161.2
  67.205.161.59
  67.205.161.8
  67.205.162.223
@@ -137138,8 +129931,6 @@
  67.205.176.238
  67.205.178.62
  67.205.178.8
-67.205.179.16
-67.205.179.170
  67.205.180.70
  67.205.181.229
  67.205.181.52
@@ -137154,7 +129945,6 @@
  67.205.190.4
  67.205.191.127
  67.205.241.96
-67.205.31.50
  67.205.38.108
  67.205.59.42
  67.206.200.122
@@ -137168,7 +129958,6 @@
  67.207.84.38
  67.207.84.53
  67.207.86.191
-67.207.87.138
  67.207.88.180
  67.207.88.69
  67.207.89.137
@@ -137183,7 +129972,6 @@
  67.207.93.228
  67.207.94.180
  67.207.94.70
-67.209.114.118
  67.209.176.31
  67.209.185.210
  67.209.185.218
@@ -137191,7 +129979,6 @@
  67.209.190.12
  67.210.145.161
  67.210.146.61
-67.210.149.193
  67.210.151.33
  67.210.155.1
  67.210.158.1
@@ -137217,6 +130004,8 @@
  67.213.129.59
  67.213.212.11
  67.213.212.12
+67.213.212.15
+67.213.212.16
  67.213.87.21
  67.213.88.27
  67.214.167.194
@@ -137235,6 +130024,7 @@
  67.216.216.103
  67.216.220.27
  67.217.12.169
+67.217.145.254
  67.218.131.214
  67.218.133.193
  67.218.133.237
@@ -137261,8 +130051,6 @@
  67.222.131.151
  67.222.138.46
  67.222.16.112
-67.222.237.232
-67.223.160.137
  67.225.130.109
  67.225.139.208
  67.225.147.71
@@ -137279,7 +130067,6 @@
  67.227.167.130
  67.227.193.174
  67.227.202.86
-67.227.226.240
  67.228.177.126
  67.228.186.91
  67.228.217.155
@@ -137359,10 +130146,13 @@
  67.237.19.149
  67.237.24.39
  67.237.24.46
+67.238.132.251
  67.238.167.156
+67.240.237.47
  67.240.254.142
  67.241.150.89
  67.242.106.156
+67.242.117.82
  67.244.29.52
  67.245.120.145
  67.245.36.139
@@ -137377,6 +130167,7 @@
  67.253.129.123
  67.253.174.70
  67.253.203.141
+67.253.3.15
  67.253.72.119
  67.253.90.179
  67.254.116.89
@@ -137403,14 +130194,12 @@
  67.58.222.7
  67.59.151.227
  67.59.156.163
-67.6.135.111
  67.60.137.219
  67.61.108.237
  67.61.119.3
  67.61.130.178
  67.68.120.95
  67.68.88.78
-67.69.76.229
  67.7.5.17
  67.70.142.247
  67.70.146.48
@@ -137427,6 +130216,7 @@
  67.80.164.152
  67.81.110.191
  67.81.98.111
+67.82.124.241
  67.82.192.248
  67.82.212.255
  67.82.240.176
@@ -137463,11 +130253,11 @@
  67ytfffyt.ddns.net
  68.0.185.136
  68.0.230.118
+68.1.191.25
  68.1.85.177
  68.10.137.56
  68.10.18.22
  68.101.62.26
-68.102.243.52
  68.102.85.136
  68.103.253.43
  68.104.213.146
@@ -137479,19 +130269,17 @@
  68.106.25.44
  68.107.135.126
  68.108.234.217
-68.109.122.42
  68.109.233.150
  68.109.71.148
  68.110.167.212
-68.111.207.232
  68.111.3.250
  68.114.229.171
  68.114.95.61
  68.115.200.170
+68.116.4.158
  68.116.41.6
  68.116.72.158
  68.117.163.102
-68.117.190.111
  68.119.137.39
  68.119.215.85
  68.119.52.128
@@ -137500,13 +130288,11 @@
  68.12.98.161
  68.125.100.6
  68.129.153.254
+68.129.249.17
  68.129.67.139
+68.129.87.163
  68.132.136.198
  68.132.64.146
-68.134.118.57
-68.134.149.100
-68.134.161.187
-68.134.233.45
  68.134.33.199
  68.135.5.60
  68.14.193.71
@@ -137528,10 +130314,9 @@
  68.150.0.177
  68.150.109.112
  68.150.197.122
-68.150.203.43
  68.150.248.120
+68.150.88.99
  68.151.210.44
-68.151.4.2
  68.162.121.232
  68.162.151.51
  68.166.0.184
@@ -137547,7 +130332,7 @@
  68.169.40.75
  68.169.43.232
  68.169.51.212
-68.170.34.39
+68.170.227.215
  68.170.36.100
  68.170.71.88
  68.171.103.75
@@ -137560,12 +130345,12 @@
  68.172.243.146
  68.173.119.23
  68.173.243.56
-68.173.243.86
  68.173.245.139
  68.174.15.223
  68.174.182.226
  68.174.233.93
  68.174.74.55
+68.175.107.153
  68.175.12.190
  68.175.89.61
  68.178.103.180
@@ -137652,12 +130437,11 @@
  68.183.137.173
  68.183.137.83
  68.183.140.19
+68.183.141.242
  68.183.142.76
  68.183.143.192
-68.183.143.91
  68.183.145.59
  68.183.146.178
-68.183.146.249
  68.183.147.162
  68.183.147.213
  68.183.147.58
@@ -137696,7 +130480,6 @@
  68.183.186.231
  68.183.186.232
  68.183.186.29
-68.183.187.124
  68.183.188.105
  68.183.188.150
  68.183.188.250
@@ -137708,11 +130491,11 @@
  68.183.189.24
  68.183.19.26
  68.183.19.84
-68.183.190.138
  68.183.190.164
  68.183.190.199
  68.183.190.43
  68.183.190.86
+68.183.191.104
  68.183.191.152
  68.183.191.247
  68.183.191.39
@@ -137727,7 +130510,6 @@
  68.183.195.79
  68.183.195.93
  68.183.197.255
-68.183.198.132
  68.183.198.153
  68.183.198.68
  68.183.201.105
@@ -137738,6 +130520,7 @@
  68.183.203.160
  68.183.203.98
  68.183.204.183
+68.183.204.9
  68.183.205.14
  68.183.205.35
  68.183.205.58
@@ -137756,7 +130539,6 @@
  68.183.218.50
  68.183.219.135
  68.183.22.152
-68.183.22.30
  68.183.22.85
  68.183.221.115
  68.183.225.160
@@ -137783,17 +130565,18 @@
  68.183.234.51
  68.183.235.104
  68.183.235.141
+68.183.235.253
  68.183.236.29
  68.183.236.92
  68.183.237.129
  68.183.237.8
  68.183.238.175
-68.183.239.89
  68.183.240.19
  68.183.27.61
  68.183.27.89
  68.183.28.137
  68.183.29.78
+68.183.30.178
  68.183.31.114
  68.183.35.255
  68.183.36.5
@@ -137836,7 +130619,6 @@
  68.183.80.139
  68.183.82.166
  68.183.82.97
-68.183.83.116
  68.183.83.117
  68.183.83.38
  68.183.86.159
@@ -137858,31 +130640,28 @@
  68.184.193.116
  68.184.194.34
  68.184.24.159
-68.185.146.21
  68.185.36.187
-68.186.178.240
  68.186.33.98
  68.186.85.14
  68.187.220.146
  68.188.11.189
  68.188.112.97
+68.188.198.42
  68.188.63.149
  68.189.184.40
  68.190.212.219
-68.191.129.187
-68.192.1.81
  68.192.21.94
  68.192.81.18
  68.193.247.240
  68.193.34.13
+68.194.115.117
  68.194.85.201
  68.195.60.198
  68.196.183.69
  68.196.26.55
  68.196.44.255
+68.196.90.139
  68.197.0.202
-68.197.64.252
-68.199.157.183
  68.199.18.6
  68.199.236.241
  68.199.40.52
@@ -137899,8 +130678,8 @@
  68.224.249.74
  68.224.6.232
  68.226.217.54
-68.226.43.211
  68.228.184.215
+68.229.35.244
  68.230.136.137
  68.230.26.205
  68.231.7.169
@@ -137909,6 +130688,7 @@
  68.233.22.64
  68.233.33.2
  68.235.133.5
+68.235.145.171
  68.236.122.177
  68.236.156.170
  68.236.212.86
@@ -137918,10 +130698,8 @@
  68.253.255.10
  68.255.154.241
  68.255.156.146
-68.3.22.232
  68.32.243.30
  68.32.248.98
-68.32.78.109
  68.35.122.196
  68.37.147.146
  68.37.69.206
@@ -137945,9 +130723,10 @@
  68.48.240.245
  68.48.242.227
  68.48.247.106
-68.5.173.208
  68.5.37.81
+68.5.44.226
  68.50.156.55
+68.50.46.131
  68.51.111.179
  68.51.146.22
  68.51.227.33
@@ -138040,6 +130819,7 @@
  68853653.com
  68853663.com
  688563356.com
+68856336.com
  688563365.com
  688563536.com
  688563635.com
@@ -138068,16 +130848,18 @@
  69.1.3.244
  69.10.135.205
  69.10.136.56
+69.10.193.239
  69.10.40.42
  69.10.41.70
  69.10.62.78
  69.10.63.246
  69.11.55.144
+69.112.106.211
  69.112.37.174
  69.115.23.90
  69.116.18.32
  69.116.209.199
-69.117.60.59
+69.116.44.16
  69.118.182.115
  69.119.193.9
  69.119.30.86
@@ -138097,16 +130879,19 @@
  69.12.70.34
  69.12.75.6
  69.12.80.84
+69.12.82.220
  69.12.84.122
  69.12.88.100
  69.12.88.102
  69.12.88.72
  69.12.90.242
+69.120.131.36
+69.120.151.146
  69.120.242.190
  69.120.85.61
  69.121.59.0
  69.124.231.110
-69.125.82.166
+69.126.238.180
  69.126.37.232
  69.127.214.47
  69.13.196.47
@@ -138121,47 +130906,47 @@
  69.137.140.197
  69.138.189.201
  69.139.44.61
-69.139.69.253
  69.14.145.75
  69.14.157.165
  69.14.158.98
  69.14.172.150
  69.14.208.221
+69.141.236.28
  69.143.214.211
  69.144.171.44
+69.144.99.202
  69.145.122.160
  69.146.134.2
  69.146.228.143
  69.146.96.117
-69.147.219.12
-69.147.219.122
-69.147.219.174
-69.147.219.181
-69.147.219.19
-69.147.219.209
+69.147.219.203
+69.147.219.235
+69.147.219.51
  69.147.219.6
-69.147.219.62
-69.147.219.72
  69.147.220.146
-69.147.220.173
-69.147.220.176
-69.147.220.243
+69.147.220.223
  69.147.220.26
-69.147.221.172
+69.147.220.31
+69.147.220.89
+69.147.220.95
+69.147.221.135
+69.147.221.205
  69.147.221.228
  69.147.221.244
+69.147.221.250
+69.147.221.27
  69.147.221.39
+69.147.221.44
  69.147.221.48
-69.147.221.9
-69.147.221.96
-69.147.222.117
-69.147.222.186
+69.147.222.112
+69.147.222.173
  69.147.222.52
+69.147.222.60
+69.148.175.185
  69.148.226.251
  69.15.68.38
  69.150.120.253
  69.151.70.146
-69.157.7.249
  69.158.165.14
  69.158.207.141
  69.158.53.171
@@ -138169,14 +130954,10 @@
  69.159.47.149
  69.16.231.139
  69.16.252.128
-69.160.24.5
-69.160.28.173
-69.160.28.204
  69.160.38.10
  69.162.105.66
  69.162.110.142
  69.162.111.67
-69.162.120.70
  69.162.124.35
  69.162.67.26
  69.162.69.205
@@ -138186,39 +130967,46 @@
  69.162.86.229
  69.162.99.158
  69.162.99.42
-69.163.160.143
+69.163.160.123
+69.163.160.135
  69.163.160.163
  69.163.160.170
-69.163.160.191
  69.163.160.195
-69.163.160.228
+69.163.160.64
  69.163.161.111
-69.163.162.127
+69.163.161.118
+69.163.161.162
+69.163.161.178
+69.163.161.226
+69.163.161.87
  69.163.162.172
+69.163.162.202
+69.163.162.240
  69.163.162.253
  69.163.163.117
-69.163.163.167
-69.163.163.169
-69.163.163.45
+69.163.163.120
+69.163.163.159
+69.163.163.171
+69.163.163.53
  69.163.163.54
-69.163.163.56
-69.163.163.59
-69.163.163.62
+69.163.163.6
+69.163.163.63
+69.163.164.255
+69.163.164.29
  69.163.164.52
-69.163.165.119
-69.163.165.134
+69.163.164.68
+69.163.165.132
+69.163.165.172
  69.163.165.180
-69.163.165.204
+69.163.165.243
  69.163.166.143
+69.163.166.169
+69.163.166.173
  69.163.166.25
-69.163.166.61
-69.163.166.91
-69.163.166.93
-69.163.167.169
+69.163.166.97
  69.163.169.133
  69.163.178.140
  69.163.179.6
-69.163.224.120
  69.163.225.131
  69.163.248.109
  69.163.33.84
@@ -138234,13 +131022,13 @@
  69.164.212.86
  69.165.136.30
  69.165.224.111
+69.166.119.6
  69.166.233.250
  69.167.1.14
  69.167.1.238
  69.167.12.250
  69.167.13.148
  69.167.151.209
-69.167.152.53
  69.167.22.139
  69.167.23.48
  69.167.23.61
@@ -138278,14 +131066,12 @@
  69.171.78.223
  69.171.78.225
  69.172.165.196
-69.172.74.142
  69.172.78.17
  69.172.87.212
  69.174.245.163
  69.175.109.74
  69.175.127.74
  69.175.14.34
-69.175.19.105
  69.175.29.26
  69.175.44.42
  69.175.49.230
@@ -138302,7 +131088,6 @@
  69.179.38.78
  69.179.39.184
  69.179.4.41
-69.180.156.84
  69.181.162.176
  69.181.88.180
  69.183.32.121
@@ -138333,7 +131118,6 @@
  69.197.189.51
  69.197.32.119
  69.199.44.59
-69.2.171.199
  69.2.244.202
  69.20.66.228
  69.20.66.236
@@ -138361,15 +131145,12 @@
  69.238.202.251
  69.243.150.123
  69.245.71.26
-69.246.100.84
  69.246.26.72
-69.247.36.145
  69.247.89.58
  69.247.97.80
  69.248.131.25
  69.248.146.7
  69.249.137.104
-69.25.110.109
  69.25.218.73
  69.25.236.60
  69.250.156.161
@@ -138418,6 +131199,7 @@
  69.36.5.119
  69.36.94.214
  69.4.147.182
+69.4.234.44
  69.4.234.81
  69.4.32.137
  69.4.80.123
@@ -138425,6 +131207,7 @@
  69.4.94.107
  69.4.94.142
  69.41.0.45
+69.41.2.188
  69.42.66.94
  69.42.89.216
  69.43.168.202
@@ -138432,6 +131215,7 @@
  69.47.133.80
  69.47.161.24
  69.50.181.85
+69.50.64.15
  69.51.16.248
  69.51.197.165
  69.51.20.152
@@ -138442,7 +131226,6 @@
  69.55.35.193
  69.55.49.187
  69.55.54.65
-69.55.55.220
  69.55.62.9
  69.57.164.32
  69.57.195.97
@@ -138453,9 +131236,7 @@
  69.58.178.58
  69.58.178.59
  69.58.2.53
-69.58.3.235
  69.58.4.140
-69.58.6.53
  69.59.18.113
  69.59.18.206
  69.59.18.22
@@ -138469,7 +131250,6 @@
  69.62.176.156
  69.62.183.244
  69.62.187.248
-69.62.61.35
  69.63.134.83
  69.63.16.6
  69.63.68.194
@@ -138497,7 +131277,6 @@
  69.72.232.122
  69.73.133.224
  69.73.144.112
-69.73.219.57
  69.73.28.41
  69.75.105.124
  69.75.115.194
@@ -138505,6 +131284,7 @@
  69.76.196.64
  69.76.240.206
  69.76.49.0
+69.79.11.133
  69.8.34.165
  69.80.29.102
  69.81.139.73
@@ -138532,17 +131312,11 @@
  69.92.203.224
  69.94.12.235
  69.94.125.100
-69.94.130.18
  69.94.140.199
  69.94.140.200
-69.94.140.203
  69.94.140.204
-69.94.140.206
-69.94.140.207
  69.94.140.209
  69.94.140.212
-69.94.140.229
-69.94.148.245
  69.94.27.169
  69.94.33.254
  69.94.47.76
@@ -138628,6 +131402,7 @@
  70.109.53.128
  70.110.160.224
  70.112.139.159
+70.112.162.144
  70.112.215.0
  70.113.239.98
  70.113.86.177
@@ -138640,6 +131415,7 @@
  70.117.70.82
  70.118.240.88
  70.118.31.195
+70.119.144.148
  70.120.196.27
  70.120.24.242
  70.120.242.204
@@ -138656,16 +131432,17 @@
  70.127.155.33
  70.127.96.78
  70.131.38.109
-70.15.246.23
  70.16.157.162
  70.161.250.9
  70.162.148.24
  70.163.188.190
  70.164.0.233
  70.165.65.233
+70.166.181.164
  70.166.204.38
  70.167.79.116
  70.168.13.172
+70.168.13.18
  70.168.13.187
  70.168.249.154
  70.168.249.162
@@ -138689,12 +131466,13 @@
  70.177.74.63
  70.179.168.149
  70.18.5.86
+70.182.149.123
  70.182.172.19
  70.182.204.98
  70.182.252.189
  70.183.15.51
+70.183.193.82
  70.184.112.55
-70.184.13.81
  70.184.38.52
  70.184.69.146
  70.184.75.210
@@ -138705,7 +131483,6 @@
  70.188.167.133
  70.188.193.251
  70.189.113.219
-70.189.236.35
  70.19.45.204
  70.190.0.38
  70.191.39.150
@@ -138730,6 +131507,7 @@
  70.32.94.58
  70.32.95.51
  70.33.177.251
+70.34.5.222
  70.35.191.24
  70.35.197.138
  70.35.198.115
@@ -138744,12 +131522,10 @@
  70.35.98.12
  70.36.100.156
  70.36.101.145
-70.37.100.72
  70.37.109.62
  70.37.50.171
  70.37.56.225
  70.37.56.247
-70.37.67.55
  70.37.75.157
  70.37.98.52
  70.39.14.91
@@ -138757,6 +131533,7 @@
  70.40.210.173
  70.40.213.248
  70.42.131.170
+70.44.139.37
  70.44.34.81
  70.44.89.180
  70.45.113.17
@@ -138789,7 +131566,6 @@
  70.65.174.69
  70.65.199.149
  70.66.139.68
-70.67.15.93
  70.68.167.156
  70.68.171.11
  70.68.226.192
@@ -138802,12 +131578,12 @@
  70.72.206.251
  70.73.144.181
  70.73.29.74
+70.76.22.120
  70.76.237.144
  70.77.204.98
  70.77.89.64
  70.78.110.101
  70.78.140.240
-70.79.173.244
  70.79.247.86
  70.80.14.169
  70.80.245.209
@@ -138869,7 +131645,9 @@
  71.105.155.204
  71.105.44.45
  71.105.48.7
+71.11.166.33
  71.11.208.97
+71.114.46.209
  71.117.145.210
  71.12.94.6
  71.122.164.51
@@ -138878,25 +131656,24 @@
  71.127.149.226
  71.127.156.63
  71.13.105.122
-71.13.20.33
  71.13.29.182
  71.13.87.122
  71.13.92.62
+71.135.93.156
  71.14.237.124
-71.14.6.226
  71.143.206.208
  71.144.19.146
  71.146.114.111
  71.15.138.7
  71.15.245.148
  71.15.45.96
+71.15.59.142
  71.150.147.71
  71.161.90.231
  71.162.172.166
  71.163.243.192
  71.163.29.121
  71.167.164.113
-71.167.17.150
  71.168.137.61
  71.168.149.14
  71.168.214.49
@@ -138939,19 +131716,22 @@
  71.198.208.72
  71.198.255.195
  71.199.148.184
+71.2.125.8
  71.200.246.11
  71.200.70.202
  71.200.89.21
  71.204.162.179
+71.204.165.1
  71.204.206.246
  71.204.209.251
  71.204.34.191
-71.205.165.16
  71.208.12.25
  71.208.148.77
  71.208.160.24
  71.208.161.159
+71.208.167.92
  71.208.184.143
+71.208.229.246
  71.208.25.136
  71.208.49.101
  71.208.57.55
@@ -138959,13 +131739,13 @@
  71.208.76.221
  71.209.190.79
  71.209.33.111
-71.210.151.15
  71.210.198.16
  71.210.31.246
  71.211.146.65
  71.211.16.236
  71.212.144.220
  71.213.117.120
+71.213.140.253
  71.213.141.244
  71.213.146.149
  71.213.160.101
@@ -138985,27 +131765,21 @@
  71.213.58.206
  71.213.58.81
  71.213.86.3
-71.213.86.54
  71.213.90.208
  71.214.172.70
  71.215.100.233
-71.217.143.161
-71.217.145.140
+71.217.87.155
  71.218.136.61
  71.218.145.149
  71.218.21.12
+71.220.148.25
  71.221.0.72
-71.221.112.56
  71.221.67.31
  71.222.149.28
  71.222.26.182
-71.222.44.25
-71.222.58.207
  71.222.8.178
  71.223.53.159
  71.225.121.125
-71.225.176.25
-71.227.234.201
  71.227.242.72
  71.228.126.91
  71.228.134.158
@@ -139023,6 +131797,7 @@
  71.237.161.118
  71.237.97.77
  71.242.127.196
+71.242.85.177
  71.244.185.101
  71.244.226.161
  71.244.49.72
@@ -139041,13 +131816,13 @@
  71.32.62.252
  71.33.135.151
  71.33.149.145
-71.33.210.55
  71.33.232.126
  71.34.28.180
  71.36.106.6
  71.37.238.85
  71.38.117.8
  71.38.146.51
+71.38.47.12
  71.38.90.235
  71.40.162.211
  71.40.28.250
@@ -139098,7 +131873,6 @@
  71.6.167.142
  71.6.167.197
  71.6.199.23
-71.6.220.101
  71.6.231.186
  71.6.231.8
  71.6.231.80
@@ -139113,12 +131887,14 @@
  71.6.232.8
  71.60.175.80
  71.60.192.20
+71.60.32.56
  71.60.74.147
  71.62.129.30
  71.62.13.183
  71.62.173.58
  71.63.10.44
  71.63.116.146
+71.64.128.226
  71.66.216.5
  71.67.85.90
  71.69.155.207
@@ -139127,7 +131903,6 @@
  71.72.135.3
  71.72.140.136
  71.72.196.159
-71.72.234.20
  71.73.5.169
  71.74.113.236
  71.74.184.137
@@ -139141,9 +131916,6 @@
  71.80.74.41
  71.81.152.192
  71.82.135.102
-71.83.32.49
-71.84.159.21
-71.84.26.42
  71.85.115.26
  71.85.117.51
  71.85.218.231
@@ -139153,14 +131925,10 @@
  71.88.207.47
  71.89.183.246
  71.89.209.212
-71.91.1.106
-71.91.33.165
-71.91.70.119
  71.92.201.42
  71.92.202.13
  71.93.148.59
  71.93.180.247
-71.93.232.3
  71.93.27.91
  71.94.131.149
  71.94.136.19
@@ -139180,6 +131948,7 @@
  71sise.com
  71zhuan.com
  72.0.242.105
+72.0.44.212
  72.10.28.190
  72.10.32.139
  72.10.75.10
@@ -139190,6 +131959,8 @@
  72.11.157.211
  72.11.166.13
  72.12.131.162
+72.128.111.73
+72.128.139.18
  72.128.6.3
  72.129.153.215
  72.13.171.216
@@ -139199,12 +131970,10 @@
  72.132.27.158
  72.133.177.119
  72.134.178.149
-72.134.205.184
  72.134.245.7
  72.134.81.111
  72.135.224.85
  72.135.232.168
-72.137.20.160
  72.137.82.73
  72.138.45.190
  72.139.68.174
@@ -139215,7 +131984,6 @@
  72.14.186.84
  72.14.190.72
  72.14.191.154
-72.14.21.2
  72.140.179.221
  72.141.204.207
  72.141.51.198
@@ -139248,7 +132016,6 @@
  72.17.22.30
  72.17.60.150
  72.172.163.106
-72.174.209.240
  72.175.14.188
  72.176.72.30
  72.177.87.97
@@ -139256,7 +132023,6 @@
  72.180.13.251
  72.180.80.67
  72.182.43.135
-72.183.114.71
  72.183.63.214
  72.186.136.247
  72.186.137.156
@@ -139269,6 +132035,7 @@
  72.189.31.82
  72.189.57.105
  72.19.61.122
+72.190.149.12
  72.191.113.27
  72.191.230.57
  72.192.19.169
@@ -139283,6 +132050,7 @@
  72.197.219.254
  72.198.122.235
  72.198.29.30
+72.199.58.161
  72.2.20.39
  72.20.137.133
  72.20.176.209
@@ -139307,7 +132075,6 @@
  72.218.42.62
  72.219.185.161
  72.22.247.189
-72.220.49.41
  72.221.1.78
  72.221.164.34
  72.221.164.35
@@ -139356,13 +132123,16 @@
  72.249.108.180
  72.249.108.220
  72.249.144.95
+72.249.233.193
  72.249.235.194
  72.249.235.201
  72.250.153.47
  72.250.184.57
+72.250.20.19
  72.250.42.191
  72.251.234.218
  72.251.243.50
+72.252.113.178
  72.252.173.153
  72.252.196.30
  72.252.201.135
@@ -139401,7 +132171,6 @@
  72.34.42.146
  72.34.42.196
  72.34.43.74
-72.37.129.79
  72.37.199.41
  72.37.212.230
  72.38.0.172
@@ -139413,28 +132182,23 @@
  72.4.44.28
  72.42.162.79
  72.42.170.60
-72.43.142.218
  72.43.207.8
  72.43.232.254
+72.43.71.36
  72.45.49.211
  72.46.135.146
  72.46.157.102
  72.46.205.70
  72.46.207.50
-72.47.186.48
  72.47.248.48
  72.48.208.215
  72.49.128.94
  72.49.214.143
  72.49.49.11
  72.50.240.124
-72.50.5.90
-72.50.5.97
  72.50.54.38
-72.50.6.178
  72.51.34.249
  72.51.6.183
-72.52.104.90
  72.52.111.58
  72.52.112.209
  72.52.112.25
@@ -139469,12 +132233,11 @@
  72.78.238.89
  72.79.35.91
  72.79.54.220
+72.79.58.112
  72.80.116.10
  72.80.198.241
  72.80.233.20
  72.80.6.222
-72.82.235.213
-72.83.137.48
  72.83.216.67
  72.83.232.54
  72.84.247.5
@@ -139503,7 +132266,6 @@
  72.90.235.219bin.sh
  72.90.89.108
  72.91.70.103
-72.93.236.125
  72.93.243.211
  72.93.4.198
  72.94.181.219
@@ -139554,9 +132316,7 @@
  73.110.170.108
  73.110.222.253
  73.112.84.96
-73.114.54.239
  73.114.91.101
-73.115.114.224
  73.116.193.136
  73.117.1.162
  73.117.30.174
@@ -139564,22 +132324,21 @@
  73.12.223.81
  73.121.248.161
  73.122.168.118
+73.123.126.196
  73.123.232.227
  73.124.179.25
  73.124.89.175
  73.13.104.201
  73.131.78.250
  73.135.41.55
+73.136.129.35
  73.138.248.232
  73.138.75.151
  73.139.190.176
  73.14.213.38
  73.14.89.87
-73.141.87.59
-73.143.70.179
  73.144.254.23
  73.145.168.196
-73.145.220.29
  73.148.22.210
  73.148.23.198
  73.15.247.118
@@ -139589,10 +132348,10 @@
  73.151.63.2
  73.152.157.213
  73.152.233.100
-73.154.78.184
  73.156.166.223
  73.156.172.155
  73.157.14.193
+73.157.4.128
  73.158.127.66
  73.158.138.247
  73.16.207.94
@@ -139601,22 +132360,22 @@
  73.162.234.132
  73.163.180.189
  73.164.13.142
+73.164.174.146
  73.164.52.11
  73.168.170.206
  73.169.135.137
  73.169.136.149
-73.169.177.150
  73.170.66.172
  73.171.139.42
  73.171.28.104
  73.171.96.175
-73.172.88.243
  73.175.16.198
  73.175.179.139
  73.176.169.253
  73.177.35.27
  73.179.171.207
  73.179.223.7
+73.180.45.23
  73.181.193.36
  73.181.212.48
  73.182.190.68
@@ -139652,6 +132411,7 @@
  73.209.24.166
  73.209.24.30
  73.209.30.60
+73.21.4.103
  73.21.65.208
  73.210.156.165
  73.211.134.215
@@ -139659,11 +132419,10 @@
  73.213.160.205
  73.213.26.179
  73.215.97.122
-73.216.78.94
  73.217.114.206
  73.217.79.105
-73.218.33.147
  73.22.153.25
+73.221.221.48
  73.221.249.191
  73.222.179.128
  73.222.94.184
@@ -139676,32 +132435,34 @@
  73.228.107.58
  73.228.125.7
  73.228.145.60
+73.228.154.233
  73.229.153.51
  73.229.229.82
+73.229.232.218
  73.23.241.110
  73.230.25.82
  73.231.231.83
  73.231.235.10
-73.232.46.104
  73.234.13.63
  73.235.226.74
+73.237.185.95
  73.239.107.185
  73.239.11.159
+73.239.162.77
  73.239.197.175
-73.239.95.24
  73.24.80.142
  73.240.171.67
  73.240.190.65
  73.242.184.160
  73.243.176.4
-73.243.213.159
  73.244.18.79
+73.244.49.39
  73.244.81.190
  73.245.214.234
  73.245.31.179
+73.246.103.38
  73.246.233.197
  73.246.239.110
-73.246.86.229
  73.248.190.241
  73.248.234.184
  73.25.123.164
@@ -139710,8 +132471,9 @@
  73.252.141.43
  73.254.207.2
  73.255.2.67
-73.255.92.126
  73.26.98.45
+73.27.120.111
+73.29.139.28
  73.29.37.188
  73.3.250.179
  73.30.120.173
@@ -139722,9 +132484,11 @@
  73.35.60.4
  73.36.232.192
  73.37.123.160
+73.38.213.196
  73.39.161.79
  73.39.60.223
  73.40.163.97
+73.40.76.9
  73.41.119.62
  73.42.127.157
  73.42.45.230
@@ -139737,7 +132501,6 @@
  73.47.229.191
  73.48.143.14
  73.49.178.35
-73.49.2.111
  73.49.47.252
  73.5.121.204
  73.5.210.149
@@ -139752,19 +132515,20 @@
  73.57.140.214
  73.57.140.229
  73.59.4.102
+73.6.184.64
  73.60.227.128
+73.61.193.229
  73.61.6.1
  73.62.12.214
  73.62.147.174
-73.62.252.237
  73.65.229.77
+73.65.96.167
  73.66.93.2
  73.67.133.25
  73.67.179.188
  73.7.135.222
  73.70.143.219
  73.72.220.62
-73.72.85.92
  73.73.230.131
  73.73.90.68
  73.74.145.41
@@ -139777,12 +132541,15 @@
  73.77.111.54
  73.77.14.20
  73.78.37.96
+73.78.6.54
  73.8.77.18
  73.82.57.252
+73.82.76.68
  73.83.103.79
  73.84.152.17
  73.84.156.242
  73.84.49.191
+73.85.11.108
  73.85.125.227
  73.85.151.74
  73.85.21.193
@@ -139795,6 +132562,7 @@
  73.93.179.188
  73.93.184.25
  73.93.252.130
+73.95.116.240
  73.96.104.130
  73.96.105.70
  73.96.105.92
@@ -139802,7 +132570,8 @@
  73.96.30.69
  73.97.12.152
  73.97.164.59
-73.97.88.48
+73.98.227.247
+73.98.237.75
  73.98.51.107
  73.99.122.204
  73.99.199.15
@@ -139872,6 +132641,8 @@
  74.120.14.37
  74.120.14.38
  74.120.14.39
+74.120.14.40
+74.120.14.53
  74.120.14.54
  74.120.14.55
  74.120.14.56
@@ -139935,22 +132706,20 @@
  74.133.89.164
  74.134.117.119
  74.134.190.205
-74.134.253.26
  74.135.120.91
  74.137.220.142
  74.138.14.217
-74.138.155.112
-74.138.180.108
  74.138.26.36
  74.138.28.69
  74.14.62.39
  74.141.132.233
-74.143.126.50
+74.141.95.6
  74.15.221.214
  74.15.64.117
  74.15.97.64
  74.192.32.213
  74.194.247.205
+74.194.96.98
  74.195.115.176
  74.196.136.236
  74.199.84.77
@@ -139971,7 +132740,6 @@
  74.204.66.105
  74.205.120.232
  74.205.223.153
-74.207.152.2
  74.207.226.232
  74.207.227.96
  74.207.228.170
@@ -139993,7 +132761,6 @@
  74.208.156.182
  74.208.173.53
  74.208.173.91
-74.208.182.190
  74.208.194.89
  74.208.199.16
  74.208.214.68
@@ -140010,23 +132777,18 @@
  74.209.192.67
  74.209.192.68
  74.209.192.69
-74.209.20.207
  74.210.133.140
  74.210.140.218
  74.213.166.212
  74.213.177.58
-74.213.232.178
-74.213.234.196
  74.214.177.61
  74.214.230.200
  74.214.242.140
  74.215.179.188
  74.215.219.214
-74.217.186.42
  74.217.28.153
  74.218.23.14
  74.219.188.146
-74.219.208.214
  74.219.225.232
  74.219.9.2
  74.220.169.212
@@ -140045,7 +132807,7 @@
  74.244.125.55
  74.255.67.50
  74.3.104.66
-74.3.173.35
+74.3.160.18
  74.4.107.20
  74.4.245.0
  74.40.205.197
@@ -140053,6 +132815,7 @@
  74.50.51.115
  74.50.85.15
  74.50.85.59
+74.51.12.42
  74.52.164.18
  74.52.17.34
  74.53.121.130
@@ -140078,7 +132841,6 @@
  74.62.215.218
  74.63.199.120
  74.63.199.3
-74.63.204.2
  74.63.216.218
  74.63.220.148
  74.63.221.49
@@ -140092,14 +132854,13 @@
  74.68.157.90
  74.69.118.0
  74.7.84.106
-74.70.173.40
  74.70.21.65
  74.71.15.170
  74.71.152.200
  74.72.123.96
  74.72.210.86
  74.73.249.7
-74.75.117.254
+74.75.104.224
  74.75.165.81
  74.76.61.139
  74.77.90.160
@@ -140107,6 +132868,7 @@
  74.78.244.207
  74.78.31.240
  74.79.124.131
+74.80.20.41
  74.81.68.114
  74.82.1.152
  74.82.1.8
@@ -140198,7 +132960,6 @@
  74.88.21.70
  74.89.167.253
  74.89.44.115
-74.91.113.107
  74.91.23.194
  74.91.24.186
  74.91.24.202
@@ -140236,6 +132997,7 @@
  75.102.39.180
  75.104.11.91
  75.107.29.173
+75.108.21.14
  75.108.43.50
  75.109.102.8
  75.109.199.102
@@ -140243,11 +133005,9 @@
  75.109.226.104
  75.109.23.22
  75.109.249.165
-75.109.60.86
  75.111.125.131
  75.111.126.62
  75.111.168.21
-75.111.174.35
  75.112.160.49
  75.112.68.166
  75.112.74.197
@@ -140258,7 +133018,8 @@
  75.119.201.9
  75.119.205.12
  75.119.215.210
-75.120.64.138
+75.120.10.245
+75.120.79.232
  75.121.69.141
  75.125.130.122
  75.125.138.114
@@ -140289,12 +133050,9 @@
  75.13.70.187
  75.130.124.90
  75.130.218.151
-75.133.127.83
  75.133.96.235
-75.134.17.127
  75.134.60.248
  75.136.121.230
-75.136.226.212
  75.137.241.100
  75.138.248.60
  75.139.38.211
@@ -140304,7 +133062,6 @@
  75.140.86.113
  75.141.57.156
  75.142.211.18
-75.142.248.224
  75.142.255.87
  75.143.100.75
  75.143.172.32
@@ -140331,6 +133088,7 @@
  75.155.172.108
  75.155.174.150
  75.155.187.117
+75.155.214.45
  75.156.105.135
  75.156.107.154
  75.156.127.87
@@ -140350,26 +133108,24 @@
  75.162.60.163
  75.163.227.196
  75.165.135.243
+75.165.14.36
  75.165.183.246
-75.166.180.59
  75.166.186.56
  75.169.110.215
  75.169.13.18
  75.169.135.34
  75.170.209.26
+75.170.235.161
  75.171.42.202
  75.172.114.142
-75.172.50.13
  75.172.51.103
  75.172.9.14
  75.173.5.69
  75.175.2.246
-75.175.66.243
  75.177.178.218
  75.181.139.49
  75.183.15.12
  75.183.40.203
-75.185.237.145
  75.185.243.179
  75.188.38.166
  75.188.82.235
@@ -140377,6 +133133,7 @@
  75.190.114.202
  75.191.43.166
  75.2.88.115
+75.24.62.81
  75.250.130.109
  75.3.206.157
  75.31.93.181
@@ -140392,9 +133149,9 @@
  75.51.221.20
  75.51.222.43
  75.51.34.205
+75.51.96.100
  75.53.36.9
  75.55.97.119
-75.56.8.205
  75.57.26.201
  75.65.170.90
  75.65.224.173
@@ -140416,7 +133173,6 @@
  75.75.232.133
  75.75.232.145
  75.75.232.154
-75.75.232.241
  75.75.232.38
  75.75.232.70
  75.75.97.57
@@ -140426,13 +133182,14 @@
  75.80.148.244
  75.80.202.202
  75.81.226.4
+75.82.34.4
  75.82.49.143
  75.83.121.147
+75.83.176.131
  75.83.186.62
  75.83.21.179
  75.83.253.194
  75.83.58.8
-75.84.231.86
  75.85.105.207
  75.85.186.143
  75.85.34.13
@@ -140441,15 +133198,12 @@
  75.86.142.122
  75.97.242.94
  75.97.38.113
-75.97.66.141
  75.98.226.29
  75.98.36.146
  75.99.123.26
  75.99.13.123
  75.99.159.189
  75.99.199.179
-75.99.213.61
-75.99.59.205
  75.99.69.186
  7520.ca
  7521550a119fe3171a82df8e0644d569e796b36b.info
@@ -140492,11 +133246,11 @@
  76.0.6.35
  76.0.65.207
  76.1.173.149
+76.10.157.54
  76.100.17.13
  76.101.140.70
  76.102.103.136
  76.102.119.124
-76.102.223.168
  76.103.215.236
  76.103.7.22
  76.104.80.47
@@ -140510,7 +133264,6 @@
  76.109.160.210
  76.109.54.235
  76.110.118.6
-76.115.168.209
  76.116.143.18
  76.116.201.102
  76.12.191.16
@@ -140532,12 +133285,12 @@
  76.14.182.93
  76.14.185.177
  76.14.186.147
-76.14.186.61
  76.14.190.57
  76.14.31.93
  76.15.23.177
  76.15.31.11
  76.15.97.41
+76.164.153.60
  76.164.193.195
  76.164.193.196
  76.164.197.92
@@ -140545,9 +133298,11 @@
  76.164.202.3
  76.167.150.16
  76.167.150.74
+76.168.51.54
  76.168.54.203
  76.170.11.82
  76.170.32.158
+76.171.66.198
  76.173.137.100
  76.173.179.89
  76.173.238.49
@@ -140562,17 +133317,14 @@
  76.178.199.119
  76.178.73.223
  76.18.1.104
-76.180.64.107
  76.180.99.249
  76.181.44.116
  76.182.177.11
  76.183.211.188
  76.184.0.130
  76.184.115.29
-76.185.104.214
  76.185.28.113
  76.186.123.165
-76.186.131.156
  76.186.73.35
  76.187.167.11
  76.188.24.162
@@ -140629,6 +133381,7 @@
  76.3.40.17
  76.30.103.128
  76.30.129.183
+76.30.169.108
  76.30.62.156
  76.31.151.57
  76.31.159.165
@@ -140640,6 +133393,7 @@
  76.68.234.36
  76.69.29.42
  76.7.128.243
+76.72.169.18
  76.72.254.222
  76.73.249.146
  76.74.170.209
@@ -140667,6 +133421,7 @@
  76.88.107.25
  76.88.117.240
  76.88.138.78
+76.88.189.50
  76.88.48.104
  76.88.51.61
  76.88.59.75
@@ -140675,7 +133430,6 @@
  76.91.214.103
  76.94.147.111
  76.94.242.129
-76.94.242.235
  76.95.47.115
  76.97.93.242
  76.98.136.198
@@ -140705,8 +133459,8 @@
  76wzxjp.com
  77.0.179.43
  77.0.7.65
-77.1.18.61
-77.10.149.213
+77.10.186.32
+77.10.5.170
  77.101.132.253
  77.104.102.230
  77.105.100.105
@@ -140722,11 +133476,9 @@
  77.105.87.97
  77.107.17.52
  77.107.19.61
-77.107.32.219
+77.107.20.162
  77.107.35.147
  77.107.41.175
-77.107.42.45
-77.107.45.88
  77.107.51.33
  77.107.87.51
  77.108.104.50
@@ -140741,14 +133493,14 @@
  77.109.177.12
  77.109.191.140
  77.109.191.149
-77.11.22.217
+77.11.152.11
  77.110.25.253
  77.110.27.226
-77.110.38.213
  77.110.63.57
  77.116.99.216
  77.119.128.158
-77.12.143.236
+77.12.203.60
+77.12.5.75
  77.12.69.249
  77.120.113.64
  77.120.113.69
@@ -140768,6 +133520,7 @@
  77.121.81.204
  77.122.142.190
  77.122.171.25
+77.122.235.96
  77.122.242.24
  77.122.48.74
  77.122.57.126
@@ -140778,14 +133531,14 @@
  77.125.5.174
  77.125.68.31
  77.125.78.61
-77.126.1.178
  77.126.116.247
  77.126.30.80
  77.127.60.239
+77.127.71.241
  77.128.141.124
  77.13.121.27
+77.13.133.237
  77.13.26.49
-77.13.39.100
  77.130.135.14
  77.131.118.34
  77.134.172.81
@@ -140794,7 +133547,7 @@
  77.139.39.37
  77.139.74.184
  77.140.201.98
-77.141.106.155
+77.140.237.201
  77.141.242.25
  77.141.8.209
  77.156.242.132
@@ -140808,11 +133561,9 @@
  77.163.136.136
  77.163.24.180
  77.164.157.171
-77.164.207.90
  77.164.213.131
  77.164.241.157
  77.165.133.73
-77.165.159.142
  77.165.60.53
  77.166.83.167
  77.167.12.43
@@ -140826,52 +133577,58 @@
  77.172.59.122
  77.174.237.229
  77.175.30.187
-77.179.129.13
-77.179.37.108
+77.180.17.43
  77.181.164.65
-77.181.22.197
  77.182.226.127
-77.183.185.19
-77.185.172.34
  77.185.176.43
+77.185.179.195
  77.189.70.79
-77.190.115.51
  77.190.15.86
-77.190.169.30
-77.191.142.111
+77.190.54.132
  77.194.128.136
  77.197.198.214
  77.197.25.130
  77.198.48.5
  77.199.87.64
+77.2.116.34
  77.20.245.213
  77.20.64.160
+77.20.64.169
  77.201.16.106
  77.201.236.237
  77.202.38.49
  77.204.13.78
  77.206.129.119
  77.206.129.192
+77.206.233.180
  77.208.112.212
  77.21.162.135
+77.21.162.172
+77.21.162.91
+77.21.163.166
  77.21.163.182
  77.21.164.5
+77.21.164.93
  77.21.165.213
+77.21.165.236
+77.21.166.230
  77.21.167.12
+77.21.167.125
  77.21.167.138
+77.21.167.236
  77.21.183.71
  77.21.184.57
  77.21.185.229
  77.21.186.160
  77.21.186.55
  77.21.225.123
+77.21.225.24
  77.21.225.31
  77.210.180.10
  77.211.16.26
  77.211.170.149
  77.211.170.214
  77.216.117.168
-77.216.120.3
  77.216.36.147
  77.216.59.210
  77.216.95.155
@@ -140881,7 +133638,6 @@
  77.220.161.250
  77.220.185.190
  77.220.193.12
-77.220.194.158
  77.220.214.225
  77.221.130.11
  77.221.130.15
@@ -140897,6 +133653,7 @@
  77.222.107.110
  77.222.112.127
  77.222.113.64
+77.222.116.135
  77.222.119.222
  77.222.132.189
  77.222.134.242
@@ -140912,16 +133669,15 @@
  77.222.61.212
  77.223.204.190
  77.223.205.15
+77.223.97.94
  77.228.73.18
  77.229.159.32
  77.229.57.33
  77.23.10.143
  77.23.98.117
  77.230.154.155
-77.230.165.35
  77.230.178.181
  77.231.136.127
-77.231.165.16
  77.232.100.184
  77.232.100.253
  77.232.134.222
@@ -140935,6 +133691,7 @@
  77.232.72.113
  77.233.0.245
  77.233.10.37
+77.233.4.133
  77.234.18.194
  77.234.40.136
  77.234.41.22
@@ -140948,7 +133705,6 @@
  77.236.78.158
  77.236.86.28
  77.236.95.218
-77.236.95.245
  77.236.95.89
  77.236.97.247
  77.237.87.207
@@ -140957,7 +133713,6 @@
  77.238.212.227
  77.238.79.111
  77.239.148.134
-77.239.150.226
  77.239.48.142
  77.239.65.206
  77.240.101.94
@@ -140979,6 +133734,7 @@
  77.242.29.25
  77.242.37.212
  77.243.113.220
+77.243.115.162
  77.243.181.54
  77.243.183.120
  77.243.183.80
@@ -140986,7 +133742,6 @@
  77.243.191.19
  77.243.191.20
  77.243.191.21
-77.243.191.43
  77.243.191.44
  77.243.238.149
  77.243.51.53
@@ -141004,7 +133759,6 @@
  77.245.110.212
  77.245.112.48
  77.245.13.198
-77.245.149.38
  77.245.223.197
  77.245.223.57
  77.245.76.93
@@ -141015,9 +133769,10 @@
  77.247.108.77
  77.247.111.98
  77.247.127.150
-77.247.127.202
  77.247.127.22
  77.247.178.130
+77.247.178.140
+77.247.178.141
  77.247.178.182
  77.247.178.245
  77.247.179.44
@@ -141064,9 +133819,7 @@
  77.250.60.51
  77.250.62.76
  77.250.67.102
-77.252.137.211
  77.252.53.58
-77.254.181.180
  77.27.168.117
  77.27.176.109
  77.27.26.85
@@ -141074,9 +133827,8 @@
  77.28.255.80
  77.28.96.196
  77.28.96.206
-77.3.208.13
-77.3.210.90
-77.3.3.172
+77.29.193.162
+77.3.199.84
  77.3.60.62
  77.30.202.167
  77.30.219.75
@@ -141094,15 +133846,16 @@
  77.37.160.36
  77.37.162.17
  77.37.164.74
-77.37.174.71
  77.37.208.119
  77.37.212.122
  77.37.236.10
  77.37.240.23
  77.37.246.150
+77.38.109.124
  77.38.165.204
  77.38.21.239
  77.38.42.145
+77.39.11.78
  77.39.117.115
  77.4.127.98
  77.4.41.44
@@ -141128,23 +133881,22 @@
  77.40.2.250
  77.40.3.101
  77.40.3.139
-77.40.3.20
  77.40.3.8
  77.40.3.81
-77.40.61.172
+77.40.61.49
  77.40.62.132
  77.40.62.179
-77.40.62.204
+77.41.123.213
  77.41.134.93
  77.42.224.176
  77.42.225.169
-77.42.228.42
  77.42.229.79
  77.42.231.20
-77.42.232.99
+77.42.232.4
+77.42.234.183
  77.44.58.58
  77.45.226.8
-77.45.84.133
+77.45.84.141
  77.46.129.2
  77.46.137.17
  77.46.137.21
@@ -141186,20 +133938,23 @@
  77.55.211.249
  77.55.211.77
  77.56.214.160
+77.56.6.24
  77.57.105.152
  77.57.114.22
  77.57.189.22
  77.57.204.34
-77.57.32.92
  77.57.53.115
  77.57.59.199
  77.58.100.111
  77.58.17.83
  77.58.220.34
  77.58.58.11
-77.6.8.235
+77.6.126.50
+77.6.209.48
+77.6.32.106
  77.6.82.183
-77.61.187.18
+77.6.83.219
+77.6.94.167
  77.64.162.103
  77.64.234.44
  77.65.129.162
@@ -141217,10 +133972,7 @@
  77.68.12.217
  77.68.121.174
  77.68.14.241
-77.68.17.131
-77.68.20.140
  77.68.25.145
-77.68.28.173
  77.68.62.77
  77.68.73.152
  77.68.79.44
@@ -141231,17 +133983,15 @@
  77.69.23.183
  77.69.9.110
  77.7.55.162
-77.7.80.236
+77.7.66.50
  77.7.92.201
  77.70.16.245
  77.70.29.86
-77.70.35.87
  77.71.12.32
  77.71.251.9
  77.71.30.84
  77.71.82.6
  77.71.84.249
-77.71.85.18
  77.72.138.108
  77.72.71.66
  77.72.83.192
@@ -141263,7 +134013,6 @@
  77.75.145.94
  77.75.151.138
  77.75.161.167
-77.75.6.34
  77.75.76.160
  77.75.76.161
  77.75.76.162
@@ -141312,6 +134061,7 @@
  77.75.79.62
  77.75.79.95
  77.76.143.97
+77.76.144.78
  77.76.151.206
  77.76.228.4
  77.76.41.205
@@ -141325,12 +134075,10 @@
  77.78.40.9
  77.79.103.219
  77.79.12.9
-77.79.131.244
  77.79.132.10
  77.79.246.80
  77.79.246.81
  77.79.93.3
-77.8.2.52
  77.81.100.88
  77.81.139.35
  77.81.139.36
@@ -141338,6 +134086,7 @@
  77.81.139.38
  77.81.139.39
  77.81.139.42
+77.81.139.44
  77.81.139.46
  77.81.23.74
  77.81.247.72
@@ -141349,19 +134098,17 @@
  77.82.231.81
  77.82.90.234
  77.82.96.186
-77.82.97.87
  77.83.117.240
+77.83.149.91
  77.83.175.161
  77.83.84.94
-77.83.85.120
  77.83.85.152
  77.83.85.158
-77.83.85.161
  77.83.85.196
  77.83.85.206
+77.83.85.24
  77.83.85.244
  77.83.85.27
-77.83.85.47
  77.83.85.62
  77.83.86.120
  77.83.86.151
@@ -141373,9 +134120,9 @@
  77.83.86.27
  77.83.86.64
  77.83.86.77
+77.83.87.114
  77.83.87.128
  77.83.87.140
-77.83.87.19
  77.83.87.50
  77.83.87.63
  77.83.87.65
@@ -141386,6 +134133,7 @@
  77.85.203.98
  77.85.204.149
  77.85.238.130
+77.85.28.130
  77.87.194.117
  77.87.196.119
  77.87.75.12
@@ -141433,8 +134181,6 @@
  77.95.167.41
  77.95.225.77
  77.95.60.155
-77.95.65.167
-77.95.65.168
  77.97.150.249
  77.98.107.167
  77.super-me.online
@@ -141453,7 +134199,6 @@
  7761184-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  777109-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  777589-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-777777777777777certi777777777ficatedpages282014541112020.advanced-enable-certificated-pages-0636346436624655020.my.id
  777global.online
  777hustle777.info
  778002991822.com
@@ -141470,17 +134215,16 @@
  77st.net
  78.1.228.179
  78.1.230.221
-78.1.236.254
  78.1.8.98
  78.100.176.159
  78.101.165.58
+78.101.169.80
  78.101.224.151
  78.101.231.250
  78.102.136.61
  78.102.184.199
  78.106.209.103
  78.106.220.129
-78.107.195.106
  78.107.220.30
  78.108.102.8
  78.108.108.162
@@ -141506,6 +134250,7 @@
  78.110.158.168
  78.110.174.119
  78.110.174.2
+78.110.174.55
  78.110.214.39
  78.110.254.139
  78.110.255.218
@@ -141528,14 +134273,12 @@
  78.111.249.108
  78.111.250.174
  78.111.250.49
-78.111.97.182
  78.111.99.178
  78.112.139.216
  78.112.179.120
  78.113.231.245
  78.115.20.117
  78.116.69.186
-78.117.21.233
  78.118.109.147
  78.118.222.35
  78.118.61.162
@@ -141545,17 +134288,16 @@
  78.122.132.63
  78.125.47.94
  78.128.112.30
-78.128.113.0
  78.128.113.118
  78.128.113.119
  78.128.113.120
  78.128.113.121
+78.128.113.18
  78.128.113.238
  78.128.113.26
  78.128.113.42
  78.128.113.6
  78.128.114.111
-78.128.179.15
  78.128.56.51
  78.128.62.52
  78.128.92.94
@@ -141578,8 +134320,8 @@
  78.132.0.179
  78.132.140.85
  78.132.171.34
+78.132.179.195
  78.132.33.193
-78.132.48.110
  78.133.12.20
  78.133.126.100
  78.133.163.190
@@ -141589,9 +134331,10 @@
  78.133.94.243
  78.134.126.85
  78.134.19.128
+78.134.22.251
  78.134.3.70
  78.134.5.173
-78.134.7.212
+78.134.56.126
  78.134.90.115
  78.134.93.134
  78.135.53.21
@@ -141602,6 +134345,7 @@
  78.138.127.98
  78.138.128.3
  78.138.129.104
+78.138.131.248
  78.138.157.26
  78.138.157.42
  78.138.188.187
@@ -141609,7 +134353,6 @@
  78.139.200.51
  78.139.216.117
  78.139.91.76
-78.14.109.146
  78.14.51.42
  78.14.87.92
  78.140.201.254
@@ -141629,7 +134372,6 @@
  78.142.194.34
  78.142.194.6
  78.142.207.52
-78.142.209.250
  78.142.229.191
  78.142.232.27
  78.142.35.145
@@ -141637,7 +134379,6 @@
  78.142.60.102
  78.143.96.35
  78.146.202.184
-78.146.76.222
  78.148.88.96
  78.151.161.24
  78.152.161.133
@@ -141646,7 +134387,6 @@
  78.153.146.222
  78.153.4.122
  78.153.50.88
-78.154.167.68
  78.154.176.154
  78.154.180.12
  78.154.189.190
@@ -141654,15 +134394,14 @@
  78.155.118.15
  78.155.205.102
  78.156.100.109
+78.156.140.5
  78.156.45.230
  78.156.9.173
  78.157.165.90
-78.157.183.115
  78.157.193.67
  78.157.28.15
  78.157.28.26
  78.157.28.35
-78.157.4.36
  78.157.42.59
  78.157.66.220
  78.157.91.120
@@ -141675,7 +134414,9 @@
  78.158.160.91
  78.158.160.92
  78.158.164.98
+78.158.191.162
  78.159.103.141
+78.159.103.159
  78.159.103.53
  78.159.108.204
  78.159.113.195
@@ -141703,8 +134444,9 @@
  78.167.141.4
  78.167.141.52
  78.167.20.195
+78.167.40.88
  78.168.56.248
-78.17.165.113
+78.168.95.56
  78.171.108.198
  78.171.16.229
  78.171.20.4
@@ -141732,6 +134474,7 @@
  78.176.80.127
  78.179.151.188
  78.18.84.174
+78.180.150.148
  78.180.152.74
  78.180.153.97
  78.180.154.110
@@ -141759,16 +134502,14 @@
  78.186.146.79
  78.186.156.196
  78.186.160.14
-78.186.166.179
  78.186.169.219
-78.186.172.22
  78.186.184.198
+78.186.186.149
  78.186.188.12
  78.186.191.10
  78.186.196.202
  78.186.198.122
  78.186.202.120
-78.186.207.13
  78.186.216.101
  78.186.216.216
  78.186.218.20
@@ -141777,6 +134518,7 @@
  78.186.239.194
  78.186.244.78
  78.186.248.243
+78.186.254.130
  78.186.39.211
  78.186.4.41
  78.186.40.28
@@ -141792,15 +134534,16 @@
  78.187.142.180
  78.187.143.113
  78.187.156.31
-78.187.189.253
  78.187.193.68
  78.187.193.71
+78.187.197.135
  78.187.199.121
  78.187.205.165
  78.187.205.79
  78.187.206.59
  78.187.209.36
  78.187.224.15
+78.187.235.44
  78.187.240.125
  78.187.25.221
  78.187.28.12
@@ -141854,6 +134597,7 @@
  78.189.160.100
  78.189.161.31
  78.189.175.72
+78.189.176.163
  78.189.176.181
  78.189.180.169
  78.189.186.149
@@ -141861,6 +134605,7 @@
  78.189.189.85
  78.189.190.196
  78.189.191.195
+78.189.192.69
  78.189.202.253
  78.189.207.248
  78.189.207.87
@@ -141876,19 +134621,20 @@
  78.189.72.118
  78.189.76.127
  78.189.94.228
-78.190.250.141
  78.191.217.199
  78.191.246.237
+78.192.102.109
  78.192.18.48
+78.193.127.17
  78.193.48.41
  78.193.74.165
  78.194.135.43
  78.194.196.203
+78.195.169.45
  78.195.178.119
  78.195.86.1
  78.196.166.11
  78.196.38.46
-78.196.50.44
  78.198.97.205
  78.199.19.89
  78.20.135.129
@@ -141896,13 +134642,12 @@
  78.202.164.128
  78.202.185.88
  78.203.14.39
-78.204.123.164
  78.204.53.118
  78.205.222.137
  78.206.229.130
  78.207.129.1
  78.207.160.132
-78.21.234.68
+78.208.63.100
  78.210.110.79
  78.210.70.16
  78.213.155.13
@@ -141911,7 +134656,6 @@
  78.217.36.106
  78.218.42.126
  78.219.167.75
-78.22.89.35
  78.220.176.23
  78.221.154.29
  78.221.223.169
@@ -141936,7 +134680,6 @@
  78.244.50.209
  78.246.107.6
  78.247.112.21
-78.247.170.48
  78.249.30.153
  78.25.112.42
  78.25.120.105
@@ -141945,11 +134688,13 @@
  78.25.95.216
  78.251.252.26
  78.26.143.44
+78.26.146.69
  78.26.151.247
  78.26.164.218
  78.26.179.12
  78.26.185.152
  78.27.139.13
+78.27.80.220
  78.29.32.35
  78.29.35.3
  78.29.42.10
@@ -141964,7 +134709,6 @@
  78.30.52.227
  78.31.56.204
  78.31.74.10
-78.31.92.63
  78.34.186.192
  78.35.120.245
  78.35.250.110
@@ -141975,14 +134719,12 @@
  78.36.6.246
  78.36.97.216
  78.37.239.227
-78.37.245.172
  78.37.27.139
  78.37.48.179
  78.37.63.171
  78.37.89.122
  78.38.122.249
  78.38.123.110
-78.38.15.143
  78.38.189.249
  78.38.24.51
  78.38.50.229
@@ -141993,6 +134735,7 @@
  78.38.99.10
  78.39.193.36
  78.39.205.171
+78.40.104.118
  78.40.107.3
  78.40.109.187
  78.40.139.80
@@ -142006,15 +134749,13 @@
  78.41.174.196
  78.41.174.198
  78.41.40.16
-78.43.148.129
-78.43.199.248
  78.44.232.66
  78.46.128.195
  78.46.137.232
  78.46.151.58
-78.46.163.121
  78.46.17.17
  78.46.173.117
+78.46.173.189
  78.46.188.239
  78.46.188.240
  78.46.189.199
@@ -142025,6 +134766,7 @@
  78.46.218.20
  78.46.22.102
  78.46.254.164
+78.46.40.206
  78.46.46.195
  78.46.50.246
  78.46.60.149
@@ -142034,7 +134776,6 @@
  78.46.83.7
  78.46.85.221
  78.46.86.12
-78.46.91.175
  78.46.91.40
  78.46.95.150
  78.46.98.13
@@ -142048,16 +134789,16 @@
  78.47.217.54
  78.47.224.242
  78.47.233.244
-78.47.234.162
  78.47.234.246
  78.47.27.178
  78.47.41.177
-78.47.45.2
  78.47.50.83
  78.47.61.83
  78.47.87.196
  78.48.162.105
  78.54.81.114
+78.55.106.91
+78.55.155.63
  78.56.201.4
  78.56.35.205
  78.57.227.227
@@ -142075,6 +134816,7 @@
  78.66.209.110
  78.66.209.22
  78.66.211.179
+78.66.213.196
  78.67.213.148
  78.67.99.227
  78.68.121.105
@@ -142085,8 +134827,8 @@
  78.71.2.168
  78.71.212.230
  78.71.234.246
-78.72.125.24
  78.72.17.227
+78.72.191.204
  78.72.222.170
  78.72.233.238
  78.73.54.32
@@ -142100,7 +134842,6 @@
  78.8.111.87
  78.8.120.10
  78.8.126.198
-78.8.161.130
  78.8.188.1
  78.8.188.100
  78.8.188.136
@@ -142115,10 +134856,9 @@
  78.8.189.88
  78.80.179.178
  78.80.2.186
-78.81.137.1
+78.80.235.217
  78.81.245.153
  78.82.164.29
-78.82.203.247
  78.82.237.9
  78.83.103.4
  78.83.129.61
@@ -142133,15 +134873,13 @@
  78.84.16.236
  78.84.169.212
  78.84.22.156
-78.84.70.245
-78.85.154.31
-78.85.163.189
  78.85.17.176
  78.85.17.6
  78.85.172.10
-78.85.20.134
+78.85.201.81
  78.85.36.199
  78.85.36.59
+78.85.49.117
  78.85.49.28
  78.88.229.104
  78.89.186.250
@@ -142162,26 +134900,22 @@
  78.90.78.210
  78.90.81.184
  78.90.91.220
+78.92.19.230
  78.92.2.177
  78.92.254.169
  78.92.254.9
  78.94.180.85
-78.94.217.140
  78.94.255.174
  78.94.31.171
  78.94.74.70
  78.94.92.13
-78.95.4.45
-78.96.125.24
  78.96.129.15
  78.96.142.24
  78.96.17.76
  78.96.170.177
  78.96.32.107
-78.96.65.186
  78.97.123.232
  78.97.125.50
-78.97.206.149
  78.98.175.251
  78.99.164.136
  7803000.com
@@ -142212,7 +134946,6 @@
  79.0.155.183
  79.0.214.80
  79.1.154.24
-79.1.194.79
  79.10.148.140
  79.10.172.170
  79.10.172.251
@@ -142220,7 +134953,6 @@
  79.10.62.118
  79.10.74.233
  79.10.82.174
-79.100.162.206
  79.100.49.51
  79.100.49.79
  79.101.1.25
@@ -142229,7 +134961,6 @@
  79.101.45.94
  79.101.55.161
  79.101.55.162
-79.101.98.2
  79.102.128.245
  79.102.129.165
  79.103.253.74
@@ -142246,7 +134977,6 @@
  79.106.165.30
  79.106.166.154
  79.106.170.60
-79.106.209.143
  79.106.224.231
  79.106.224.238
  79.106.228.44
@@ -142274,27 +135004,24 @@
  79.107.189.247
  79.107.235.192
  79.107.88.1
-79.108.198.163
  79.108.206.93
  79.108.207.194
+79.108.253.218
  79.11.13.20
  79.11.192.131
  79.11.222.106
  79.11.243.44
  79.110.112.210
-79.110.17.101
-79.110.17.144
  79.110.17.183
+79.110.17.32
  79.110.17.76
-79.110.17.83
  79.110.201.117
  79.110.31.18
  79.110.31.48
  79.111.12.111
  79.111.13.155
  79.111.13.182
-79.111.28.152
-79.111.62.227
+79.111.53.199
  79.112.228.199
  79.113.191.249
  79.113.203.187
@@ -142303,10 +135030,10 @@
  79.114.149.116
  79.114.75.198
  79.114.89.221
-79.115.142.181
  79.115.172.4
  79.115.246.20
  79.115.49.9
+79.115.95.4
  79.116.28.250
  79.117.176.217
  79.117.184.182
@@ -142321,9 +135048,9 @@
  79.118.74.230
  79.118.74.90
  79.12.121.217
-79.12.145.161
  79.12.210.119
  79.12.230.94
+79.12.91.176
  79.120.118.82
  79.120.177.106
  79.120.193.211
@@ -142337,7 +135064,6 @@
  79.124.27.59
  79.124.3.100
  79.124.49.227
-79.124.49.228
  79.124.60.174
  79.124.60.85
  79.124.62.10
@@ -142364,7 +135090,6 @@
  79.125.160.18
  79.125.183.146
  79.125.4.162
-79.126.121.118
  79.126.23.130
  79.127.105.141
  79.127.113.235
@@ -142384,10 +135109,9 @@
  79.13.135.49
  79.13.156.48
  79.13.78.64
+79.130.10.15
  79.130.102.195
  79.130.178.207
-79.130.211.44
-79.130.249.8
  79.130.63.14
  79.131.173.224
  79.131.52.39
@@ -142432,6 +135156,7 @@
  79.136.83.75
  79.137.109.83
  79.137.112.61
+79.137.113.100
  79.137.115.56
  79.137.116.226
  79.137.126.100
@@ -142442,7 +135167,6 @@
  79.137.20.253
  79.137.222.49
  79.137.24.250
-79.137.254.51
  79.137.28.159
  79.137.33.20
  79.137.34.248
@@ -142474,14 +135198,16 @@
  79.138.94.148
  79.139.56.120
  79.14.154.4
+79.140.150.201
  79.140.167.238
  79.140.228.108
  79.140.30.20
  79.140.30.237
  79.141.161.20
  79.141.163.78
+79.141.66.61
  79.142.129.218
-79.142.133.88
+79.142.137.16
  79.142.207.102
  79.142.55.206
  79.142.65.64
@@ -142505,6 +135231,7 @@
  79.143.87.227
  79.143.87.240
  79.143.87.241
+79.145.225.45
  79.146.121.90
  79.146.21.163
  79.146.37.108
@@ -142516,11 +135243,11 @@
  79.150.168.125
  79.150.204.56
  79.150.214.31
-79.153.212.95
  79.153.213.31
  79.154.122.214
  79.154.14.4
  79.154.50.142
+79.154.8.217
  79.155.135.44
  79.156.226.17
  79.156.254.117
@@ -142535,7 +135262,6 @@
  79.164.176.68
  79.164.238.134
  79.164.24.50
-79.164.241.6
  79.164.59.221
  79.165.225.234
  79.165.250.129
@@ -142547,7 +135273,6 @@
  79.169.184.113
  79.17.217.113
  79.17.227.196
-79.17.39.174
  79.170.185.187
  79.171.13.166
  79.171.13.182
@@ -142556,14 +135281,15 @@
  79.172.193.32
  79.172.201.60
  79.172.60.178
+79.173.193.238
  79.173.194.9
  79.173.203.253
  79.173.204.144
  79.173.210.231
  79.173.211.41
  79.173.212.181
-79.173.88.244
  79.173.90.153
+79.174.13.5
  79.174.24.137
  79.174.24.172
  79.174.70.46
@@ -142577,6 +135303,7 @@
  79.177.4.62
  79.177.60.133
  79.178.17.62
+79.178.191.171
  79.178.211.152
  79.179.55.169
  79.179.80.57
@@ -142585,7 +135312,6 @@
  79.18.148.197
  79.18.72.152
  79.180.21.202
-79.180.51.198
  79.181.20.138
  79.181.69.198
  79.181.82.231
@@ -142594,7 +135320,7 @@
  79.183.91.113
  79.184.174.202
  79.184.5.85
-79.186.103.76
+79.185.114.239
  79.186.159.195
  79.186.74.123
  79.186.77.158
@@ -142611,32 +135337,28 @@
  79.19.58.245
  79.190.144.158
  79.190.213.51
-79.190.217.149
-79.191.242.97
  79.193.117.36
-79.194.171.121
+79.194.172.226
  79.194.175.217
-79.195.20.74
  79.2.137.18
  79.2.142.166
  79.20.247.221
-79.207.19.246
+79.201.175.155
  79.207.19.248
-79.208.178.71
+79.207.2.77
  79.208.186.109
-79.208.229.172
-79.208.230.171
-79.209.69.141
+79.209.64.185
  79.209.71.208
  79.209.79.121
  79.21.224.141
  79.21.251.58
  79.21.45.9
-79.210.169.17
+79.210.172.205
  79.211.231.50
-79.211.64.238
  79.213.70.17
+79.214.55.110
  79.217.17.124
+79.217.21.51
  79.218.112.29
  79.218.117.76
  79.219.231.241
@@ -142644,24 +135366,24 @@
  79.219.236.195
  79.22.55.251
  79.22.60.156
-79.22.84.250
  79.224.56.206
  79.23.74.251
  79.232.162.209
  79.232.172.18
  79.235.157.75
  79.235.175.228
+79.235.246.229
  79.236.190.42
-79.236.190.74
  79.238.23.226
  79.24.112.100
-79.24.149.100
  79.24.209.121
+79.242.174.69
  79.244.122.142
  79.244.53.1
  79.25.112.10
  79.25.45.231
  79.25.95.13
+79.253.164.159
  79.253.207.184
  79.26.116.164
  79.26.3.187
@@ -142676,15 +135398,15 @@
  79.31.193.54
  79.31.224.198
  79.31.255.74
+79.31.6.201
  79.32.158.232
  79.32.67.61
  79.32.80.147
  79.33.104.100
  79.33.179.164
-79.33.92.246
+79.33.33.111
  79.34.195.169
  79.35.145.68
-79.35.148.110
  79.36.1.209
  79.36.91.246
  79.36.98.159
@@ -142704,8 +135426,6 @@
  79.44.9.173
  79.45.180.100
  79.45.48.17
-79.46.176.109
-79.46.208.41
  79.46.233.10
  79.46.32.118
  79.46.96.48
@@ -142720,7 +135440,7 @@
  79.53.98.253
  79.54.115.243
  79.54.231.112
-79.55.228.114
+79.55.158.98
  79.55.6.99
  79.58.55.43
  79.58.56.35
@@ -142740,6 +135460,7 @@
  79.7.114.1
  79.7.157.91
  79.7.158.208
+79.7.177.70
  79.7.182.180
  79.7.209.246
  79.7.218.151
@@ -142751,10 +135472,8 @@
  79.77.33.130
  79.77.48.143
  79.78.46.116
-79.8.112.131
  79.8.155.177
  79.8.178.21
-79.8.189.10
  79.8.192.152
  79.8.32.58
  79.8.82.125
@@ -142768,7 +135487,9 @@
  79.9.102.118
  79.9.118.213
  79.9.135.207
+79.9.157.65
  79.9.171.88
+79.9.21.146
  79.96.175.83
  79.96.218.84
  79.96.33.43
@@ -142776,6 +135497,8 @@
  79.98.1.32
  79.98.107.90
  79.98.159.7
+79.98.223.11
+79.98.223.25
  79.98.23.9
  79.98.30.37
  79.98.31.253
@@ -142802,6 +135525,7 @@
  79k52baw2qa3.com
  7a5a8ee372ebd9cdb3d2bcf5c0d2828490221c5a.info
  7a81.ru
+7a83r-h2i1mv.com
  7a88ab607987c55056bea813a0b6d42d.udagwebspace.de
  7ab3c860fd2789fdda8cd.info
  7ac0e733-6c9b-4230-8a15-98adda36ff8b.server1.deepsound.live
@@ -142899,7 +135623,9 @@
  8.12.16.78
  8.12.161.82
  8.12.22.118
+8.129.172.40
  8.129.191.245
+8.129.38.164
  8.129.46.157
  8.129.47.187
  8.134.18.217
@@ -142912,10 +135638,8 @@
  8.208.20.90
  8.208.24.115
  8.208.76.238
-8.208.76.28
  8.208.88.207
  8.208.90.81
-8.209.119.241
  8.209.215.172
  8.209.71.217
  8.209.72.208
@@ -142965,6 +135689,7 @@
  8.38.89.146
  8.38.89.152
  8.4.9.137
+8.40.140.85
  8.40.183.187
  8.42.229.3
  8.81.199.35.bc.googleusercontent.com
@@ -142975,7 +135700,6 @@
  8.9.8.68
  8.dojnh.com
  80-87-45.ga
-80.0.141.86
  80.10.11.137
  80.10.8.64
  80.100.128.128
@@ -142983,7 +135707,9 @@
  80.100.93.182
  80.101.146.172
  80.101.82.203
+80.101.91.75
  80.102.113.163
+80.102.157.101
  80.102.22.14
  80.102.50.2
  80.103.116.164
@@ -143002,13 +135728,12 @@
  80.108.14.34
  80.108.210.64
  80.108.82.95
-80.108.95.9
  80.109.153.122
  80.109.220.251
  80.109.75.19
  80.11.109.149
-80.11.113.217
  80.11.29.177
+80.110.103.239
  80.110.188.114
  80.111.142.213
  80.111.167.93
@@ -143032,16 +135757,15 @@
  80.127.116.96
  80.13.252.251
  80.13.87.178
-80.131.75.245
+80.132.124.111
  80.132.124.69
-80.132.125.123
  80.134.153.146
+80.135.114.151
  80.135.246.39
  80.136.55.29
  80.137.175.16
  80.14.172.55
  80.14.187.157
-80.14.77.216
  80.14.89.146
  80.14.97.65
  80.143.58.226
@@ -143050,6 +135774,7 @@
  80.147.37.219
  80.149.158.186
  80.15.100.37
+80.15.123.172
  80.15.14.46
  80.15.19.171
  80.15.195.37
@@ -143070,6 +135795,7 @@
  80.169.112.191
  80.169.143.166
  80.169.225.123
+80.17.145.82
  80.17.241.246
  80.172.255.60
  80.174.107.37
@@ -143078,7 +135804,6 @@
  80.174.80.218
  80.175.219.102
  80.178.110.82
-80.178.73.61
  80.179.149.111
  80.179.157.4
  80.179.42.40
@@ -143092,7 +135817,6 @@
  80.182.149.45
  80.182.156.196
  80.182.249.219
-80.182.88.198
  80.183.67.6
  80.183.80.215
  80.184.108.152
@@ -143100,13 +135824,13 @@
  80.184.26.109
  80.184.3.203
  80.184.57.91
-80.187.64.240
  80.188.183.58
  80.188.204.250
-80.188.225.248
  80.188.239.106
  80.189.197.11
  80.19.177.242
+80.190.133.181
+80.190.133.182
  80.190.188.74
  80.191.140.58
  80.191.169.66
@@ -143123,9 +135847,9 @@
  80.192.224.74
  80.194.62.218
  80.197.125.83
+80.2.201.66
  80.2.208.221
  80.20.133.206
-80.20.79.130
  80.200.58.215
  80.201.147.91
  80.201.85.82
@@ -143133,21 +135857,18 @@
  80.209.229.151
  80.209.230.160
  80.209.231.126
-80.209.242.26
  80.21.126.234
-80.21.190.42
  80.21.251.28
  80.210.152.123
  80.210.18.193
  80.210.18.218
  80.210.18.85
-80.210.22.129
  80.210.26.203
+80.210.32.251
  80.210.33.250
  80.210.37.34
  80.210.59.2
  80.211.102.87
-80.211.104.172
  80.211.11.250
  80.211.113.17
  80.211.116.102
@@ -143159,7 +135880,6 @@
  80.211.134.89
  80.211.137.127
  80.211.138.17
-80.211.139.155
  80.211.139.7
  80.211.148.133
  80.211.150.214
@@ -143191,7 +135911,6 @@
  80.211.238.210
  80.211.239.49
  80.211.239.70
-80.211.240.147
  80.211.240.161
  80.211.241.29
  80.211.242.10
@@ -143231,12 +135950,13 @@
  80.212.63.139
  80.213.12.220
  80.213.212.137
+80.213.93.79
  80.215.155.8
  80.216.146.248
-80.216.146.64
  80.216.55.15
  80.216.75.119
  80.217.110.221
+80.217.160.243
  80.217.9.74
  80.218.56.244
  80.219.113.82
@@ -143268,7 +135988,7 @@
  80.234.33.156
  80.235.214.123
  80.235.221.42
-80.235.230.218
+80.235.41.27
  80.235.87.104
  80.237.159.104
  80.237.194.90
@@ -143295,7 +136015,6 @@
  80.241.212.139
  80.241.212.78
  80.241.215.232
-80.241.216.100
  80.241.217.150
  80.241.217.54
  80.241.219.59
@@ -143336,25 +136055,26 @@
  80.248.233.10
  80.249.1.140
  80.249.147.244
-80.249.148.82
  80.249.176.206
  80.25.41.189
  80.25.87.49
  80.250.14.236
  80.250.55.32
  80.251.196.216
+80.251.211.191
+80.251.213.242
+80.251.216.186
  80.251.216.20
+80.251.221.21
  80.251.50.20
  80.252.107.200
  80.252.133.26
  80.252.135.121
  80.253.135.66
  80.253.147.238
-80.253.187.34
  80.253.20.94
  80.253.22.126
  80.253.244.42
-80.253.245.36
  80.253.246.116
  80.253.246.222
  80.253.92.137
@@ -143374,6 +136094,7 @@
  80.255.3.82
  80.255.3.86
  80.255.3.87
+80.26.152.209
  80.26.176.21
  80.28.102.26
  80.28.255.69
@@ -143391,25 +136112,25 @@
  80.38.139.178
  80.4.23.192
  80.41.0.23
+80.44.201.158
  80.44.90.212
+80.47.117.154
  80.48.183.166
  80.48.211.70
  80.48.255.145
  80.48.255.154
  80.48.68.150
  80.48.99.204
+80.49.207.229
  80.49.220.97
  80.5.132.247
  80.5.140.25
-80.50.132.134
  80.50.141.118
  80.51.66.103
  80.52.222.238
  80.53.131.233
  80.53.158.194
-80.53.244.214
  80.53.57.146
-80.54.110.90
  80.55.101.146
  80.55.175.172
  80.55.27.114
@@ -143419,16 +136140,13 @@
  80.60.135.139
  80.63.106.83
  80.63.106.90
-80.63.33.14
  80.64.172.68
-80.64.27.85
  80.65.197.234
  80.65.23.139
  80.65.26.229
  80.65.28.57
  80.65.92.18
  80.66.146.84
-80.66.84.206
  80.66.85.182
  80.67.172.162
  80.67.223.41
@@ -143436,7 +136154,6 @@
  80.67.28.145
  80.67.28.6
  80.67.30.137
-80.68.105.118
  80.68.116.7
  80.68.122.214
  80.68.2.100
@@ -143480,6 +136197,7 @@
  80.70.22.88
  80.70.22.95
  80.71.112.100
+80.71.112.101
  80.71.112.105
  80.71.112.107
  80.71.112.108
@@ -143517,8 +136235,6 @@
  80.79.114.34
  80.79.116.131
  80.79.116.132
-80.79.116.136
-80.79.116.138
  80.79.116.139
  80.79.116.140
  80.79.158.29
@@ -143529,6 +136245,7 @@
  80.80.163.182
  80.80.164.164
  80.80.167.18
+80.80.167.22
  80.80.167.241
  80.80.167.246
  80.80.167.249
@@ -143556,6 +136273,7 @@
  80.82.64.208
  80.82.64.21
  80.82.64.212
+80.82.64.213
  80.82.64.215
  80.82.64.219
  80.82.64.242
@@ -143573,7 +136291,6 @@
  80.82.65.82
  80.82.65.90
  80.82.66.176
-80.82.67.45
  80.82.68.123
  80.82.68.130
  80.82.68.134
@@ -143586,7 +136303,6 @@
  80.82.70.112
  80.82.70.118
  80.82.70.140
-80.82.70.168
  80.82.70.178
  80.82.70.189
  80.82.70.206
@@ -143622,7 +136338,6 @@
  80.82.78.85
  80.82.78.87
  80.82.78.9
-80.82.79.15
  80.83.165.217
  80.83.26.228
  80.83.90.42
@@ -143652,8 +136367,7 @@
  80.89.137.54
  80.89.156.216
  80.89.203.172
-80.90.131.176
-80.90.131.179
+80.89.239.94
  80.90.228.170
  80.90.82.70
  80.90.83.163
@@ -143675,8 +136389,6 @@
  80.93.48.49
  80.94.118.192
  80.94.22.165
-80.94.247.13
-80.94.252.21
  80.94.93.10
  80.94.93.13
  80.94.93.16
@@ -143696,9 +136408,11 @@
  80.94.93.39
  80.94.93.41
  80.94.93.42
+80.94.93.48
  80.94.93.6
  80.94.93.7
  80.94.93.8
+80.94.93.9
  80.95.109.6
  80.95.94.240
  80.96.150.171
@@ -143749,13 +136463,12 @@
  81.100.212.101
  81.100.51.193
  81.100.66.241
-81.101.188.200
  81.102.155.91
-81.104.104.196
  81.105.178.194
  81.105.223.91
  81.107.36.31
  81.11.142.176
+81.11.244.249
  81.110.170.57
  81.111.112.45
  81.111.145.16
@@ -143763,19 +136476,19 @@
  81.111.169.50
  81.111.91.234
  81.117.225.245
-81.12.119.166
+81.12.116.10
  81.12.119.169
+81.12.124.11
  81.12.124.158
  81.12.124.214
  81.12.124.30
-81.12.124.71
  81.12.13.152
  81.12.169.126
  81.12.169.254
  81.12.224.61
+81.12.28.203
  81.12.52.130
  81.12.72.102
-81.12.90.108
  81.12.93.144
  81.12.94.122
  81.129.239.169
@@ -143791,10 +136504,10 @@
  81.133.24.24
  81.134.179.184
  81.134.82.82
+81.136.206.92
  81.137.213.157
  81.137.6.81
  81.138.20.196
-81.140.102.191
  81.141.131.2
  81.143.192.104
  81.143.204.149
@@ -143809,7 +136522,9 @@
  81.149.117.127
  81.149.38.69
  81.15.239.53
+81.150.42.240
  81.150.74.162
+81.151.1.138
  81.151.103.222
  81.151.114.101
  81.152.170.26
@@ -143823,7 +136538,7 @@
  81.16.122.128
  81.16.123.123
  81.16.124.74
-81.16.222.11
+81.16.245.179
  81.16.250.105
  81.16.33.31
  81.16.33.33
@@ -143832,7 +136547,6 @@
  81.16.9.222
  81.161.226.4
  81.161.61.110
-81.161.61.22
  81.161.61.88
  81.161.63.100
  81.161.63.101
@@ -143841,7 +136555,8 @@
  81.161.63.251
  81.161.63.252
  81.161.63.253
-81.161.67.137
+81.161.65.80
+81.161.67.165
  81.162.231.6
  81.162.237.120
  81.162.243.249
@@ -143853,6 +136568,7 @@
  81.163.6.245
  81.163.62.221
  81.164.47.161
+81.164.89.239
  81.165.180.252
  81.165.210.66
  81.165.44.109
@@ -143875,7 +136591,6 @@
  81.169.174.142
  81.169.179.225
  81.169.179.77
-81.169.210.15
  81.169.217.70
  81.169.226.11
  81.169.251.124
@@ -143918,7 +136633,6 @@
  81.170.243.170
  81.170.252.231
  81.170.253.202
-81.170.62.184
  81.170.81.165
  81.171.12.44
  81.171.22.143
@@ -143950,7 +136664,6 @@
  81.177.126.59
  81.177.126.74
  81.177.126.99
-81.177.127.110
  81.177.127.125
  81.177.127.131
  81.177.127.133
@@ -143958,7 +136671,6 @@
  81.177.127.163
  81.177.127.182
  81.177.127.187
-81.177.127.211
  81.177.127.244
  81.177.127.31
  81.177.127.49
@@ -143983,7 +136695,6 @@
  81.180.68.232
  81.182.187.3
  81.182.217.13
-81.182.218.216
  81.182.240.98
  81.182.246.50
  81.182.248.193
@@ -144001,6 +136712,8 @@
  81.183.222.181
  81.183.224.244
  81.183.253.34
+81.183.90.185
+81.183.96.53
  81.183.97.198
  81.184.215.161
  81.186.148.72
@@ -144037,6 +136750,7 @@
  81.198.147.21
  81.198.154.43
  81.198.27.236
+81.198.65.14
  81.198.79.162
  81.198.79.164
  81.198.79.168
@@ -144056,6 +136770,7 @@
  81.201.125.167
  81.201.50.131
  81.202.67.69
+81.205.107.8
  81.206.43.83
  81.208.34.38
  81.208.39.28
@@ -144075,6 +136790,7 @@
  81.213.109.188
  81.213.110.173
  81.213.111.13
+81.213.147.224
  81.213.151.161
  81.213.166.175
  81.213.183.246
@@ -144102,10 +136818,11 @@
  81.215.195.83
  81.215.198.238
  81.215.199.141
+81.215.199.29
  81.215.200.142
-81.215.200.22
  81.215.204.75
  81.215.230.173
+81.217.85.29
  81.218.110.46
  81.218.139.106
  81.218.148.98
@@ -144124,10 +136841,10 @@
  81.219.174.10
  81.219.174.76
  81.219.189.162
-81.219.67.44
  81.22.176.154
  81.22.46.253
  81.22.47.189
+81.22.47.208
  81.22.47.49
  81.22.51.231
  81.22.57.143
@@ -144136,7 +136853,6 @@
  81.224.111.93
  81.224.237.221
  81.224.44.164
-81.225.152.203
  81.225.160.128
  81.225.160.19
  81.225.208.186
@@ -144145,7 +136861,6 @@
  81.226.160.5
  81.226.169.192
  81.226.191.14
-81.227.106.73
  81.227.115.222
  81.227.171.215
  81.227.24.133
@@ -144155,8 +136870,7 @@
  81.23.32.47
  81.23.35.77
  81.230.136.6
-81.230.217.48
-81.231.128.105
+81.231.50.55
  81.232.140.246
  81.232.78.75
  81.233.184.27
@@ -144186,7 +136900,7 @@
  81.246.179.127
  81.246.203.57
  81.246.225.203
-81.247.173.162
+81.246.233.248
  81.248.1.143
  81.248.2.164
  81.248.238.182
@@ -144219,6 +136933,7 @@
  81.3.154.204
  81.3.154.235
  81.3.179.83
+81.3.186.208
  81.3.206.168
  81.30.158.81
  81.30.164.221
@@ -144242,11 +136957,13 @@
  81.34.122.18
  81.34.18.81
  81.34.219.211
+81.35.160.55
  81.35.67.42
  81.36.111.181
  81.36.14.52
  81.36.43.38
  81.38.9.42
+81.39.217.19
  81.39.48.224
  81.4.102.200
  81.4.102.69
@@ -144316,9 +137033,7 @@
  81.68.128.198
  81.68.128.244
  81.68.129.2
-81.68.131.116
  81.68.132.177
-81.68.133.128
  81.68.133.86
  81.68.135.238
  81.68.137.163
@@ -144329,7 +137044,6 @@
  81.68.145.65
  81.68.147.247
  81.68.147.53
-81.68.149.178
  81.68.150.7
  81.68.156.122
  81.68.157.127
@@ -144349,18 +137063,14 @@
  81.68.181.60
  81.68.183.164
  81.68.186.207
-81.68.188.41
  81.68.191.188
  81.68.194.173
  81.68.194.214
  81.68.196.234
  81.68.196.248
-81.68.197.106
  81.68.197.142
  81.68.198.31
  81.68.199.196
-81.68.199.198
-81.68.199.201
  81.68.199.45
  81.68.200.73
  81.68.202.212
@@ -144392,6 +137102,7 @@
  81.68.240.109
  81.68.241.224
  81.68.243.185
+81.68.243.205
  81.68.244.151
  81.68.244.183
  81.68.244.249
@@ -144400,6 +137111,7 @@
  81.68.246.68
  81.68.247.119
  81.68.247.127
+81.68.248.67
  81.68.248.78
  81.68.249.112
  81.68.251.104
@@ -144417,10 +137129,8 @@
  81.68.74.171
  81.68.75.34
  81.68.77.53
-81.68.78.210
  81.68.78.230
  81.68.78.48
-81.68.79.130
  81.68.79.217
  81.68.79.223
  81.68.79.84
@@ -144453,7 +137163,8 @@
  81.69.18.110
  81.69.18.144
  81.69.185.250
-81.69.19.167
+81.69.19.79
+81.69.190.192
  81.69.197.13
  81.69.198.109
  81.69.199.172
@@ -144469,10 +137180,12 @@
  81.69.230.2
  81.69.230.31
  81.69.232.30
+81.69.233.135
  81.69.233.230
  81.69.233.249
  81.69.240.182
  81.69.242.114
+81.69.242.169
  81.69.242.220
  81.69.243.134
  81.69.243.46
@@ -144484,7 +137197,6 @@
  81.69.247.188
  81.69.249.196
  81.69.249.56
-81.69.250.101
  81.69.250.167
  81.69.250.222
  81.69.253.43
@@ -144501,23 +137213,25 @@
  81.69.38.149
  81.69.40.239
  81.69.41.235
+81.69.59.111
  81.69.6.25
  81.69.9.125
  81.69.9.42
  81.69.9.71
  81.7.10.238
+81.7.10.251
  81.7.16.182
  81.7.17.202
  81.70.10.77
  81.70.101.180
  81.70.102.91
-81.70.103.201
  81.70.103.73
  81.70.104.253
  81.70.104.75
  81.70.11.106
  81.70.13.198
  81.70.143.60
+81.70.154.128
  81.70.155.18
  81.70.158.191
  81.70.158.228
@@ -144531,7 +137245,6 @@
  81.70.22.3
  81.70.23.138
  81.70.27.79
-81.70.34.143
  81.70.36.8
  81.70.37.55
  81.70.39.239
@@ -144563,10 +137276,12 @@
  81.71.128.203
  81.71.13.96
  81.71.132.67
+81.71.135.79
  81.71.136.41
  81.71.138.119
  81.71.138.3
  81.71.141.201
+81.71.142.89
  81.71.147.156
  81.71.147.245
  81.71.147.40
@@ -144575,18 +137290,15 @@
  81.71.24.200
  81.71.25.135
  81.71.26.161
-81.71.28.92
  81.71.3.99
-81.71.31.89
  81.71.32.176
  81.71.36.176
  81.71.36.35
  81.71.4.235
  81.71.65.217
-81.71.66.194
  81.71.68.119
  81.71.68.204
-81.71.7.68
+81.71.68.248
  81.71.70.182
  81.71.70.46
  81.71.71.53
@@ -144615,6 +137327,7 @@
  81.86.25.161
  81.88.198.162
  81.88.221.190
+81.88.222.222
  81.88.233.206
  81.88.49.11
  81.88.49.13
@@ -144640,7 +137353,6 @@
  81.91.137.45
  81.91.154.195
  81.91.157.134
-81.91.176.211
  81.91.208.8
  81.91.219.12
  81.91.219.98
@@ -144648,6 +137360,7 @@
  81.92.207.106
  81.92.207.82
  81.92.207.99
+81.92.254.56
  81.92.58.217
  81.93.218.200
  81.93.240.199
@@ -144656,6 +137369,7 @@
  81.94.255.12
  81.94.68.146
  81.94.91.3
+81.95.1.104
  81.95.114.105
  81.95.124.6
  81.95.13.42
@@ -144670,7 +137384,6 @@
  81.95.5.146
  81.95.7.22
  81.95.7.28
-81.96.23.135
  81.99.178.170
  810-365.com
  810365365.com
@@ -144706,6 +137419,7 @@
  82.100.63.181
  82.102.10.148
  82.102.100.94
+82.102.115.131
  82.102.118.46
  82.102.121.77
  82.102.123.1
@@ -144732,8 +137446,6 @@
  82.112.163.243
  82.112.166.170
  82.112.189.167
-82.112.191.139
-82.112.28.123
  82.112.62.181
  82.113.63.230
  82.114.181.163
@@ -144747,9 +137459,6 @@
  82.114.90.90
  82.114.94.68
  82.114.94.69
-82.115.213.147
-82.115.213.205
-82.115.213.41
  82.115.215.101
  82.115.215.156
  82.115.215.180
@@ -144761,7 +137470,6 @@
  82.117.196.30
  82.117.211.14
  82.117.215.14
-82.117.226.12
  82.117.234.133
  82.117.234.36
  82.117.244.85
@@ -144778,19 +137486,24 @@
  82.118.242.76
  82.118.249.2
  82.119.71.21
+82.123.104.9
  82.124.114.58
  82.124.12.112
  82.124.137.199
  82.124.19.33
  82.127.160.25
+82.127.232.222
  82.127.237.205
+82.127.67.202
  82.127.92.201
  82.128.141.82
  82.128.141.82bin.sh
  82.128.247.149
  82.129.186.65
  82.129.8.4
+82.13.73.44
  82.130.201.15
+82.131.245.96
  82.133.19.74
  82.135.136.132
  82.135.148.201
@@ -144849,24 +137562,26 @@
  82.148.179.37
  82.148.25.100
  82.148.25.99
+82.148.28.20
  82.149.13.45
  82.150.140.40
  82.151.113.56
  82.151.114.197
+82.151.167.165
  82.151.199.95
  82.151.220.89
  82.154.199.134
  82.154.209.76
  82.155.28.72
  82.155.53.112
-82.158.219.109
-82.158.34.200
  82.159.109.89
  82.159.200.114
+82.159.47.162
  82.16.128.254
  82.16.75.250
  82.160.140.77
  82.160.151.123
+82.160.173.84
  82.160.215.7
  82.161.200.117
  82.161.228.66
@@ -144877,6 +137592,7 @@
  82.164.21.7
  82.164.50.175
  82.165.100.150
+82.165.114.135
  82.165.124.25
  82.165.126.97
  82.165.135.211
@@ -144891,7 +137607,6 @@
  82.165.198.170
  82.165.207.220
  82.165.23.226
-82.165.242.9
  82.165.37.162
  82.165.61.178
  82.165.72.192
@@ -144901,19 +137616,20 @@
  82.166.152.154
  82.166.239.179
  82.166.30.20
-82.166.30.33
  82.166.62.243
  82.166.83.27
+82.166.86.104
  82.169.227.38
-82.169.239.184
  82.176.164.40
+82.177.126.165
  82.177.176.1
  82.177.176.24
+82.177.176.34
  82.177.87.98
  82.181.91.236
  82.183.2.151
-82.185.180.134
  82.186.120.234
+82.186.233.89
  82.186.251.25
  82.189.223.116
  82.192.235.212
@@ -144921,6 +137637,7 @@
  82.192.88.11
  82.193.103.110
  82.193.110.177
+82.193.115.159
  82.193.15.3
  82.193.150.21
  82.194.17.45
@@ -144929,6 +137646,7 @@
  82.194.66.135
  82.194.85.198
  82.194.86.23
+82.196.0.108
  82.196.0.198
  82.196.1.53
  82.196.11.13
@@ -144943,6 +137661,7 @@
  82.196.113.78
  82.196.115.225
  82.196.12.70
+82.196.13.176
  82.196.14.163
  82.196.14.6
  82.196.15.195
@@ -144956,16 +137675,18 @@
  82.196.5.251
  82.196.6.248
  82.196.9.161
-82.197.194.21
-82.197.195.20
  82.197.203.78
  82.197.204.14
  82.197.207.140
  82.197.215.125
  82.197.231.216
  82.199.102.10
+82.199.41.122
+82.199.47.227
  82.199.54.249
+82.199.94.105
  82.20.11.17
+82.20.251.200
  82.200.105.254
  82.200.142.22
  82.200.160.178
@@ -144990,12 +137711,15 @@
  82.202.167.56
  82.202.197.224
  82.202.197.233
+82.202.247.228
  82.202.68.231
  82.202.99.217
  82.204.141.94
  82.206.222.21
  82.207.126.147
  82.207.195.24
+82.207.214.162
+82.207.221.167
  82.207.27.206
  82.207.39.224
  82.207.41.135
@@ -145003,13 +137727,13 @@
  82.207.57.10
  82.207.59.154
  82.207.60.26
-82.207.87.24
  82.208.133.133
  82.208.147.137
  82.208.149.161
  82.208.153.25
  82.208.173.16
  82.208.173.230
+82.208.65.46
  82.208.78.166
  82.208.87.162
  82.208.99.54
@@ -145030,11 +137754,11 @@
  82.209.222.197
  82.209.232.109
  82.209.250.155
+82.209.59.206
  82.209.67.22
  82.21.164.47
  82.21.67.65
  82.211.168.254
-82.211.185.49
  82.211.19.129
  82.211.24.102
  82.211.24.107
@@ -145054,6 +137778,7 @@
  82.211.57.187
  82.211.57.214
  82.211.57.250
+82.211.57.254
  82.211.58.104
  82.211.58.25
  82.211.58.43
@@ -145064,8 +137789,8 @@
  82.211.9.134
  82.211.9.146
  82.211.9.211
-82.211.9.229
  82.211.9.235
+82.211.9.46
  82.211.9.50
  82.211.9.99
  82.212.103.10
@@ -145073,7 +137798,6 @@
  82.213.205.31
  82.213.231.238
  82.213.233.104
-82.213.237.21
  82.213.238.234
  82.213.247.245
  82.213.253.55
@@ -145084,6 +137808,7 @@
  82.217.194.145
  82.217.229.45
  82.22.150.96
+82.22.74.93
  82.220.0.85
  82.220.34.231
  82.221.100.229
@@ -145133,15 +137858,16 @@
  82.223.14.245
  82.223.19.45
  82.223.198.224
-82.223.216.184
  82.223.67.241
  82.223.69.17
+82.223.73.138
  82.223.78.168
  82.223.83.118
  82.227.214.152
  82.228.108.208
  82.228.6.131
  82.230.52.13
+82.233.232.25
  82.234.53.57
  82.237.192.49
  82.238.213.29
@@ -145149,7 +137875,8 @@
  82.240.41.131
  82.241.168.24
  82.242.45.193
-82.244.64.126
+82.246.12.103
+82.25.143.213
  82.25.245.121
  82.251.100.63
  82.251.161.207
@@ -145157,23 +137884,23 @@
  82.252.131.1
  82.252.140.82
  82.252.141.19
+82.252.145.109
  82.252.147.250
  82.252.153.26
  82.252.157.95
  82.252.158.185
  82.253.131.63
-82.253.28.46
  82.254.243.42
  82.255.154.111
  82.255.20.214
  82.255.203.175
  82.26.57.81
  82.27.13.139
-82.27.185.248
  82.29.104.21
  82.3.220.15
  82.30.113.174
  82.31.209.133
+82.32.203.214
  82.33.148.31
  82.33.4.255
  82.36.136.144
@@ -145184,6 +137911,8 @@
  82.39.251.207
  82.39.82.18
  82.4.203.246
+82.40.228.91
+82.41.118.158
  82.44.14.48
  82.46.189.53
  82.47.214.29
@@ -145191,6 +137920,7 @@
  82.48.38.53
  82.48.86.218
  82.49.101.234
+82.5.222.144
  82.5.67.222
  82.51.213.204
  82.52.185.120
@@ -145210,14 +137940,13 @@
  82.55.72.33
  82.56.191.187
  82.57.117.208
+82.57.3.105
  82.57.95.216
  82.59.139.112
-82.59.139.78
  82.59.99.214
  82.6.139.142
  82.6.156.164
  82.6.63.3
-82.60.123.74
  82.60.23.43
  82.60.7.40
  82.62.116.55
@@ -145252,18 +137981,17 @@
  82.64.223.247
  82.64.231.55
  82.64.234.148
+82.64.242.49
  82.64.247.199
  82.64.247.247
-82.64.248.169
  82.64.25.166
  82.64.25.207
  82.64.32.76
  82.64.45.205
  82.64.46.144
  82.64.49.27
-82.64.51.141
  82.64.57.228
-82.64.7.152
+82.64.60.174
  82.64.71.54
  82.64.77.30
  82.64.80.181
@@ -145277,19 +138005,20 @@
  82.65.144.217
  82.65.15.194
  82.65.165.177
+82.65.166.65
+82.65.172.245
  82.65.173.65
  82.65.184.194
+82.65.190.68
  82.65.23.62
-82.65.25.148
  82.65.27.68
  82.65.3.217
  82.65.3.231
  82.65.31.125
  82.65.33.144
-82.65.35.12
  82.65.35.189
  82.65.42.106
-82.66.213.127
+82.65.86.43
  82.66.234.57
  82.66.81.44
  82.67.234.103
@@ -145299,8 +138028,10 @@
  82.67.68.28
  82.68.49.227
  82.69.119.77
+82.7.24.102
  82.71.0.201
  82.71.23.33
+82.71.47.216
  82.72.154.55
  82.73.140.167
  82.73.194.143
@@ -145308,7 +138039,6 @@
  82.74.205.180
  82.74.87.60
  82.75.186.23
-82.76.110.45
  82.76.111.249
  82.76.135.94
  82.76.52.155
@@ -145316,12 +138046,10 @@
  82.77.172.31
  82.77.178.157
  82.77.206.149
-82.77.237.153
  82.77.55.46
  82.77.63.61
  82.77.67.31
  82.77.77.39
-82.78.139.73
  82.78.179.117
  82.78.201.172
  82.78.3.255
@@ -145336,7 +138064,6 @@
  82.80.148.158
  82.80.154.214
  82.80.157.97
-82.80.166.183
  82.80.176.23
  82.80.187.109
  82.80.191.120
@@ -145345,7 +138072,6 @@
  82.81.102.84
  82.81.108.172
  82.81.110.206
-82.81.131.158
  82.81.170.125
  82.81.19.203
  82.81.197.254
@@ -145360,6 +138086,7 @@
  82.81.24.133
  82.81.241.25
  82.81.247.239
+82.81.31.170
  82.81.37.65
  82.81.4.57
  82.81.43.144
@@ -145428,7 +138155,6 @@
  83.1.247.228
  83.1.96.139
  83.1.96.147
-83.10.54.223
  83.100.193.124
  83.102.172.104
  83.103.147.110
@@ -145454,7 +138180,6 @@
  83.110.241.177
  83.110.251.195
  83.110.5.234
-83.114.212.63
  83.114.88.78
  83.118.194.4
  83.118.205.162
@@ -145466,7 +138191,9 @@
  83.12.244.50
  83.122.170.173
  83.128.173.97
+83.128.185.155
  83.128.21.250
+83.128.78.62
  83.13.19.85
  83.13.191.186
  83.13.209.154
@@ -145474,6 +138201,10 @@
  83.132.176.76
  83.133.121.137
  83.133.127.251
+83.135.100.221
+83.135.155.159
+83.135.159.145
+83.135.159.245
  83.135.194.233
  83.135.198.165
  83.135.199.255
@@ -145483,6 +138214,7 @@
  83.135.206.146
  83.135.206.41
  83.135.207.99
+83.135.88.131
  83.136.106.190
  83.136.114.154
  83.136.123.228
@@ -145500,6 +138232,7 @@
  83.138.48.14
  83.14.193.25
  83.14.56.203
+83.140.53.36
  83.140.53.54
  83.142.167.139
  83.142.167.207
@@ -145508,13 +138241,12 @@
  83.142.52.104
  83.142.52.116
  83.142.52.170
+83.142.52.76
  83.142.53.117
  83.142.53.174
-83.142.53.201
  83.142.53.214
  83.142.54.210
  83.142.54.230
-83.142.54.59
  83.142.55.229
  83.142.55.35
  83.143.134.34
@@ -145538,29 +138270,28 @@
  83.15.108.140
  83.15.198.33
  83.15.68.129
+83.150.16.14
  83.150.212.244
  83.150.214.235
  83.150.214.238
  83.150.218.106
-83.150.218.111
  83.150.218.114
  83.150.218.163
+83.150.218.192
+83.150.218.212
  83.150.218.222
  83.150.218.231
  83.150.218.237
  83.150.218.241
  83.150.218.252
  83.150.218.52
-83.150.218.89
  83.150.54.50
  83.151.229.140
  83.151.230.201
-83.151.234.163
  83.159.240.104
  83.16.100.218
  83.16.157.161
  83.16.62.106
-83.160.81.177
  83.161.157.200
  83.161.192.36
  83.162.151.227
@@ -145568,12 +138299,12 @@
  83.162.211.100
  83.162.240.14
  83.162.251.163
-83.163.211.75
  83.164.146.86
  83.165.229.57
-83.166.100.154
+83.165.50.235
  83.166.241.216
  83.166.29.169
+83.167.1.125
  83.167.203.174
  83.167.27.4
  83.167.29.29
@@ -145595,7 +138326,6 @@
  83.169.20.144
  83.169.208.218
  83.169.21.32
-83.169.212.9
  83.169.238.190
  83.169.245.34
  83.169.28.96
@@ -145608,9 +138338,9 @@
  83.170.115.42
  83.170.193.178
  83.170.200.34
+83.171.103.154
  83.171.114.92
  83.171.122.188
-83.171.252.83
  83.171.253.127
  83.171.253.171
  83.171.253.175
@@ -145619,9 +138349,6 @@
  83.171.253.226
  83.171.253.229
  83.171.253.251
-83.171.253.77
-83.171.253.88
-83.171.254.159
  83.171.254.214
  83.171.254.230
  83.171.254.231
@@ -145630,7 +138357,6 @@
  83.171.254.56
  83.171.254.99
  83.171.255.103
-83.171.255.105
  83.171.255.134
  83.171.255.146
  83.171.255.205
@@ -145640,7 +138366,6 @@
  83.171.255.247
  83.171.255.28
  83.171.255.40
-83.171.255.60
  83.171.255.69
  83.171.255.89
  83.171.255.94
@@ -145653,13 +138378,13 @@
  83.174.149.18
  83.174.203.222
  83.174.209.87
+83.174.217.184
  83.174.218.83
  83.174.233.94
  83.175.108.193
  83.175.111.138
  83.175.155.41
  83.175.166.234
-83.175.238.170
  83.178.250.183
  83.179.210.166
  83.179.221.47
@@ -145682,31 +138407,31 @@
  83.19.92.133
  83.19.99.66
  83.191.170.69
-83.192.101.54
  83.192.131.30
  83.192.231.120
  83.196.105.38
  83.196.44.149
  83.198.130.101
  83.198.144.132
+83.198.82.100
  83.199.8.45
  83.199.90.103
-83.2.189.11
-83.2.189.50
  83.2.189.66
  83.20.207.43
  83.20.96.80
  83.202.164.133
+83.202.231.25
+83.205.62.248
  83.208.33.77
  83.208.87.187
  83.209.121.104
  83.209.139.50
-83.209.140.182
  83.209.162.235
+83.209.219.235
  83.209.237.224
  83.209.252.83
  83.209.51.230
-83.209.62.247
+83.209.66.42
  83.209.98.129
  83.211.246.107
  83.212.102.225
@@ -145730,7 +138455,6 @@
  83.219.205.131
  83.22.2.76
  83.22.248.73
-83.22.88.175
  83.220.144.22
  83.220.162.174
  83.220.173.156
@@ -145755,12 +138479,13 @@
  83.223.18.158
  83.224.131.41
  83.224.161.86
+83.226.105.203
  83.226.108.159
  83.226.120.85
  83.226.17.109
  83.226.240.33
  83.226.27.226
-83.226.76.197
+83.226.45.169
  83.227.10.204
  83.227.15.88
  83.228.102.154
@@ -145774,6 +138499,7 @@
  83.231.34.192
  83.233.106.108
  83.233.120.250
+83.233.138.242
  83.233.181.209
  83.233.192.191
  83.233.192.20
@@ -145789,6 +138515,7 @@
  83.233.208.231
  83.233.30.201
  83.233.37.116
+83.233.37.152
  83.233.60.105
  83.233.60.251
  83.233.60.31
@@ -145798,7 +138525,6 @@
  83.233.72.174
  83.233.95.130
  83.234.160.106
-83.234.179.115
  83.234.201.102
  83.234.206.200
  83.234.206.47
@@ -145810,7 +138536,6 @@
  83.238.26.22
  83.238.39.250
  83.238.76.27
-83.239.114.88
  83.239.138.38
  83.239.177.23
  83.239.38.138
@@ -145818,8 +138543,8 @@
  83.239.46.124
  83.24.214.42
  83.24.255.250
-83.24.46.108
  83.24.54.119
+83.24.75.165
  83.240.15.151
  83.240.242.218
  83.240.72.79
@@ -145838,7 +138563,6 @@
  83.248.180.9
  83.248.66.194
  83.249.245.244
-83.249.249.243
  83.249.73.216
  83.25.14.196
  83.250.1.13
@@ -145858,6 +138582,7 @@
  83.253.184.177
  83.253.227.220
  83.253.253.167
+83.253.253.99
  83.254.119.42
  83.254.249.65
  83.254.54.33
@@ -145868,15 +138593,14 @@
  83.26.50.159
  83.26.54.64
  83.26.76.38
-83.27.20.17
-83.28.1.91
  83.28.162.225
  83.28.4.29
  83.28.74.37
  83.29.197.187
+83.29.203.167
+83.29.224.41
  83.29.226.213
  83.3.151.42
-83.30.142.17
  83.30.169.28
  83.30.193.198
  83.30.230.160
@@ -145888,16 +138612,15 @@
  83.37.158.47
  83.37.178.69
  83.38.39.93
-83.4.100.103
  83.4.101.104
  83.4.115.182
  83.4.39.184
  83.4.56.165
  83.40.147.111
+83.40.30.72
  83.40.81.28
  83.41.172.111
  83.42.54.207
-83.42.98.228
  83.43.241.236
  83.43.53.115
  83.45.243.249
@@ -145906,20 +138629,21 @@
  83.48.101.184
  83.48.15.142
  83.48.62.121
-83.48.72.253
  83.48.89.147
  83.48.91.194
  83.48.97.152
  83.50.25.138
-83.51.16.179
+83.51.5.100
  83.53.86.172
-83.55.103.94
-83.57.129.50
+83.54.248.171
+83.55.101.248
+83.56.66.58
  83.6.146.196
  83.6.159.151
  83.6.164.25
  83.6.3.135
  83.60.154.199
+83.61.122.65
  83.61.23.152
  83.63.136.171
  83.63.185.108
@@ -145930,8 +138654,10 @@
  83.66.175.34
  83.68.237.104
  83.68.251.177
+83.69.125.126
  83.69.215.130
  83.69.222.102
+83.69.230.5
  83.69.237.89
  83.69.90.191
  83.7.114.8
@@ -145946,6 +138672,7 @@
  83.79.177.242
  83.79.59.54
  83.82.3.167
+83.83.102.55
  83.83.112.87
  83.83.155.43
  83.83.172.176
@@ -145954,8 +138681,8 @@
  83.85.29.35
  83.85.9.236
  83.85.97.52
+83.86.37.228
  83.86.39.14
-83.9.244.225
  83.94.206.60
  83.96.205.72
  83.96.213.63
@@ -145991,7 +138718,6 @@
  83.97.20.29
  83.97.20.30
  83.97.20.31
-83.97.20.34
  83.97.20.35
  83.97.20.39
  83.97.20.67
@@ -146019,7 +138745,6 @@
  83877384989389459-secondary.z13.web.core.windows.net
  839393.ml
  83buortfa83.bankofamericaslpemr.com
-84.0.197.181
  84.0.215.198
  84.0.24.80
  84.0.247.95
@@ -146031,7 +138756,6 @@
  84.1.219.32
  84.1.30.70
  84.1.35.197
-84.101.76.36
  84.102.96.90
  84.104.86.54
  84.105.163.103
@@ -146052,41 +138776,44 @@
  84.117.139.69
  84.118.161.63
  84.118.239.130
-84.119.169.39
+84.118.91.210
  84.120.107.50
  84.121.4.248
  84.122.1.218
-84.122.252.151
  84.123.13.17
+84.125.160.7
  84.126.137.181
+84.126.177.81
  84.126.71.50
  84.127.137.202
  84.127.40.16
-84.133.173.129
  84.134.24.100
  84.140.144.150
+84.140.150.23
  84.141.254.249
  84.145.76.125
  84.148.217.197
-84.148.223.134
  84.15.143.111
  84.15.156.185
  84.15.160.174
  84.15.209.197
-84.151.189.83
-84.151.237.232
+84.151.177.70
  84.154.242.25
+84.154.247.234
  84.154.28.16
  84.16.126.83
+84.16.234.202
  84.16.234.247
  84.16.248.172
  84.16.38.218
  84.16.46.130
  84.160.181.229
-84.160.48.149
+84.160.51.38
  84.160.55.55
  84.161.206.4
+84.162.125.30
  84.162.94.163
+84.164.162.221
  84.167.152.27
  84.168.116.156
  84.168.252.185
@@ -146102,13 +138829,9 @@
  84.17.49.20
  84.17.49.202
  84.17.49.99
-84.17.51.37
  84.17.51.49
-84.17.51.66
  84.17.51.67
  84.17.51.82
-84.17.53.159
-84.17.53.82
  84.17.54.71
  84.17.55.103
  84.17.55.105
@@ -146122,35 +138845,30 @@
  84.17.55.123
  84.17.55.124
  84.17.55.125
-84.17.55.15
  84.17.55.19
  84.17.55.6
  84.17.60.209
  84.17.60.210
  84.17.60.214
+84.17.61.113
  84.17.61.225
-84.170.117.192
  84.170.117.244
-84.174.211.188
  84.174.96.222
  84.178.71.231
  84.180.236.205
  84.180.243.61
  84.181.20.135
-84.181.29.171
-84.183.149.231
  84.184.108.174
  84.184.82.227
  84.185.244.169
  84.19.178.210
-84.190.140.128
+84.190.130.75
  84.190.141.8
  84.192.16.234
  84.193.201.197
  84.193.98.117
  84.194.158.124
  84.199.237.190
-84.2.189.105
  84.2.191.178
  84.2.226.70
  84.2.248.104
@@ -146193,7 +138911,6 @@
  84.21.188.100
  84.21.188.118
  84.21.188.123
-84.21.188.143
  84.21.188.149
  84.21.188.16
  84.21.188.163
@@ -146226,14 +138943,12 @@
  84.21.188.78
  84.21.188.91
  84.21.188.94
-84.21.188.95
  84.21.191.1
  84.21.191.10
  84.21.191.101
  84.21.191.102
  84.21.191.106
  84.21.191.107
-84.21.191.108
  84.21.191.111
  84.21.191.112
  84.21.191.115
@@ -146269,7 +138984,6 @@
  84.21.191.18
  84.21.191.181
  84.21.191.184
-84.21.191.186
  84.21.191.187
  84.21.191.188
  84.21.191.194
@@ -146300,7 +139014,6 @@
  84.21.191.30
  84.21.191.31
  84.21.191.32
-84.21.191.34
  84.21.191.35
  84.21.191.36
  84.21.191.4
@@ -146318,7 +139031,6 @@
  84.21.191.7
  84.21.191.72
  84.21.191.73
-84.21.191.79
  84.21.191.81
  84.21.191.87
  84.21.191.88
@@ -146344,10 +139056,12 @@
  84.214.176.227
  84.214.55.15
  84.214.74.65
+84.215.68.131
  84.215.88.26
  84.216.170.35
  84.216.171.5
  84.216.177.35
+84.216.181.94
  84.216.210.214
  84.216.51.36
  84.217.0.86
@@ -146355,6 +139069,7 @@
  84.217.7.105
  84.217.82.227
  84.22.116.140
+84.22.137.229
  84.22.138.150
  84.22.141.87
  84.22.143.118
@@ -146366,15 +139081,16 @@
  84.22.41.102
  84.22.42.213
  84.22.52.222
-84.22.53.122
  84.22.59.202
  84.22.59.74
  84.22.63.122
  84.221.212.164
+84.225.189.27
  84.226.245.96
  84.226.56.42
  84.228.117.172
  84.228.117.173
+84.228.118.218
  84.228.120.132
  84.228.120.49
  84.228.123.246
@@ -146387,7 +139103,6 @@
  84.228.91.2
  84.229.225.161
  84.229.233.3
-84.229.88.146
  84.23.138.151
  84.23.141.177
  84.23.145.70
@@ -146398,6 +139113,7 @@
  84.232.18.171
  84.232.223.152
  84.232.24.31
+84.232.24.86
  84.232.243.108
  84.232.251.72
  84.232.5.230
@@ -146416,7 +139132,6 @@
  84.236.243.47
  84.236.30.236
  84.236.6.226
-84.236.97.197
  84.237.149.162
  84.237.231.191
  84.238.105.42
@@ -146426,10 +139141,12 @@
  84.238.157.146
  84.238.198.166
  84.238.241.194
+84.238.44.49
  84.238.57.224
  84.238.96.208
  84.239.39.142
  84.239.39.89
+84.24.190.84
  84.240.26.123
  84.240.28.49
  84.240.66.131
@@ -146466,12 +139183,14 @@
  84.246.200.122
  84.246.21.243
  84.246.229.182
+84.247.12.90
  84.247.48.11
  84.247.48.12
  84.247.48.13
  84.247.48.14
  84.247.48.20
  84.247.48.24
+84.247.48.25
  84.247.48.27
  84.247.48.28
  84.247.48.29
@@ -146481,28 +139200,26 @@
  84.247.48.5
  84.247.48.51
  84.247.48.53
+84.247.48.55
  84.247.48.57
  84.247.48.58
-84.247.48.6
  84.247.48.61
+84.247.48.62
  84.247.48.7
  84.247.48.8
-84.248.191.75
+84.25.47.230
  84.250.5.191
  84.251.91.165
  84.252.121.124
  84.253.146.34
  84.254.38.12
  84.254.39.129
-84.254.8.101
  84.254.89.159
  84.254.90.125
  84.255.194.237
  84.255.203.218
-84.255.203.28
  84.255.204.59
  84.255.243.69
-84.255.244.128
  84.255.244.61
  84.255.249.163
  84.255.249.179
@@ -146534,6 +139251,7 @@
  84.38.181.217
  84.38.184.216
  84.38.184.53
+84.38.184.67
  84.38.184.79
  84.38.185.122
  84.38.187.143
@@ -146562,10 +139280,8 @@
  84.42.45.165
  84.42.62.141
  84.42.62.187
-84.42.72.1
  84.42.72.137
  84.42.72.165
-84.42.72.169
  84.42.72.183
  84.42.72.254
  84.42.72.41
@@ -146582,15 +139298,12 @@
  84.42.73.29
  84.42.73.3
  84.42.73.74
-84.42.73.88
-84.42.74.124
  84.42.74.134
  84.42.74.145
  84.42.74.149
  84.42.74.150
  84.42.74.175
  84.42.74.177
-84.42.74.18
  84.42.74.184
  84.42.74.19
  84.42.74.20
@@ -146620,6 +139333,7 @@
  84.45.214.120
  84.45.38.216
  84.46.1.149
+84.46.11.194
  84.46.4.114
  84.47.226.66
  84.47.226.68
@@ -146918,14 +139632,10 @@
  84.54.146.184
  84.54.191.52
  84.54.202.216
-84.54.53.13
  84.54.53.94
  84.54.58.105
  84.54.58.116
  84.54.58.128
-84.54.58.195
-84.54.58.199
-84.54.58.204
  84.54.58.48
  84.55.70.80
  84.57.168.131
@@ -146943,8 +139653,8 @@
  84.7.96.195
  84.71.103.181
  84.71.195.200
-84.72.111.202
  84.73.156.202
+84.73.17.41
  84.73.218.55
  84.74.119.202
  84.74.164.236
@@ -147012,10 +139722,10 @@
  85.10.203.85
  85.10.206.14
  85.10.206.179
+85.10.206.219
  85.10.24.40
  85.10.248.121
-85.10.50.180
-85.10.51.31
+85.10.50.179
  85.10.53.90
  85.10.56.132
  85.10.56.136
@@ -147055,6 +139765,7 @@
  85.105.154.118
  85.105.155.218
  85.105.156.8
+85.105.160.167
  85.105.166.119
  85.105.172.244
  85.105.180.33
@@ -147065,6 +139776,7 @@
  85.105.203.55
  85.105.204.90
  85.105.205.77
+85.105.208.25
  85.105.213.225
  85.105.218.37
  85.105.218.49
@@ -147080,21 +139792,21 @@
  85.105.29.239
  85.105.31.183
  85.105.32.224
+85.105.4.226
  85.105.44.145
  85.105.69.143
  85.105.73.59
  85.105.74.126
  85.105.76.57
+85.105.82.94
  85.105.83.125
  85.105.87.39
  85.105.96.64
  85.105.97.45
  85.106.189.123
  85.106.209.223
-85.106.255.120
  85.106.4.40
  85.106.8.102
-85.108.168.246
  85.108.246.221
  85.109.127.48
  85.109.43.176
@@ -147110,6 +139822,7 @@
  85.111.74.140
  85.112.32.172
  85.112.44.170
+85.112.69.122
  85.112.76.110
  85.112.76.58
  85.112.78.34
@@ -147124,22 +139837,18 @@
  85.113.213.176
  85.113.213.222
  85.113.213.45
-85.113.213.50
  85.113.213.65
  85.113.213.81
  85.113.213.89
  85.113.213.99
  85.113.214.11
-85.113.214.118
  85.113.214.119
  85.113.214.139
  85.113.214.141
  85.113.214.142
  85.113.214.150
  85.113.214.160
-85.113.214.195
  85.113.214.237
-85.113.214.243
  85.113.214.28
  85.113.214.34
  85.113.214.44
@@ -147150,7 +139859,6 @@
  85.113.91.205
  85.114.101.200
  85.114.101.203
-85.114.124.205
  85.114.133.163
  85.114.134.49
  85.114.135.126
@@ -147161,6 +139869,7 @@
  85.114.96.154
  85.115.173.73
  85.116.125.149
+85.117.110.208
  85.117.56.103
  85.117.56.73
  85.117.56.74
@@ -147183,11 +139892,6 @@
  85.12.241.144
  85.12.245.153
  85.12.33.30
-85.121.205.185
-85.128.142.100
-85.128.142.240
-85.128.142.66
-85.128.142.83
  85.13.134.81
  85.13.229.138
  85.13.237.23
@@ -147196,13 +139900,11 @@
  85.132.9.180
  85.132.96.242
  85.133.130.132
-85.133.130.42
  85.133.143.35
+85.133.183.66
  85.133.190.156
  85.133.221.195
  85.135.95.218
-85.136.137.82
-85.137.201.108
  85.138.240.40
  85.14.10.115
  85.14.243.31
@@ -147215,15 +139917,12 @@
  85.143.213.2
  85.143.214.43
  85.143.222.245
-85.143.228.167
-85.143.228.171
  85.143.228.45
  85.143.254.20
  85.145.142.46
  85.145.145.34
  85.146.16.131
  85.146.208.186
-85.147.71.245
  85.148.168.20
  85.15.179.171
  85.15.179.235
@@ -147248,19 +139947,22 @@
  85.159.27.40
  85.159.4.113
  85.159.44.66
+85.160.34.24
+85.160.69.237
  85.163.224.168
  85.163.46.102
  85.163.53.75
  85.163.87.14
+85.164.185.172
  85.164.236.63
  85.165.51.12
  85.166.127.166
  85.166.65.242
+85.166.9.245
  85.167.131.65
  85.167.250.200
  85.167.31.227
  85.167.36.179
-85.17.104.149
  85.17.111.125
  85.17.131.134
  85.17.131.145
@@ -147291,16 +139993,14 @@
  85.172.206.33
  85.172.229.121
  85.172.38.200
-85.172.39.174
  85.172.98.94
  85.173.112.54
  85.173.165.36
-85.173.244.176
  85.173.245.218
-85.174.124.141
  85.175.100.254
  85.175.171.169
  85.175.194.35
+85.175.227.3
  85.175.4.251
  85.175.5.6
  85.175.97.57
@@ -147314,6 +140014,7 @@
  85.184.138.108
  85.184.168.215
  85.184.191.57
+85.184.241.195
  85.185.149.28
  85.185.152.146
  85.185.152.148
@@ -147321,6 +140022,7 @@
  85.185.161.202
  85.185.161.50
  85.185.161.70
+85.185.2.242
  85.185.200.161
  85.185.236.173
  85.185.250.27
@@ -147329,7 +140031,6 @@
  85.186.160.25
  85.186.38.228
  85.186.97.181
-85.187.121.186
  85.187.17.39
  85.187.224.90
  85.187.238.79
@@ -147342,7 +140043,6 @@
  85.190.2.200
  85.190.2.205
  85.190.42.199
-85.191.175.49
  85.191.200.51
  85.191.219.13
  85.191.243.82
@@ -147355,6 +140055,7 @@
  85.194.157.148
  85.194.238.131
  85.195.206.199
+85.195.222.218
  85.195.222.234
  85.195.234.244
  85.195.255.212
@@ -147364,6 +140065,7 @@
  85.195.34.254
  85.195.52.41
  85.195.54.110
+85.195.92.173
  85.196.135.154
  85.196.136.1
  85.196.136.13
@@ -147375,6 +140077,7 @@
  85.196.211.100
  85.196.25.2
  85.197.161.143
+85.197.177.204
  85.198.115.122
  85.198.133.22
  85.198.142.186
@@ -147382,26 +140085,24 @@
  85.198.250.135
  85.198.250.240
  85.2.130.99
+85.2.209.66
  85.2.219.109
  85.2.9.70
  85.201.210.10
  85.202.161.123
  85.202.176.146
-85.202.194.175
  85.202.194.185
  85.202.194.196
  85.202.194.40
  85.202.194.48
  85.202.195.124
  85.202.195.131
-85.202.195.175
  85.202.195.191
  85.202.195.74
+85.202.195.87
  85.202.195.99
  85.202.229.205
-85.203.174.27
  85.203.44.32
-85.204.111.36
  85.204.116.106
  85.204.116.111
  85.204.116.139
@@ -147431,14 +140132,13 @@
  85.204.246.107
  85.204.246.138
  85.204.53.52
+85.204.65.163
  85.206.162.219
-85.206.165.68
  85.206.57.202
  85.207.155.39
  85.208.109.193
  85.208.109.221
  85.208.115.112
-85.208.115.201
  85.208.140.163
  85.208.185.212
  85.208.187.5
@@ -147451,24 +140151,21 @@
  85.208.209.235
  85.208.209.31
  85.208.209.41
-85.208.209.49
  85.208.209.68
  85.208.210.146
  85.208.210.172
  85.208.210.183
-85.208.210.198
+85.208.210.186
  85.208.210.93
  85.208.211.14
  85.208.211.159
  85.208.211.20
-85.208.211.241
  85.208.211.48
  85.208.211.78
  85.208.213.114
  85.208.22.162
  85.208.76.1
  85.208.76.2
-85.208.85.101
  85.208.85.113
  85.208.85.117
  85.208.85.183
@@ -147477,7 +140174,6 @@
  85.208.85.207
  85.208.86.118
  85.208.86.121
-85.208.86.152
  85.208.86.175
  85.208.86.190
  85.208.86.220
@@ -147485,11 +140181,9 @@
  85.208.86.59
  85.208.86.88
  85.208.87.112
-85.208.87.133
  85.208.87.14
-85.208.87.15
+85.208.87.153
  85.208.87.158
-85.208.87.17
  85.208.87.187
  85.208.87.201
  85.208.87.212
@@ -147497,7 +140191,6 @@
  85.208.87.223
  85.208.87.234
  85.208.87.29
-85.208.87.35
  85.208.87.45
  85.208.87.63
  85.208.87.68
@@ -147549,7 +140242,6 @@
  85.209.0.181
  85.209.0.184
  85.209.0.186
-85.209.0.188
  85.209.0.189
  85.209.0.190
  85.209.0.191
@@ -147579,7 +140271,6 @@
  85.209.0.240
  85.209.0.241
  85.209.0.242
-85.209.0.244
  85.209.0.247
  85.209.0.251
  85.209.0.252
@@ -147587,7 +140278,6 @@
  85.209.0.27
  85.209.0.28
  85.209.0.31
-85.209.0.34
  85.209.0.35
  85.209.0.40
  85.209.0.41
@@ -147612,7 +140302,6 @@
  85.209.0.8
  85.209.0.81
  85.209.0.82
-85.209.0.84
  85.209.0.85
  85.209.0.88
  85.209.0.90
@@ -147620,7 +140309,6 @@
  85.209.0.96
  85.209.0.99
  85.209.129.22
-85.209.149.125
  85.209.149.133
  85.209.149.142
  85.209.149.144
@@ -147633,6 +140321,7 @@
  85.209.149.42
  85.209.149.75
  85.209.150.128
+85.209.150.135
  85.209.150.137
  85.209.150.144
  85.209.150.15
@@ -147654,11 +140343,11 @@
  85.209.151.191
  85.209.151.196
  85.209.151.233
-85.209.151.28
  85.209.151.39
  85.209.151.52
  85.209.151.77
  85.209.151.84
+85.209.40.54
  85.209.41.155
  85.209.41.254
  85.209.41.70
@@ -147669,9 +140358,12 @@
  85.21.78.213
  85.211.126.190
  85.212.178.113
-85.212.216.141
+85.212.212.121
  85.212.223.223
-85.212.91.57
+85.212.25.42
+85.212.28.56
+85.212.77.192
+85.212.79.243
  85.214.103.48
  85.214.108.223
  85.214.134.8
@@ -147718,18 +140410,15 @@
  85.215.89.53
  85.215.9.88
  85.215.92.224
+85.216.102.202
  85.216.233.230
  85.216.66.241
  85.217.137.77
  85.217.170.105
  85.217.192.39
-85.217.227.54
-85.219.233.72
-85.221.146.28
  85.222.17.110
  85.222.206.142
  85.222.69.218
-85.223.157.204
  85.223.214.130
  85.224.108.43
  85.224.186.218
@@ -147742,6 +140431,7 @@
  85.226.67.144
  85.227.137.195
  85.227.199.217
+85.227.245.26
  85.227.246.148
  85.228.216.200
  85.228.232.22
@@ -147769,7 +140459,6 @@
  85.234.143.94
  85.234.145.132
  85.234.145.20
-85.234.169.206
  85.235.190.138
  85.235.66.147
  85.236.14.54
@@ -147788,22 +140477,22 @@
  85.238.167.170
  85.238.168.253
  85.238.194.251
+85.238.96.130
  85.238.99.14
  85.239.121.168
  85.239.35.123
  85.239.35.124
  85.239.35.130
-85.239.35.162
  85.239.35.243
  85.239.42.4
  85.24.134.80
+85.24.146.133
  85.24.160.164
  85.24.161.97
  85.24.162.124
  85.24.163.112
  85.24.163.138
  85.24.164.102
-85.24.164.170
  85.24.186.23
  85.24.228.90
  85.24.232.32
@@ -147830,10 +140519,10 @@
  85.245.26.67
  85.246.168.252
  85.246.52.164
+85.246.59.168
  85.246.78.192
  85.247.0.210
  85.247.109.182
-85.247.118.6
  85.247.150.173
  85.247.151.109
  85.247.247.175
@@ -147875,6 +140564,7 @@
  85.27.199.198
  85.29.136.63
  85.3.173.102
+85.3.203.149
  85.3.206.174
  85.3.218.151
  85.3.98.134
@@ -147885,14 +140575,13 @@
  85.30.248.210
  85.30.61.54
  85.31.176.203
-85.33.102.18
+85.33.122.226
  85.35.244.164
  85.4.142.87
  85.4.176.35
  85.4.68.240
  85.4.99.111
  85.42.217.145
-85.43.219.10
  85.43.41.197
  85.45.123.234
  85.47.31.179
@@ -147900,7 +140589,6 @@
  85.5.121.39
  85.5.155.94
  85.5.89.225
-85.50.100.181
  85.50.186.130
  85.51.12.244
  85.52.217.114
@@ -147943,11 +140631,11 @@
  85.74.231.41
  85.74.89.36
  85.74.97.40
+85.75.119.145
  85.75.219.238
  85.75.74.16
  85.75.91.68
  85.75.94.205
-85.8.114.124
  85.8.44.247
  85.8.51.143
  85.84.99.163
@@ -148011,6 +140699,7 @@
  85.95.242.121
  85.95.245.50
  85.95.245.63
+85.96.135.1
  85.96.176.172
  85.96.181.88
  85.96.187.118
@@ -148071,6 +140760,7 @@
  86.101.155.47
  86.101.224.233
  86.101.56.141
+86.104.103.19
  86.104.15.20
  86.104.18.51
  86.104.194.116
@@ -148080,6 +140770,7 @@
  86.104.194.179
  86.104.194.180
  86.104.194.181
+86.104.194.210
  86.104.194.52
  86.104.194.81
  86.104.194.88
@@ -148105,12 +140796,12 @@
  86.106.131.150
  86.106.131.207
  86.106.74.125
-86.106.90.106
  86.106.92.23
  86.107.146.161
  86.107.187.54
  86.108.102.184
  86.108.103.170
+86.108.106.212
  86.108.108.246
  86.108.109.91
  86.108.110.101
@@ -148118,14 +140809,15 @@
  86.108.116.3
  86.108.127.106
  86.108.2.45
-86.108.28.122
  86.108.40.101
  86.108.43.71
+86.108.5.102
  86.108.5.105
  86.108.51.246
  86.108.53.172
  86.108.6.31
  86.108.6.32
+86.108.69.155
  86.108.7.151
  86.108.71.191
  86.108.74.233
@@ -148150,7 +140842,7 @@
  86.111.146.250
  86.111.88.138
  86.111.95.131
-86.12.75.110
+86.120.131.210
  86.120.157.254
  86.120.218.108
  86.120.218.146
@@ -148171,6 +140863,7 @@
  86.122.170.50
  86.122.180.36
  86.122.211.243
+86.122.27.242
  86.122.53.165
  86.122.71.84
  86.123.138.111
@@ -148187,6 +140880,7 @@
  86.124.131.5
  86.124.230.115
  86.124.239.218
+86.124.242.220
  86.124.249.9
  86.124.63.66
  86.124.80.99
@@ -148209,12 +140903,15 @@
  86.129.254.129
  86.130.116.108
  86.131.36.215
+86.133.122.6
  86.134.143.96
  86.134.255.97
  86.135.90.231
  86.137.132.125
  86.138.161.118
+86.138.24.57
  86.138.254.223
+86.138.34.45
  86.14.0.69
  86.141.123.144
  86.141.235.71
@@ -148224,20 +140921,14 @@
  86.143.124.247
  86.143.148.128
  86.144.134.215
-86.146.218.238
-86.146.75.188
  86.146.82.70
  86.147.9.245
  86.148.151.170
  86.149.8.23
  86.15.86.116
-86.151.73.108
-86.152.92.63
-86.155.33.151
  86.155.54.213
  86.156.101.128
  86.157.225.33
-86.157.225.34
  86.159.154.192
  86.159.84.28
  86.160.58.252
@@ -148259,7 +140950,6 @@
  86.177.249.64
  86.178.24.120
  86.179.3.0
-86.179.31.225
  86.18.184.159
  86.181.154.101
  86.183.211.181
@@ -148268,28 +140958,33 @@
  86.184.92.101
  86.188.246.2
  86.188.250.209
+86.188.33.237
  86.19.160.244
  86.19.20.105
  86.190.247.165
  86.193.209.93
  86.193.243.3
  86.195.12.7
-86.2.37.40
+86.2.188.146
  86.20.194.52
  86.202.151.196
-86.206.131.154
  86.206.224.153
+86.21.218.123
  86.210.71.37
+86.211.113.166
  86.213.148.158
  86.216.169.148
+86.218.107.235
  86.22.221.170
  86.225.212.132
  86.23.4.8
+86.233.80.203
  86.234.149.82
  86.234.56.72
  86.234.64.241
  86.235.115.128
  86.235.182.230
+86.239.109.151
  86.24.104.62
  86.24.173.237
  86.241.149.172
@@ -148300,6 +140995,7 @@
  86.249.8.95
  86.253.219.39
  86.253.40.82
+86.26.147.166
  86.27.212.216
  86.27.243.5
  86.28.108.118
@@ -148337,10 +141033,12 @@
  86.47.252.137
  86.51.26.11
  86.52.125.68
+86.52.47.147
  86.56.238.247
  86.57.131.182
  86.57.167.132
  86.57.181.122
+86.57.181.197
  86.57.198.55
  86.57.210.11
  86.57.216.191
@@ -148348,8 +141046,6 @@
  86.57.234.172
  86.57.235.240
  86.57.242.224
-86.57.243.168
-86.57.66.66
  86.59.147.155
  86.59.184.250
  86.60.179.136
@@ -148370,7 +141066,6 @@
  86.69.2.215
  86.7.59.195
  86.71.140.117
-86.72.228.193
  86.73.116.53
  86.73.68.243
  86.76.7.132
@@ -148392,11 +141087,10 @@
  86.94.204.81
  86.95.8.249
  86.96.249.162
-86.97.124.205
  86.97.32.103
  86.97.38.116
-86.98.156.133
-86.98.4.165
+86.98.159.18
+86.98.215.67
  86.98.4.97
  86.98.41.90
  86.98.50.135
@@ -148435,6 +141129,7 @@
  86mld.com
  87.0.2.121
  87.1.83.3
+87.1.89.131
  87.10.247.137
  87.101.178.215
  87.101.49.15
@@ -148468,7 +141163,6 @@
  87.106.18.12
  87.106.181.84
  87.106.189.77
-87.106.204.174
  87.106.205.195
  87.106.210.109
  87.106.210.178
@@ -148481,23 +141175,24 @@
  87.106.76.218
  87.106.94.225
  87.107.116.255
-87.107.159.109
-87.107.159.225
  87.107.159.248
+87.107.164.118
  87.107.28.35
  87.107.33.9
  87.107.56.156
  87.107.57.179
  87.107.57.34
  87.107.68.207
-87.107.95.70
-87.11.144.166
+87.107.72.87
+87.11.140.50
+87.11.47.156
  87.110.181.30
  87.110.188.59
  87.110.60.124
-87.112.27.94
  87.113.182.83
+87.116.144.146
  87.116.148.251
+87.116.148.5
  87.116.156.195
  87.117.1.169
  87.117.169.23
@@ -148528,6 +141223,7 @@
  87.118.92.43
  87.118.96.154
  87.119.194.44
+87.119.240.21
  87.119.66.147
  87.12.216.21
  87.12.250.90
@@ -148535,7 +141231,6 @@
  87.120.179.74
  87.120.210.239
  87.120.213.252
-87.120.220.203
  87.120.246.53
  87.120.254.105
  87.120.254.114
@@ -148550,7 +141245,6 @@
  87.120.6.218
  87.120.8.5
  87.121.175.91
-87.121.29.201
  87.121.37.156
  87.121.49.238
  87.121.51.66
@@ -148564,24 +141258,25 @@
  87.122.215.210
  87.122.219.2
  87.122.223.210
-87.122.228.65
  87.123.105.48
  87.123.173.134
-87.123.179.34
-87.123.235.250
  87.123.32.69
+87.123.33.127
  87.123.33.214
  87.123.34.16
  87.123.36.136
  87.123.37.30
+87.123.40.210
  87.123.42.107
  87.123.42.130
  87.123.42.244
  87.123.42.47
  87.123.43.195
  87.123.44.128
+87.123.44.182
  87.123.44.197
  87.123.44.245
+87.123.46.73
  87.123.47.180
  87.123.50.107
  87.123.57.146
@@ -148603,39 +141298,39 @@
  87.123.85.138
  87.123.88.3
  87.123.90.33
-87.123.96.248
+87.123.97.186
  87.124.164.13
  87.124.164.14
+87.125.102.105
  87.126.166.107
  87.126.166.109
  87.126.186.110
  87.126.213.96
  87.126.64.193
  87.13.147.184
+87.13.200.175
  87.13.200.179
  87.13.57.80
  87.132.217.50
  87.134.191.204
  87.138.108.161
  87.138.221.130
-87.138.228.114
  87.139.127.162
  87.139.46.114
  87.14.191.42
  87.140.92.161
-87.142.192.169
+87.142.197.58
  87.143.159.208
-87.143.159.235
  87.144.252.219
  87.146.254.112
+87.147.73.70
  87.147.79.44
  87.148.33.31
+87.148.38.150
  87.148.44.206
  87.15.194.35
  87.15.253.236
  87.15.36.183
-87.15.78.225
-87.150.53.188
  87.150.55.193
  87.154.82.47
  87.154.91.25
@@ -148644,10 +141339,13 @@
  87.156.33.113
  87.156.51.139
  87.157.179.156
-87.157.190.77
+87.157.183.226
  87.16.72.110
  87.160.149.147
-87.166.36.251
+87.160.195.64
+87.163.39.236
+87.163.46.119
+87.165.93.163
  87.168.141.251
  87.169.126.200
  87.17.214.235
@@ -148657,15 +141355,13 @@
  87.17.90.169
  87.170.179.202
  87.170.34.23
-87.172.224.138
  87.173.189.25
-87.173.223.98
-87.175.80.229
+87.175.35.196
  87.175.82.205
+87.175.87.168
  87.177.235.250
  87.181.177.183
  87.182.231.191
-87.185.156.89
  87.185.159.112
  87.185.31.200
  87.187.144.72
@@ -148678,7 +141374,6 @@
  87.190.16.229
  87.193.48.235
  87.196.184.69
-87.197.121.58
  87.197.137.223
  87.197.142.112
  87.197.142.80
@@ -148711,19 +141406,18 @@
  87.217.91.78
  87.218.156.4
  87.218.216.208
-87.219.130.54
  87.219.83.218
+87.220.151.125
  87.225.0.174
  87.225.106.80
+87.225.23.222
  87.226.165.143
  87.226.213.102
  87.227.140.10
-87.227.176.38
  87.228.191.138
  87.228.206.210
  87.228.211.216
  87.228.33.206
-87.228.38.147
  87.229.120.152
  87.229.142.62
  87.229.143.10
@@ -148737,6 +141431,7 @@
  87.231.27.105
  87.234.138.201
  87.236.196.221
+87.236.199.169
  87.236.208.138
  87.236.210.18
  87.236.22.215
@@ -148755,7 +141450,6 @@
  87.241.123.56
  87.241.128.55
  87.241.132.129
-87.241.143.6
  87.241.160.125
  87.241.170.21
  87.241.174.203
@@ -148779,7 +141473,6 @@
  87.246.19.124
  87.246.46.132
  87.246.59.44
-87.246.7.151
  87.246.7.153
  87.247.102.142
  87.247.143.209
@@ -148790,6 +141483,7 @@
  87.248.182.115
  87.248.19.119
  87.248.31.60
+87.248.61.39
  87.248.77.92
  87.249.141.14
  87.249.142.66
@@ -148798,6 +141492,7 @@
  87.250.6.151
  87.251.112.117
  87.251.122.178
+87.251.165.78
  87.251.214.153
  87.251.214.234
  87.251.214.242
@@ -148806,8 +141501,10 @@
  87.251.245.80
  87.251.247.238
  87.251.250.84
+87.251.66.126
  87.251.67.184
  87.251.67.205
+87.251.70.200
  87.251.70.202
  87.251.70.211
  87.251.70.240
@@ -148847,7 +141544,6 @@
  87.251.74.78
  87.251.74.8
  87.251.74.9
-87.251.75.179
  87.251.75.50
  87.251.76.122
  87.251.77.206
@@ -148856,6 +141552,7 @@
  87.252.183.184
  87.252.99.89
  87.253.135.238
+87.253.18.123
  87.253.70.139
  87.253.71.25
  87.254.138.170
@@ -148875,6 +141572,7 @@
  87.26.36.198
  87.26.40.62
  87.26.48.139
+87.26.57.119
  87.26.58.135
  87.27.124.239
  87.27.13.233
@@ -148890,7 +141588,6 @@
  87.3.254.79
  87.3.46.64
  87.5.26.155
-87.5.97.237
  87.5.98.36
  87.56.50.203
  87.61.232.211
@@ -148900,34 +141597,32 @@
  87.65.147.163
  87.65.195.214
  87.65.251.29
-87.75.104.165
  87.75.105.186
  87.76.11.57
  87.76.12.118
  87.76.33.110
  87.76.33.114
+87.76.33.134
  87.76.33.14
  87.76.33.190
  87.76.33.208
-87.76.33.21
  87.76.33.247
-87.76.33.27
-87.76.34.53
  87.76.35.178
  87.76.9.176
+87.78.62.171
  87.79.184.155
+87.79.200.197
  87.79.254.225
  87.79.68.86
  87.79.94.221
  87.81.219.92
  87.81.22.131
  87.81.81.101
+87.9.132.50
  87.9.19.191
  87.9.198.194
  87.9.201.90
  87.91.82.229
-87.92.12.14
-87.92.4.183
  87.93.33.20
  87.93.41.139
  87.93.8.13
@@ -148939,9 +141634,7 @@
  87.97.179.135
  87.97.204.41
  87.97.222.253
-87.97.28.190
  87.97.83.227
-87.97.98.141
  87.98.137.135
  87.98.143.87
  87.98.148.135
@@ -148950,10 +141643,10 @@
  87.98.157.128
  87.98.167.75
  87.98.177.105
+87.98.177.109
  87.98.177.115
  87.98.178.115
  87.98.182.93
-87.98.183.0
  87.98.185.34
  87.98.190.42
  87.98.218.97
@@ -148962,7 +141655,6 @@
  87.98.222.18
  87.98.222.207
  87.98.228.144
-87.98.241.203
  87.98.241.34
  87.98.253.31
  87.98.37.108
@@ -149040,7 +141732,6 @@
  88.114.86.97
  88.115.153.107
  88.116.146.182
-88.116.209.70
  88.116.6.98
  88.116.81.26
  88.118.131.30
@@ -149063,19 +141754,19 @@
  88.121.24.63
  88.123.169.208
  88.125.69.236
+88.127.108.225
  88.127.73.42
  88.129.208.35
+88.129.208.44
  88.129.208.46
  88.129.208.50
-88.129.21.100
-88.129.235.39
  88.129.235.44
  88.129.238.237
  88.129.253.94
  88.129.44.15
  88.129.82.123
  88.13.9.239
-88.130.134.80
+88.130.53.124
  88.131.253.74
  88.132.194.239
  88.132.194.239bin.sh
@@ -149083,20 +141774,17 @@
  88.132.217.184
  88.132.66.26
  88.134.121.93
-88.134.27.147
-88.135.134.5
  88.135.210.179
  88.135.38.250
  88.135.38.66
  88.135.39.143
+88.135.40.126
  88.135.40.212
  88.135.40.241
  88.135.40.243
  88.135.41.10
-88.135.41.176
-88.135.41.214
-88.135.41.58
  88.135.42.208
+88.135.42.6
  88.135.43.16
  88.135.43.233
  88.135.43.252
@@ -149109,12 +141797,13 @@
  88.135.44.232
  88.135.44.92
  88.135.45.122
-88.135.45.125
+88.135.45.27
+88.135.45.37
  88.135.47.213
  88.135.63.176
  88.136.99.40
-88.138.153.178
  88.138.29.218
+88.14.17.157
  88.14.225.24
  88.145.179.233
  88.146.204.49
@@ -149123,7 +141812,6 @@
  88.147.146.203
  88.147.153.78
  88.147.153.82
-88.147.17.2
  88.147.198.227
  88.147.236.239
  88.147.244.250
@@ -149131,12 +141819,13 @@
  88.147.7.66
  88.147.88.95
  88.147.99.13
+88.148.113.195
+88.148.47.80
  88.149.142.129
+88.149.150.0
  88.149.180.139
  88.149.228.212
-88.149.241.119
  88.149.248.9
-88.15.93.135
  88.150.138.114
  88.150.151.2
  88.150.151.50
@@ -149160,23 +141849,18 @@
  88.151.243.106
  88.151.75.131
  88.152.185.203
-88.152.185.204
  88.152.185.207
-88.152.185.217
-88.152.185.221
+88.152.185.214
  88.152.185.225
  88.152.185.226
  88.152.185.236
  88.152.185.237
-88.152.185.241
-88.152.185.242
-88.152.185.252
+88.152.185.249
  88.152.204.13
  88.152.27.0
  88.153.15.119
  88.153.216.102
  88.153.35.32
-88.155.148.14
  88.156.122.72
  88.156.176.224
  88.156.97.210
@@ -149214,6 +141898,7 @@
  88.198.10.239
  88.198.109.4
  88.198.151.153
+88.198.158.233
  88.198.16.153
  88.198.166.91
  88.198.188.142
@@ -149246,7 +141931,6 @@
  88.198.91.74
  88.198.92.47
  88.199.21.75
-88.199.41.26
  88.199.42.248
  88.199.82.10
  88.199.82.101
@@ -149274,9 +141958,9 @@
  88.202.224.162
  88.202.230.221
  88.203.203.150
-88.204.127.59
  88.204.164.234
  88.204.210.194
+88.204.216.142
  88.204.242.54
  88.204.245.146
  88.205.228.71
@@ -149285,7 +141969,6 @@
  88.206.173.43
  88.206.188.199
  88.207.111.56
-88.207.127.155
  88.208.194.117
  88.208.205.79
  88.208.220.105
@@ -149294,11 +141977,9 @@
  88.208.28.26
  88.208.3.195
  88.208.57.212
-88.208.80.47
  88.208.89.236
  88.208.89.237
  88.208.89.238
-88.209.225.171
  88.21.152.174
  88.210.15.24
  88.212.190.211
@@ -149320,8 +142001,8 @@
  88.215.2.29
  88.216.6.222
  88.217.113.112
-88.217.116.120
  88.217.124.99
+88.217.127.173
  88.217.172.165
  88.217.181.215
  88.218.16.118
@@ -149348,6 +142029,7 @@
  88.218.17.223
  88.218.17.232
  88.218.17.248
+88.218.17.252
  88.218.17.64
  88.218.17.67
  88.218.17.95
@@ -149361,10 +142043,10 @@
  88.218.46.214
  88.218.46.241
  88.218.46.59
+88.218.46.73
+88.218.46.74
  88.218.65.120
  88.218.65.129
-88.218.65.143
-88.218.65.226
  88.218.65.23
  88.218.65.234
  88.218.65.244
@@ -149376,7 +142058,6 @@
  88.218.66.200
  88.218.66.232
  88.218.66.245
-88.218.66.249
  88.218.66.253
  88.218.66.40
  88.218.66.49
@@ -149386,10 +142067,10 @@
  88.218.67.145
  88.218.67.195
  88.218.67.231
+88.218.67.248
  88.218.67.53
  88.218.67.54
  88.218.67.62
-88.218.67.63
  88.218.67.67
  88.218.67.90
  88.218.67.93
@@ -149406,20 +142087,20 @@
  88.225.216.13
  88.225.222.128
  88.225.231.77
-88.226.104.33
  88.226.96.242
  88.227.171.93
  88.227.251.162
  88.228.207.85
  88.229.4.26
-88.230.107.177
  88.231.239.180
  88.231.239.253
  88.231.86.42
  88.232.246.141
+88.234.156.17
  88.234.65.86
  88.236.163.250
  88.236.187.82
+88.237.240.234
  88.24.182.251
  88.243.241.172
  88.244.158.188
@@ -149444,7 +142125,6 @@
  88.247.184.201
  88.247.194.52
  88.247.2.196
-88.247.200.188
  88.247.209.164
  88.247.211.187
  88.247.212.56
@@ -149477,7 +142157,6 @@
  88.249.1.196
  88.249.107.103
  88.249.115.162
-88.249.118.13
  88.249.120.205
  88.249.121.80
  88.249.148.36
@@ -149540,15 +142219,11 @@
  88.44.100.106
  88.6.102.219
  88.65.160.213
-88.68.171.223
  88.7.137.57
  88.71.168.253
-88.71.182.106
+88.71.188.19
  88.71.224.77
  88.73.13.238
-88.73.185.92
-88.73.187.141
-88.76.240.53
  88.78.137.199
  88.78.147.139
  88.79.208.11
@@ -149564,22 +142239,20 @@
  88.80.58.152
  88.81.239.8
  88.82.181.44
-88.82.95.146
  88.83.53.164
  88.83.53.165
  88.83.54.237
  88.84.131.90
  88.84.192.206
  88.84.212.14
+88.84.222.252
  88.84.223.251
-88.85.160.29
  88.85.174.199
  88.85.97.150
  88.86.125.50
  88.86.243.241
  88.87.13.175
  88.87.207.27
-88.87.227.132
  88.87.6.154
  88.87.69.242
  88.87.72.134
@@ -149591,7 +142264,6 @@
  88.87.92.99
  88.88.105.184
  88.88.173.170
-88.88.24.75
  88.88.240.232
  88.88.66.3
  88.88.76.166
@@ -149630,6 +142302,7 @@
  88.99.209.230
  88.99.209.94
  88.99.213.166
+88.99.229.76
  88.99.33.103
  88.99.35.171
  88.99.38.113
@@ -149639,7 +142312,6 @@
  88.99.80.123
  88.99.82.23
  88.99.85.229
-88.99.92.53
  88.99.93.80
  880185.cn
  88033-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -149663,9 +142335,7 @@
  888448a.com
  8885ff.com
  8887812-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-88888888888888888888888888888certificatedpages1292014541112020.advanced-enable-certificated-pages-0636346436624655020.my.id
  8888scents.com
-888ce88888888888888888888888888rtificatedpages1222014541112020.advanced-enable-certificated-pages-0636346436624655020.my.id
  888ghostbaca.com
  888sandmyfloor.net
  888security.ru
@@ -149683,6 +142353,8 @@
  88mscco.com
  89.0.99.104
  89.1.81.210
+89.10.227.63
+89.10.252.229
  89.100.106.42
  89.100.21.40
  89.100.212.137
@@ -149690,6 +142362,7 @@
  89.102.113.31
  89.102.198.78
  89.103.145.182
+89.103.205.146
  89.103.236.146
  89.105.158.245
  89.105.194.236
@@ -149702,6 +142375,7 @@
  89.106.199.150
  89.106.199.38
  89.108.126.228
+89.108.137.237
  89.108.154.123
  89.108.64.184
  89.108.64.216
@@ -149715,6 +142389,7 @@
  89.109.239.93
  89.109.35.231
  89.109.5.127
+89.109.53.22
  89.109.53.65
  89.109.9.164
  89.111.132.132
@@ -149723,12 +142398,11 @@
  89.111.176.102
  89.111.217.191
  89.111.247.142
-89.111.247.181
  89.111.247.218
  89.113.84.51
  89.114.237.38
  89.115.120.43
-89.12.63.180
+89.115.222.177
  89.120.135.53
  89.120.146.186
  89.120.156.28
@@ -149803,11 +142477,8 @@
  89.143.72.1
  89.143.72.200
  89.144.12.17
-89.144.19.252
  89.144.19.90
  89.144.19.93
-89.144.19.95
-89.144.21.210
  89.144.25.172
  89.144.25.19
  89.144.25.20
@@ -149835,7 +142506,6 @@
  89.148.242.12
  89.148.242.169
  89.148.242.25
-89.148.242.51
  89.148.242.86
  89.149.12.188
  89.149.235.45
@@ -149851,7 +142521,6 @@
  89.151.179.170
  89.151.186.46
  89.151.43.232
-89.151.45.157
  89.151.83.58
  89.152.255.213
  89.154.4.249
@@ -149860,7 +142529,6 @@
  89.157.40.103
  89.158.32.44
  89.16.103.241
-89.160.14.136
  89.160.24.135
  89.160.24.174
  89.160.49.80
@@ -149882,10 +142550,8 @@
  89.163.148.93
  89.163.150.32
  89.163.155.202
-89.163.157.202
  89.163.209.26
  89.163.211.40
-89.163.214.109
  89.163.224.143
  89.163.224.187
  89.163.225.112
@@ -149905,9 +142571,7 @@
  89.165.114.222
  89.165.2.239
  89.165.3.29
-89.165.5.27
  89.169.80.26
-89.17.126.109
  89.17.137.136
  89.17.214.91
  89.17.63.184
@@ -149915,7 +142579,6 @@
  89.171.190.107
  89.173.20.134
  89.173.237.42
-89.173.5.15
  89.174.105.118
  89.174.202.35
  89.174.71.111
@@ -149935,24 +142598,26 @@
  89.18.208.150
  89.18.27.192
  89.181.208.61
-89.182.69.42
  89.184.152.198
  89.184.74.45
  89.185.231.103
  89.185.93.190
  89.186.1.212
-89.186.12.32
+89.186.12.6
  89.186.13.110
  89.186.13.84
  89.186.21.109
+89.186.8.166
  89.186.81.169
  89.187.142.208
  89.187.143.31
  89.187.143.81
  89.187.165.177
+89.187.168.132
  89.187.168.142
  89.187.168.147
  89.187.168.148
+89.187.174.198
  89.187.181.71
  89.187.201.70
  89.188.117.71
@@ -149961,6 +142626,7 @@
  89.189.154.66
  89.189.172.88
  89.189.174.121
+89.189.181.161
  89.189.186.45
  89.189.191.51
  89.189.222.150
@@ -149969,6 +142635,7 @@
  89.19.175.117
  89.19.199.152
  89.19.20.202
+89.19.24.146
  89.19.27.90
  89.19.7.152
  89.190.120.116
@@ -149983,13 +142650,12 @@
  89.191.228.79
  89.191.229.169
  89.191.229.182
-89.191.229.232
  89.191.229.238
  89.191.229.28
  89.191.229.54
+89.191.229.78
  89.191.229.92
  89.2.236.32
-89.2.84.126
  89.20.102.136
  89.20.102.139
  89.20.135.204
@@ -149999,9 +142665,9 @@
  89.201.192.179
  89.202.127.4
  89.203.13.6
-89.203.23.223
  89.203.249.239
  89.203.36.32
+89.203.8.62
  89.204.223.205
  89.205.41.202
  89.205.68.83
@@ -150020,13 +142686,14 @@
  89.21.77.158
  89.21.77.162
  89.210.185.78
-89.211.194.244
  89.211.216.72
-89.211.219.101
  89.211.223.6
  89.211.225.142
+89.211.245.233
  89.211.97.133
+89.212.111.51
  89.212.160.214
+89.212.17.133
  89.212.21.32
  89.212.227.136
  89.212.9.96
@@ -150055,9 +142722,8 @@
  89.218.5.108
  89.218.5.110
  89.218.72.51
-89.218.75.211
+89.218.83.122
  89.219.26.226
-89.22.124.195
  89.22.17.62
  89.22.174.150
  89.22.180.208
@@ -150074,7 +142740,6 @@
  89.222.181.58
  89.223.121.91
  89.223.123.170
-89.223.124.120
  89.223.125.140
  89.223.25.83
  89.223.26.91
@@ -150091,7 +142756,6 @@
  89.229.151.58
  89.23.194.174
  89.23.196.60
-89.23.198.13
  89.23.230.189
  89.230.96.42
  89.231.248.86
@@ -150104,8 +142768,9 @@
  89.233.219.180
  89.233.219.46
  89.233.219.93
-89.234.148.243
-89.234.148.69
+89.233.248.164
+89.234.148.183
+89.234.148.93
  89.234.157.254
  89.234.17.115
  89.234.17.116
@@ -150158,26 +142823,26 @@
  89.238.166.139
  89.238.167.44
  89.238.186.230
-89.238.209.226
  89.238.21.169
  89.238.217.146
  89.238.77.110
  89.238.81.138
-89.239.187.190
  89.239.65.140
  89.24.119.126
  89.24.133.114
  89.24.210.10
  89.24.221.82
  89.24.76.185
+89.240.0.182
  89.240.0.63
  89.240.173.230
  89.240.75.177
-89.241.126.247
  89.244.122.53
-89.244.127.28
+89.244.123.90
  89.244.186.233
+89.244.77.205
  89.244.78.126
+89.245.124.151
  89.245.125.178
  89.245.80.165
  89.245.80.30
@@ -150192,12 +142857,11 @@
  89.245.95.30
  89.245.95.44
  89.245.95.76
+89.246.116.113
  89.246.116.115
-89.247.3.168
  89.248.111.164
  89.248.112.202
  89.248.160.132
-89.248.160.135
  89.248.160.139
  89.248.160.150
  89.248.160.178
@@ -150242,7 +142906,6 @@
  89.248.167.193
  89.248.168.112
  89.248.168.127
-89.248.168.140
  89.248.168.152
  89.248.168.157
  89.248.168.171
@@ -150286,6 +142949,7 @@
  89.248.172.196
  89.248.172.20
  89.248.172.200
+89.248.172.208
  89.248.172.232
  89.248.172.48
  89.248.172.53
@@ -150303,7 +142967,6 @@
  89.248.174.46
  89.248.243.200
  89.248.244.182
-89.248.250.12
  89.249.208.211
  89.249.247.209
  89.249.247.216
@@ -150320,13 +142983,12 @@
  89.251.147.97
  89.251.35.178
  89.251.78.233
-89.252.141.251
  89.252.143.70
  89.252.155.228
  89.252.19.66
  89.252.191.154
-89.252.191.172
  89.252.40.18
+89.252.56.54
  89.253.225.14
  89.253.238.126
  89.253.247.144
@@ -150389,7 +143051,6 @@
  89.33.192.70
  89.33.192.71
  89.33.192.72
-89.33.193.195
  89.33.193.197
  89.33.193.198
  89.33.193.199
@@ -150443,16 +143104,14 @@
  89.35.30.117
  89.35.30.124
  89.35.30.139
-89.35.30.149
  89.35.30.158
  89.35.30.164
  89.35.30.177
+89.35.30.2
  89.35.30.202
  89.35.30.242
  89.35.30.46
-89.35.31.135
  89.35.31.46
-89.35.31.8
  89.35.31.90
  89.35.39.115
  89.35.39.204
@@ -150461,7 +143120,6 @@
  89.36.133.62
  89.36.160.112
  89.36.175.10
-89.36.195.238
  89.36.208.231
  89.36.210.121
  89.36.210.156
@@ -150477,15 +143135,15 @@
  89.36.224.8
  89.36.224.9
  89.36.5.160
-89.36.70.49
  89.36.76.105
  89.37.122.216
  89.37.192.194
  89.37.193.44
+89.37.64.139
  89.37.64.220
  89.37.64.35
+89.37.64.68
  89.38.11.16
-89.38.145.14
  89.38.150.129
  89.38.150.159
  89.38.150.220
@@ -150523,9 +143181,12 @@
  89.40.142.176
  89.40.150.239
  89.40.217.40
+89.40.247.173
  89.40.48.186
  89.40.59.234
+89.40.73.216
  89.40.73.225
+89.40.73.236
  89.40.82.236
  89.40.88.224
  89.40.88.228
@@ -150556,9 +143217,8 @@
  89.43.60.117
  89.44.103.58
  89.44.205.112
-89.44.205.149
  89.44.205.188
-89.44.205.4
+89.44.205.239
  89.44.247.141
  89.44.247.232
  89.44.247.30
@@ -150578,11 +143238,12 @@
  89.46.105.196
  89.46.105.197
  89.46.108.165
-89.46.114.181
-89.46.114.70
  89.46.204.81
  89.46.235.111
  89.46.235.242
+89.46.62.143
+89.46.62.64
+89.46.62.86
  89.46.80.135
  89.46.82.5
  89.46.86.183
@@ -150596,11 +143257,11 @@
  89.65.44.144
  89.66.173.101
  89.67.0.87
+89.67.77.39
  89.68.130.136
  89.69.179.180
  89.7.152.241
  89.72.212.205
-89.72.216.89
  89.73.123.32
  89.73.224.190
  89.75.158.41
@@ -150609,7 +143270,6 @@
  89.79.48.213
  89.80.42.48
  89.83.107.233
-89.85.5.51
  89.88.121.234
  89.89.5.129
  89.9.92.243
@@ -150723,14 +143383,12 @@
  9-35.xyz
  9-more.com
  90.0.0.247
-90.103.18.205
  90.103.28.177
  90.104.116.167
-90.105.105.201
-90.108.125.49
+90.104.241.224
  90.109.197.166
  90.109.27.115
-90.112.165.128
+90.112.163.178
  90.113.165.82
  90.116.139.42
  90.118.116.250
@@ -150759,7 +143417,6 @@
  90.146.219.186
  90.15.234.16
  90.15.29.43
-90.15.42.73
  90.15.8.97
  90.150.198.138
  90.150.198.159
@@ -150778,13 +143435,11 @@
  90.150.201.35
  90.150.202.201
  90.150.202.215
-90.150.202.52
  90.150.202.81
  90.150.205.212
  90.150.206.127
  90.150.206.38
  90.150.52.45
-90.150.81.2
  90.150.87.125
  90.150.87.79
  90.150.90.116
@@ -150807,17 +143462,16 @@
  90.164.252.107
  90.168.34.229
  90.170.20.2
+90.170.59.154
  90.171.35.83
  90.173.248.78
  90.173.78.53
  90.174.182.214
-90.174.217.106
  90.175.166.85
  90.176.150.123
  90.177.191.78
  90.177.244.100
  90.177.86.130
-90.178.102.136
  90.178.175.66
  90.179.3.49
  90.180.12.4
@@ -150826,7 +143480,6 @@
  90.182.165.18
  90.182.36.30
  90.183.101.238
-90.183.152.12
  90.183.152.178
  90.183.158.50
  90.185.249.111
@@ -150835,19 +143488,14 @@
  90.188.10.59
  90.188.21.217
  90.188.236.43
-90.188.239.254
  90.188.255.142
  90.188.35.190
  90.188.35.23
  90.188.42.221
-90.189.110.170
-90.189.116.152
-90.189.117.121
  90.189.147.221
  90.189.162.248
  90.189.164.232
  90.189.172.54
-90.189.188.218
  90.189.205.83
  90.189.209.144
  90.190.221.7
@@ -150858,6 +143506,7 @@
  90.202.166.148
  90.204.41.78
  90.206.169.234
+90.206.172.157
  90.206.23.95
  90.208.97.104
  90.209.9.28
@@ -150877,12 +143526,14 @@
  90.224.81.216
  90.226.231.19
  90.226.40.204
+90.227.1.125
  90.227.130.6
  90.227.184.2
  90.228.237.44
  90.230.21.243
  90.231.155.253
  90.231.156.76
+90.231.81.74
  90.232.12.186
  90.232.162.129
  90.232.174.156
@@ -150909,26 +143560,25 @@
  90.50.171.92
  90.51.18.170
  90.51.20.22
-90.53.68.47
+90.54.207.253
  90.59.147.165
-90.59.98.217
  90.62.191.95
  90.62.211.212
  90.63.247.164
  90.63.250.131
  90.63.69.90
+90.64.38.218
  90.65.111.230
  90.66.117.141
-90.66.125.143
-90.66.87.27
+90.66.148.239
  90.71.169.95
  90.71.38.63
+90.73.38.79
  90.74.52.246
  90.75.209.16
  90.76.107.69
  90.76.59.11
  90.8.124.126
-90.8.253.128
  90.8.62.159
  90.80.102.209
  90.84.226.16
@@ -150982,7 +143632,6 @@
  91.103.25.74
  91.103.27.66
  91.103.31.45
-91.105.112.115
  91.105.13.35
  91.105.135.113
  91.105.135.181
@@ -150993,6 +143642,7 @@
  91.105.232.120
  91.105.236.20
  91.105.237.46
+91.105.238.94
  91.105.239.11
  91.105.94.200
  91.106.131.90
@@ -151000,23 +143650,23 @@
  91.106.193.72
  91.106.199.101
  91.107.10.69
+91.107.5.216
  91.107.87.127
-91.108.137.238
-91.108.145.70
  91.108.151.142
-91.108.151.43
  91.108.156.131
-91.108.156.173
  91.108.178.222
  91.108.178.77
  91.108.183.170
+91.108.45.229
  91.109.13.108
+91.109.136.83
  91.109.15.52
  91.109.26.72
  91.109.3.188
  91.109.5.170
  91.112.219.44
  91.114.240.126
+91.115.198.252
  91.115.214.39
  91.117.218.56
  91.117.31.181
@@ -151029,6 +143679,7 @@
  91.121.105.125
  91.121.106.15
  91.121.106.225
+91.121.108.164
  91.121.108.5
  91.121.109.45
  91.121.109.55
@@ -151121,6 +143772,7 @@
  91.121.67.119
  91.121.67.146
  91.121.67.151
+91.121.68.60
  91.121.70.43
  91.121.74.44
  91.121.75.27
@@ -151138,9 +143790,11 @@
  91.121.84.66
  91.121.86.22
  91.121.86.38
+91.121.86.61
  91.121.88.158
  91.121.88.225
  91.121.89.135
+91.121.89.189
  91.121.89.20
  91.121.89.60
  91.121.9.61
@@ -151151,26 +143805,31 @@
  91.122.128.101
  91.122.137.170
  91.122.137.210
+91.122.14.224
  91.122.193.80
  91.122.46.120
+91.122.50.245
  91.122.52.63
  91.122.61.161
  91.123.166.111
  91.123.166.87
+91.123.30.232
  91.124.160.226
  91.124.162.195
-91.124.163.177
  91.124.172.134
  91.125.212.60
+91.125.34.9
  91.126.18.130
  91.126.200.53
-91.126.206.51
+91.126.207.114
  91.126.234.159
  91.126.244.210
  91.126.45.232
  91.126.67.237
  91.127.149.244
+91.128.87.80
  91.13.89.122
+91.131.193.59
  91.131.193.81
  91.131.196.192
  91.131.197.155
@@ -151181,6 +143840,8 @@
  91.132.138.62
  91.132.147.168
  91.132.197.21
+91.132.197.43
+91.132.60.245
  91.134.13.250
  91.134.133.251
  91.134.135.95
@@ -151211,16 +143872,17 @@
  91.134.185.93
  91.134.185.94
  91.134.185.95
-91.134.201.164
  91.134.207.16
  91.134.209.116
  91.134.214.222
  91.134.214.33
+91.134.216.25
  91.134.221.168
  91.134.231.96
  91.134.232.63
  91.134.240.130
  91.134.242.199
+91.134.248.230
  91.134.248.235
  91.134.248.249
  91.134.248.253
@@ -151231,18 +143893,19 @@
  91.135.101.228
  91.135.193.146
  91.135.194.22
+91.135.201.122
  91.135.242.203
  91.135.63.95
  91.136.48.27
  91.137.127.123
  91.137.140.89
-91.137.251.197
  91.137.251.31
  91.138.215.5
  91.139.1.158
  91.139.140.18
  91.139.225.200
  91.14.210.114
+91.14.44.31
  91.140.11.54
  91.140.167.32
  91.142.174.224
@@ -151261,16 +143924,12 @@
  91.144.20.198
  91.144.21.15
  91.144.21.200
-91.144.212.83
  91.144.218.61
  91.144.249.132
  91.144.30.132
  91.144.30.172
  91.144.82.6
-91.144.83.42
-91.145.237.255
  91.145.41.23
-91.145.41.5
  91.145.54.163
  91.146.121.3
  91.147.128.123
@@ -151284,7 +143943,6 @@
  91.148.180.245
  91.149.157.145
  91.15.112.81
-91.15.239.222
  91.15.75.156
  91.15.75.77
  91.15.76.169
@@ -151310,8 +143968,6 @@
  91.163.206.48
  91.163.27.221
  91.163.6.199
-91.164.40.78
-91.166.93.32
  91.168.145.151
  91.169.100.84
  91.170.12.3
@@ -151319,8 +143975,6 @@
  91.170.71.173
  91.172.62.9
  91.173.165.153
-91.174.108.245
-91.174.162.196
  91.174.213.39
  91.174.80.149
  91.175.129.61
@@ -151328,6 +143982,7 @@
  91.175.181.196
  91.179.33.55
  91.179.53.221
+91.18.245.106
  91.181.235.31
  91.181.40.39
  91.183.215.121
@@ -151343,7 +143998,6 @@
  91.185.216.4
  91.185.226.136
  91.185.236.236
-91.185.236.239
  91.185.236.24
  91.185.36.26
  91.185.40.183
@@ -151358,11 +144012,11 @@
  91.187.119.118
  91.187.78.57
  91.187.80.246
-91.187.90.205
  91.188.108.222
  91.188.112.61
  91.188.112.64
  91.188.117.157
+91.188.117.198
  91.188.124.225
  91.188.124.232
  91.188.229.129
@@ -151370,6 +144024,7 @@
  91.188.246.184
  91.188.246.191
  91.188.246.49
+91.188.246.51
  91.188.246.56
  91.188.246.76
  91.188.246.77
@@ -151379,6 +144034,7 @@
  91.188.247.11
  91.188.247.113
  91.188.247.118
+91.188.247.133
  91.188.247.174
  91.188.247.187
  91.188.247.190
@@ -151402,6 +144058,7 @@
  91.189.201.70
  91.189.242.131
  91.189.47.155
+91.19.162.66
  91.190.138.85
  91.191.148.9
  91.191.173.120
@@ -151424,6 +144081,7 @@
  91.192.135.69
  91.192.136.43
  91.192.139.65
+91.192.168.32
  91.192.195.131
  91.192.2.168
  91.192.20.164
@@ -151455,7 +144113,7 @@
  91.195.156.41
  91.195.192.38
  91.195.254.46
-91.195.255.228
+91.195.98.186
  91.196.100.35
  91.196.100.93
  91.196.132.166
@@ -151471,15 +144129,12 @@
  91.197.17.249
  91.197.174.16
  91.197.205.16
-91.197.224.177
  91.197.44.133
  91.198.108.220
  91.198.164.24
  91.198.220.225
  91.199.118.137
  91.2.173.53
-91.200.103.193
-91.200.103.217
  91.200.114.243
  91.200.12.58
  91.200.12.76
@@ -151494,6 +144149,7 @@
  91.201.188.240
  91.201.240.101
  91.201.255.50
+91.201.88.164
  91.202.133.201
  91.202.133.75
  91.202.144.153
@@ -151504,7 +144160,6 @@
  91.203.138.100
  91.203.145.116
  91.203.146.126
-91.203.176.204
  91.203.192.72
  91.203.208.174
  91.203.224.177
@@ -151521,11 +144176,12 @@
  91.204.14.134
  91.204.14.135
  91.204.14.179
+91.204.14.231
  91.204.149.250
  91.204.149.5
  91.204.15.135
-91.204.15.151
-91.204.15.217
+91.204.15.206
+91.204.15.209
  91.204.15.82
  91.204.163.19
  91.204.199.73
@@ -151535,10 +144191,12 @@
  91.204.250.51
  91.204.250.61
  91.205.123.185
+91.205.128.65
  91.205.130.129
  91.205.131.110
  91.205.131.55
  91.205.146.25
+91.205.167.226
  91.205.168.32
  91.205.168.34
  91.205.168.36
@@ -151573,6 +144231,7 @@
  91.207.238.127
  91.207.244.212
  91.207.5.102
+91.207.52.104
  91.207.7.124
  91.208.184.110
  91.208.184.117
@@ -151598,13 +144257,13 @@
  91.210.147.131
  91.210.147.47
  91.210.178.161
-91.210.224.109
  91.210.224.123
  91.210.224.154
  91.210.224.21
  91.210.237.71
  91.210.24.30
  91.210.47.85
+91.210.81.182
  91.211.105.92
  91.211.124.217
  91.211.146.202
@@ -151615,11 +144274,14 @@
  91.211.250.208
  91.211.251.127
  91.211.251.22
+91.211.251.226
  91.211.251.42
+91.211.251.75
+91.211.251.76
  91.211.3.110
  91.211.3.111
+91.211.46.64
  91.211.48.180
-91.211.48.195
  91.211.48.213
  91.211.88.113
  91.211.88.52
@@ -151627,7 +144289,6 @@
  91.212.124.160
  91.212.127.100
  91.212.150.241
-91.212.153.5
  91.213.100.68
  91.213.119.246
  91.213.197.15
@@ -151658,7 +144319,6 @@
  91.213.84.56
  91.213.84.60
  91.213.84.9
-91.214.114.41
  91.214.114.7
  91.214.115.100
  91.214.130.253
@@ -151667,16 +144327,18 @@
  91.214.31.234
  91.214.55.65
  91.214.64.173
+91.214.70.63
  91.215.145.31
-91.215.170.24
  91.215.187.35
  91.215.195.143
  91.215.216.13
  91.215.232.33
  91.215.25.103
+91.215.68.60
  91.215.79.23
  91.215.91.254
  91.216.149.28
+91.216.164.251
  91.216.190.14
  91.216.190.152
  91.216.190.209
@@ -151708,11 +144370,9 @@
  91.218.163.74
  91.218.19.106
  91.218.195.187
-91.218.202.22
  91.218.241.68
  91.218.47.161
-91.218.67.103
-91.218.86.194
+91.218.65.102
  91.218.88.128
  91.219.171.97
  91.219.200.122
@@ -151730,8 +144390,8 @@
  91.219.239.188
  91.219.25.232
  91.219.253.115
-91.219.253.42
  91.219.4.151
+91.219.58.18
  91.219.88.121
  91.219.90.198
  91.220.163.21
@@ -151749,6 +144409,7 @@
  91.222.171.246
  91.222.196.82
  91.222.223.240
+91.222.236.185
  91.222.236.19
  91.222.236.249
  91.222.236.253
@@ -151768,8 +144429,8 @@
  91.224.87.138
  91.224.97.111
  91.224.97.119
-91.224.98.206
  91.225.111.150
+91.225.158.77
  91.225.163.155
  91.225.190.77
  91.225.208.83
@@ -151788,12 +144449,10 @@
  91.226.213.133
  91.226.252.238
  91.226.253.160
-91.226.35.93
  91.226.45.66
  91.226.5.245
  91.226.72.252
  91.227.112.196
-91.227.12.20
  91.227.122.167
  91.227.18.122
  91.227.220.149
@@ -151809,7 +144468,6 @@
  91.228.85.136
  91.228.85.197
  91.228.85.45
-91.228.86.112
  91.228.86.166
  91.228.86.236
  91.228.86.64
@@ -151820,12 +144478,12 @@
  91.228.87.54
  91.229.112.16
  91.229.112.17
-91.229.165.141
  91.229.23.64
  91.229.233.100
  91.229.77.64
  91.229.78.76
  91.229.79.152
+91.23.144.102
  91.23.158.74
  91.230.138.11
  91.230.146.73
@@ -151851,7 +144509,6 @@
  91.232.162.31
  91.232.165.112
  91.232.197.100
-91.232.217.160
  91.232.4.149
  91.233.158.36
  91.233.190.198
@@ -151872,6 +144529,7 @@
  91.234.60.94
  91.234.62.16
  91.234.62.164
+91.234.62.165
  91.234.62.17
  91.234.62.174
  91.234.62.18
@@ -151894,7 +144552,6 @@
  91.234.99.193
  91.234.99.203
  91.234.99.234
-91.235.0.64
  91.235.129.159
  91.235.129.180
  91.235.142.214
@@ -151922,7 +144579,6 @@
  91.236.6.11
  91.236.61.166
  91.236.7.126
-91.236.71.185
  91.236.74.121
  91.237.111.19
  91.237.121.11
@@ -151938,14 +144594,15 @@
  91.237.61.15
  91.237.69.17
  91.237.73.68
+91.237.73.74
  91.237.77.5
  91.237.94.12
  91.238.134.99
  91.238.161.3
-91.238.166.132
+91.238.166.136
  91.238.199.1
  91.238.223.41
-91.238.244.37
+91.238.223.42
  91.238.255.71
  91.239.136.166
  91.239.158.22
@@ -151957,7 +144614,6 @@
  91.239.85.86
  91.240.125.80
  91.240.13.226
-91.240.132.39
  91.240.193.56
  91.240.209.105
  91.240.54.254
@@ -151971,17 +144627,15 @@
  91.241.109.47
  91.241.182.78
  91.241.19.223
-91.241.19.244
  91.241.19.42
-91.241.19.59
  91.241.194.245
  91.241.20.246
+91.241.250.69
  91.241.59.47
  91.242.136.103
  91.242.161.167
  91.242.77.60
  91.243.100.112
-91.243.101.25
  91.243.162.166
  91.243.168.119
  91.243.175.249
@@ -151990,7 +144644,6 @@
  91.243.80.38
  91.243.81.189
  91.243.89.107
-91.243.89.136
  91.243.89.17
  91.243.89.172
  91.243.89.176
@@ -152016,8 +144669,6 @@
  91.243.92.225
  91.243.92.32
  91.243.92.44
-91.243.92.53
-91.243.92.65
  91.243.92.73
  91.243.93.180
  91.243.93.188
@@ -152026,7 +144677,6 @@
  91.243.94.111
  91.243.94.112
  91.243.94.129
-91.243.94.133
  91.243.94.170
  91.243.94.221
  91.243.94.252
@@ -152035,20 +144685,20 @@
  91.243.94.64
  91.244.137.203
  91.244.139.93
-91.244.140.203
  91.244.140.93
  91.244.181.85
  91.244.217.177
  91.244.253.103
  91.244.253.66
  91.244.73.243
-91.244.76.199
  91.244.78.50
  91.245.109.75
  91.245.114.33
+91.245.34.95
  91.245.85.130
  91.246.213.100
  91.246.213.104
+91.246.71.88
  91.246.74.202
  91.247.250.215
  91.247.39.245
@@ -152059,27 +144709,28 @@
  91.250.6.108
  91.250.83.53
  91.3.126.183
-91.3.73.151
+91.3.72.225
  91.3.75.205
-91.34.64.47
-91.35.17.124
+91.34.71.28
  91.37.223.62
+91.38.78.75
  91.42.219.125
  91.44.225.23
-91.45.97.118
+91.46.155.121
  91.46.47.216
-91.48.95.44
+91.5.108.109
  91.5.122.131
-91.5.171.198
  91.5.174.174
  91.50.246.75
+91.51.236.188
  91.57.133.43
  91.63.17.107
-91.64.117.11
  91.64.139.161
  91.64.49.192
+91.65.190.81
  91.65.219.105
  91.65.242.22
+91.65.242.24
  91.65.70.241
  91.67.148.206
  91.67.240.32
@@ -152092,41 +144743,40 @@
  91.73.174.126
  91.73.174.78
  91.73.197.90
-91.73.89.213
  91.74.129.82
  91.74.26.196
  91.75.177.113
  91.75.177.114
  91.75.75.46
-91.76.163.236
-91.76.185.181
  91.77.141.146
  91.77.160.195
  91.77.165.170
  91.77.166.52
  91.77.168.231
+91.78.77.187
  91.78.98.218
  91.79.48.119
  91.8.16.121
-91.8.19.154
  91.80.137.202
  91.80.140.9
  91.80.153.150
+91.80.6.248
  91.82.40.118
  91.82.41.200
  91.82.42.2
  91.82.46.25
  91.82.85.85
  91.83.160.107
-91.83.161.145
  91.83.161.181
  91.83.162.129
  91.83.162.176
+91.83.162.203
  91.83.163.184
-91.83.227.193
+91.83.227.150
  91.83.227.194
  91.83.227.254
  91.83.227.7
+91.83.227.76
  91.83.3.31
  91.83.88.201
  91.83.88.53
@@ -152136,12 +144786,12 @@
  91.83.93.124
  91.86.83.129
  91.87.123.173
+91.89.196.200
  91.9.194.46
  91.90.114.186
  91.90.190.194
  91.90.36.174
  91.90.39.182
-91.91.46.33
  91.92.109.43
  91.92.115.210
  91.92.133.32
@@ -152169,11 +144819,9 @@
  91.93.69.211
  91.93.73.148
  91.93.97.106
-91.97.206.10
  91.98.108.189
  91.98.157.87
  91.98.171.216
-91.98.250.179
  91.98.26.62
  91.98.28.188
  91.98.32.223
@@ -152189,8 +144837,6 @@
  91.98.64.222
  91.98.68.49
  91.98.88.193
-91.99.120.155
-91.99.214.83
  910-365.com
  91131994de4.xyz
  911718.net
@@ -152224,7 +144870,6 @@
  92.1.195.95
  92.10.217.28
  92.10.226.197
-92.100.156.249
  92.101.61.80
  92.101.92.69
  92.103.168.50
@@ -152233,6 +144878,7 @@
  92.105.208.127
  92.105.22.126
  92.105.61.210
+92.106.102.227
  92.106.143.52
  92.106.7.62
  92.107.154.228
@@ -152241,9 +144887,9 @@
  92.108.241.58
  92.108.241.61
  92.109.224.63
-92.110.58.125
  92.111.126.154
  92.111.156.14
+92.111.178.114
  92.112.119.86
  92.112.240.138
  92.112.245.7
@@ -152251,24 +144897,22 @@
  92.113.144.212
  92.113.199.114
  92.113.82.230
-92.114.117.73
  92.114.16.108
  92.114.18.12
  92.114.194.160
  92.114.35.161
  92.114.75.210
  92.114.82.197
-92.115.102.133
  92.115.134.57
  92.116.15.42
-92.116.160.34
  92.116.163.244
-92.116.33.112
+92.116.177.104
+92.116.5.62
+92.117.102.178
  92.117.148.8
  92.117.151.110
-92.117.234.133
+92.117.247.221
  92.117.47.205
-92.117.56.249
  92.118.149.91
  92.118.160.1
  92.118.160.13
@@ -152307,12 +144951,7 @@
  92.118.208.143
  92.118.208.150
  92.118.208.196
-92.118.208.218
-92.118.208.63
-92.118.209.113
-92.118.209.23
  92.118.211.109
-92.118.211.15
  92.118.211.161
  92.118.211.192
  92.118.211.204
@@ -152322,6 +144961,7 @@
  92.118.211.44
  92.118.27.173
  92.118.52.58
+92.118.63.198
  92.119.112.226
  92.119.112.62
  92.119.115.94
@@ -152336,6 +144976,10 @@
  92.124.162.19
  92.124.162.48
  92.124.198.170
+92.125.137.176
+92.127.223.25
+92.127.226.133
+92.127.229.61
  92.130.196.17
  92.130.50.188
  92.131.208.136
@@ -152346,11 +144990,10 @@
  92.150.9.141
  92.151.79.102
  92.152.106.155
-92.152.2.147
  92.154.54.87
  92.154.60.172
  92.154.95.236
-92.161.88.67
+92.158.214.116
  92.169.84.253
  92.170.221.168
  92.170.38.177
@@ -152360,63 +145003,45 @@
  92.175.229.4
  92.176.203.8
  92.177.112.167
-92.182.44.5
-92.184.102.111
-92.184.102.165
-92.184.102.185
-92.184.102.197
-92.184.102.223
-92.184.102.225
-92.184.102.227
+92.18.60.183
+92.182.24.14
+92.184.102.115
+92.184.102.129
+92.184.102.199
+92.184.102.254
  92.184.102.39
  92.184.102.55
-92.184.102.73
+92.184.102.59
  92.184.104.160
+92.184.104.54
  92.184.108.200
  92.184.108.203
-92.184.108.22
  92.184.108.98
  92.184.110.247
  92.184.110.98
-92.184.112.10
-92.184.112.105
-92.184.112.109
  92.184.112.11
-92.184.112.114
+92.184.112.110
+92.184.112.116
  92.184.112.121
-92.184.112.150
-92.184.112.158
  92.184.112.163
-92.184.112.164
-92.184.112.166
-92.184.112.168
-92.184.112.184
-92.184.112.20
-92.184.112.206
-92.184.112.216
-92.184.112.225
-92.184.112.23
+92.184.112.22
+92.184.112.226
+92.184.112.228
  92.184.112.230
-92.184.112.242
-92.184.112.247
-92.184.112.248
  92.184.112.25
-92.184.112.33
  92.184.112.42
  92.184.112.46
-92.184.112.59
  92.184.112.6
-92.184.112.79
-92.184.112.88
+92.184.112.85
  92.184.112.9
  92.184.112.91
-92.184.112.94
-92.184.116.148
+92.184.116.151
  92.184.116.172
-92.184.116.23
-92.184.117.140
-92.184.97.105
+92.184.117.145
+92.184.124.120
+92.184.124.212
  92.184.98.219
+92.184.98.243
  92.185.96.97
  92.187.228.47
  92.19.185.35
@@ -152426,11 +145051,12 @@
  92.190.153.246
  92.190.182.62
  92.192.15.200
-92.192.54.233
-92.193.174.254
+92.192.99.217
+92.193.170.20
+92.193.231.76
  92.193.248.205
-92.194.121.174
  92.194.48.23
+92.194.73.129
  92.195.111.223
  92.195.83.3
  92.2.81.153
@@ -152441,9 +145067,11 @@
  92.20.74.204
  92.20.8.10
  92.20.86.49
+92.200.47.77
  92.204.128.148
  92.204.160.150
  92.204.163.231
+92.204.163.233
  92.204.163.66
  92.204.168.195
  92.204.171.210
@@ -152468,8 +145096,7 @@
  92.219.48.156
  92.22.81.200
  92.220.112.251
-92.220.113.88
-92.220.133.181
+92.220.163.15
  92.220.203.40
  92.220.61.122
  92.221.166.189
@@ -152494,10 +145121,10 @@
  92.222.208.174
  92.222.211.47
  92.222.221.49
-92.222.235.174
  92.222.28.243
  92.222.64.195
  92.222.66.234
+92.222.70.236
  92.222.71.173
  92.222.74.255
  92.222.75.41
@@ -152523,17 +145150,18 @@
  92.222.93.227
  92.222.94.117
  92.223.105.133
-92.223.109.147
-92.223.109.148
  92.223.109.150
  92.223.109.151
-92.223.109.154
-92.223.65.142
-92.223.65.143
+92.223.109.156
+92.223.109.157
+92.223.109.158
+92.223.109.171
  92.223.65.145
  92.223.65.147
  92.223.65.156
  92.223.65.158
+92.223.87.31
+92.223.89.138
  92.223.89.151
  92.223.89.6
  92.223.93.145
@@ -152570,6 +145198,8 @@
  92.242.126.154
  92.242.207.18
  92.242.220.5
+92.242.220.91
+92.242.220.93
  92.242.234.19
  92.242.240.34
  92.242.243.164
@@ -152586,12 +145216,13 @@
  92.243.15.162
  92.243.21.182
  92.243.84.187
+92.244.2.237
  92.244.36.73
  92.244.99.229
  92.245.175.165
  92.245.6.160
+92.246.16.39
  92.246.187.253
-92.246.20.200
  92.246.22.214
  92.246.243.163
  92.246.76.202
@@ -152661,11 +145292,11 @@
  92.253.16.235
  92.253.17.12
  92.253.204.200
-92.253.21.2
  92.253.239.242
  92.253.250.71
  92.253.37.70
  92.253.69.221
+92.253.73.241
  92.253.8.132
  92.253.84.108
  92.254.140.12
@@ -152713,6 +145344,7 @@
  92.35.108.183
  92.35.235.164
  92.35.4.23
+92.35.71.42
  92.38.136.69
  92.38.163.44
  92.38.225.177
@@ -152732,10 +145364,10 @@
  92.42.37.141
  92.42.47.188
  92.42.8.20
-92.42.8.5
  92.43.187.34
  92.43.20.29
  92.43.29.162
+92.44.119.53
  92.44.6.91
  92.45.165.20
  92.45.19.5
@@ -152780,6 +145412,7 @@
  92.53.103.158
  92.53.111.240
  92.53.119.193
+92.53.45.211
  92.53.64.203
  92.53.65.130
  92.53.65.40
@@ -152816,6 +145449,7 @@
  92.60.224.56
  92.61.102.252
  92.61.114.103
+92.61.191.119
  92.62.112.130
  92.62.131.106
  92.62.139.103
@@ -152864,25 +145498,26 @@
  92.70.243.58
  92.74.195.155
  92.74.40.220
-92.75.163.251
+92.76.166.113
  92.79.100.106
  92.79.91.147
  92.8.129.228
  92.8.84.191
  92.8.85.159
+92.80.110.47
  92.80.217.82
  92.81.10.94
  92.81.117.206
  92.81.119.26
  92.81.178.90
  92.81.19.48
-92.81.21.110
  92.81.23.31
  92.81.76.19
  92.81.94.146
  92.82.198.253
  92.82.208.71
  92.82.216.249
+92.82.75.189
  92.83.0.82
  92.83.174.70
  92.83.223.158
@@ -152890,7 +145525,6 @@
  92.85.150.203
  92.85.169.16
  92.85.21.46
-92.85.216.59
  92.85.34.30
  92.85.44.90
  92.86.10.42
@@ -152962,7 +145596,6 @@
  93.104.213.162
  93.104.213.231
  93.105.155.169
-93.107.155.138
  93.107.187.162
  93.107.43.251
  93.108.242.140
@@ -152992,13 +145625,11 @@
  93.114.82.21
  93.114.86.226
  93.115.0.103
-93.115.0.124
  93.115.0.130
  93.115.0.198
  93.115.0.215
  93.115.0.4
  93.115.1.195
-93.115.106.19
  93.115.138.250
  93.115.20.130
  93.115.240.26
@@ -153023,7 +145654,9 @@
  93.116.57.4
  93.117.174.151
  93.117.72.27
+93.118.100.97
  93.118.102.208
+93.118.112.244
  93.118.112.34
  93.118.115.77
  93.118.32.141
@@ -153031,14 +145664,13 @@
  93.118.74.237
  93.118.98.56
  93.119.106.179
-93.119.107.240
  93.119.123.233
  93.119.161.92
  93.119.164.33
  93.119.181.146
  93.119.205.5
  93.119.39.192
-93.119.66.156
+93.12.66.98
  93.121.142.217
  93.122.192.117
  93.122.192.214
@@ -153058,6 +145690,7 @@
  93.123.96.141
  93.124.125.4
  93.124.40.170
+93.124.50.73
  93.124.57.13
  93.125.101.10
  93.125.109.16
@@ -153073,6 +145706,7 @@
  93.126.21.49
  93.126.25.33
  93.126.25.34
+93.126.28.88
  93.126.60.99
  93.126.73.213
  93.126.84.38
@@ -153081,26 +145715,25 @@
  93.127.145.162
  93.127.145.40
  93.127.55.44
-93.133.173.102
  93.136.40.241
-93.138.31.215
+93.138.157.141
  93.139.128.141
  93.139.143.191
  93.139.173.80
  93.14.78.71
+93.140.62.37
  93.140.74.25
-93.142.124.161
+93.142.186.89
  93.142.201.222
  93.142.206.154
+93.142.212.0
  93.142.228.31
  93.142.240.146
  93.142.245.124
  93.142.246.165
  93.143.34.46
  93.143.53.167
-93.143.68.197
-93.144.114.249
-93.144.155.211
+93.144.122.236
  93.144.160.252
  93.144.211.236
  93.144.221.23
@@ -153122,26 +145755,24 @@
  93.148.22.156
  93.148.231.30
  93.148.249.77
-93.148.254.112
  93.148.254.87
  93.148.88.202
  93.149.12.2
  93.149.158.158
  93.149.208.70
  93.149.233.109
+93.149.50.38
  93.149.79.247
  93.15.13.198
  93.15.159.159
  93.15.41.61
  93.150.176.157
  93.150.222.153
-93.150.43.188
  93.150.84.161
  93.151.177.159
  93.151.179.67
  93.151.220.213
  93.152.139.99
-93.152.140.51
  93.152.158.132
  93.152.159.11
  93.153.173.99
@@ -153155,7 +145786,6 @@
  93.157.153.134
  93.157.163.66
  93.157.193.18
-93.157.236.119
  93.157.62.102
  93.157.62.58
  93.158.211.196
@@ -153164,7 +145794,6 @@
  93.158.228.230
  93.158.231.175
  93.158.73.127
-93.158.84.110
  93.158.85.35
  93.159.158.85
  93.159.184.226
@@ -153172,12 +145801,12 @@
  93.159.221.58
  93.163.176.183
  93.163.52.152
-93.168.116.222
-93.169.89.72
+93.168.169.198
  93.170.103.109
  93.170.113.159
  93.170.119.69
  93.170.119.71
+93.170.124.251
  93.170.129.150
  93.170.13.7
  93.170.187.173
@@ -153258,14 +145887,12 @@
  93.176.84.45
  93.177.103.136
  93.177.116.143
-93.177.116.15
  93.177.116.195
  93.177.116.21
  93.177.116.225
  93.177.116.238
  93.177.116.59
  93.177.116.75
-93.177.116.81
  93.177.117.101
  93.177.117.130
  93.177.117.150
@@ -153278,10 +145905,10 @@
  93.177.117.77
  93.177.117.98
  93.177.118.38
+93.177.119.138
  93.177.119.151
  93.177.119.21
-93.177.127.11
-93.177.127.110
+93.177.119.28
  93.177.237.104
  93.177.82.226
  93.178.15.63
@@ -153289,7 +145916,6 @@
  93.178.71.232
  93.179.102.31
  93.179.197.152
-93.179.202.79
  93.179.66.113
  93.180.157.61
  93.180.178.213
@@ -153326,8 +145952,6 @@
  93.186.254.240
  93.187.182.176
  93.187.200.218
-93.187.33.26
-93.187.33.28
  93.188.161.145
  93.188.164.193
  93.188.164.198
@@ -153338,14 +145962,12 @@
  93.189.127.128
  93.189.127.250
  93.189.127.90
-93.189.145.169
+93.189.147.33
  93.189.221.253
  93.189.29.75
  93.189.30.194
  93.189.35.16
-93.189.42.39
  93.189.43.3
-93.189.95.190
  93.190.107.148
  93.190.138.136
  93.190.138.3
@@ -153365,19 +145987,19 @@
  93.190.95.214
  93.191.114.183
  93.191.20.34
-93.191.40.33
-93.192.186.184
+93.195.202.205
  93.196.103.122
  93.197.102.178
-93.197.34.170
  93.2.210.101
-93.201.116.231
+93.201.115.215
+93.201.119.163
  93.201.124.93
  93.201.236.52
  93.209.179.173
+93.209.186.221
  93.21.101.4
  93.21.224.154
-93.210.16.63
+93.210.15.126
  93.214.122.25
  93.219.113.201
  93.22.37.164
@@ -153391,23 +146013,20 @@
  93.228.9.224
  93.23.196.55
  93.230.143.208
-93.230.157.253
+93.231.2.159
  93.234.221.223
-93.234.254.103
+93.236.51.145
  93.241.228.102
  93.242.218.76
-93.245.242.25
  93.25.118.228
  93.25.179.36
  93.27.205.105
  93.29.187.145
  93.29.43.226
-93.29.44.94
-93.31.12.115
  93.33.192.204
  93.34.12.15
+93.34.147.89
  93.34.236.88
-93.34.237.230
  93.34.238.61
  93.35.186.155
  93.35.225.23
@@ -153440,12 +146059,13 @@
  93.42.196.218
  93.42.224.202
  93.42.249.235
-93.42.7.100
+93.42.71.176
  93.42.79.64
  93.43.193.42
  93.43.22.148
  93.43.223.61
  93.43.231.1
+93.43.35.161
  93.46.101.20
  93.46.167.60
  93.46.218.89
@@ -153471,12 +146091,12 @@
  93.51.247.104
  93.51.29.92
  93.51.49.210
+93.51.67.87
  93.55.137.209
  93.55.210.172
  93.55.211.209
  93.55.242.131
  93.56.109.163
-93.56.16.241
  93.56.206.214
  93.56.38.154
  93.56.87.123
@@ -153489,7 +146109,6 @@
  93.61.108.20
  93.61.134.60
  93.61.137.226
-93.61.73.166
  93.61.76.73
  93.63.167.100
  93.63.173.228
@@ -153512,10 +146131,10 @@
  93.70.136.152
  93.70.137.16
  93.70.247.76
-93.70.45.138
  93.71.143.237
  93.71.206.35
-93.71.255.37
+93.71.207.223
+93.71.33.192
  93.71.9.21
  93.72.114.171
  93.72.149.200
@@ -153550,13 +146169,13 @@
  93.8.151.167
  93.8.84.160
  93.81.252.222
+93.81.254.25
  93.82.220.150
-93.82.38.73
  93.83.126.93
-93.84.109.72
+93.84.111.7
  93.84.158.75
+93.84.178.54
  93.85.132.194
-93.86.152.147
  93.86.173.9
  93.86.206.139
  93.86.255.42
@@ -153586,13 +146205,11 @@
  93.89.235.77
  93.89.81.97
  93.89.84.93
-93.9.209.70
  93.90.147.104
  93.90.206.167
  93.90.207.43
  93.90.207.46
  93.90.73.137
-93.91.112.247
  93.91.116.101
  93.91.146.30
  93.91.162.58
@@ -153615,7 +146232,6 @@
  93.96.91.67
  93.97.219.82
  93.99.176.84
-93.99.4.23
  93.99.53.201
  93.99.6.158
  93020300-dot-sydneyma.appspot.com
@@ -153644,6 +146260,7 @@
  94.1.160.177
  94.1.213.58
  94.100.18.70
+94.100.221.39
  94.100.28.179
  94.100.28.201
  94.100.93.251
@@ -153659,9 +146276,7 @@
  94.102.209.169
  94.102.210.40
  94.102.212.234
-94.102.224.159
  94.102.48.193
-94.102.48.55
  94.102.49.103
  94.102.49.104
  94.102.49.106
@@ -153694,11 +146309,9 @@
  94.102.50.137
  94.102.50.138
  94.102.50.155
+94.102.50.156
  94.102.50.163
-94.102.50.175
  94.102.50.177
-94.102.50.178
-94.102.50.182
  94.102.50.223
  94.102.50.56
  94.102.51.155
@@ -153716,7 +146329,6 @@
  94.102.51.78
  94.102.51.95
  94.102.52.241
-94.102.53.112
  94.102.53.195
  94.102.53.208
  94.102.53.219
@@ -153724,7 +146336,6 @@
  94.102.54.138
  94.102.54.215
  94.102.54.217
-94.102.54.227
  94.102.54.229
  94.102.54.24
  94.102.54.249
@@ -153756,16 +146367,16 @@
  94.102.58.3
  94.102.59.64
  94.102.59.99
+94.102.6.175
  94.102.63.245
  94.102.63.52
-94.102.63.65
  94.102.63.71
  94.102.63.74
  94.102.63.94
  94.102.8.112
  94.103.120.173
+94.103.122.210
  94.103.175.86
-94.107.208.112
  94.112.121.49
  94.112.132.191
  94.112.142.134
@@ -153776,7 +146387,7 @@
  94.114.158.146
  94.114.70.23
  94.12.31.76
-94.121.14.175
+94.121.13.252
  94.124.193.242
  94.124.193.245
  94.124.6.181
@@ -153790,7 +146401,6 @@
  94.127.188.97
  94.127.217.200
  94.127.217.66
-94.127.222.36
  94.127.68.158
  94.13.119.139
  94.130.10.158
@@ -153821,8 +146431,9 @@
  94.130.64.182
  94.130.69.46
  94.130.71.31
-94.130.73.18
+94.130.73.22
  94.130.75.8
+94.130.76.69
  94.130.84.44
  94.130.89.38
  94.130.9.125
@@ -153830,7 +146441,6 @@
  94.131.14.19
  94.131.219.88
  94.134.1.143
-94.134.250.165
  94.136.138.142
  94.136.154.49
  94.136.154.53
@@ -153848,7 +146458,7 @@
  94.136.69.199
  94.136.69.228
  94.136.69.228bin.sh
-94.137.183.50
+94.137.173.236
  94.138.117.128
  94.138.139.81
  94.138.144.241
@@ -153866,13 +146476,12 @@
  94.139.178.59
  94.139.178.82
  94.139.181.10
-94.139.186.153
  94.139.186.206
+94.139.187.168
  94.139.191.214
  94.139.221.60
  94.139.224.104
  94.139.226.102
-94.139.227.167
  94.139.229.122
  94.139.235.254
  94.139.237.48
@@ -153883,6 +146492,7 @@
  94.140.115.207
  94.140.115.229
  94.140.115.242
+94.140.115.91
  94.140.116.14
  94.140.116.165
  94.140.116.176
@@ -153917,12 +146527,14 @@
  94.143.65.234
  94.143.83.203
  94.152.193.12
+94.152.193.15
  94.153.144.58
  94.153.157.18
  94.153.169.22
  94.153.198.62
  94.153.224.194
  94.153.227.14
+94.154.106.131
  94.154.159.157
  94.154.159.96
  94.154.17.170
@@ -153944,6 +146556,7 @@
  94.155.33.195
  94.155.33.196
  94.155.33.197
+94.155.33.199
  94.155.33.202
  94.155.33.70
  94.155.33.71
@@ -153951,6 +146564,7 @@
  94.155.33.73
  94.155.33.74
  94.155.33.75
+94.155.33.76
  94.155.33.78
  94.155.33.79
  94.155.33.80
@@ -153959,7 +146573,6 @@
  94.155.33.83
  94.155.33.84
  94.155.33.85
-94.155.33.86
  94.155.33.87
  94.155.79.172
  94.155.81.11
@@ -154028,7 +146641,6 @@
  94.177.201.50
  94.177.204.145
  94.177.207.151
-94.177.208.122
  94.177.214.200
  94.177.215.195
  94.177.218.252
@@ -154049,11 +146661,12 @@
  94.177.86.39
  94.178.120.219
  94.178.127.231
+94.178.146.22
  94.178.174.67
  94.178.175.201
+94.179.141.254
  94.18.231.202
  94.180.223.10
-94.180.24.108
  94.180.24.11
  94.180.24.119
  94.180.24.123
@@ -154079,12 +146692,10 @@
  94.180.24.207
  94.180.24.208
  94.180.24.21
-94.180.24.218
  94.180.24.219
  94.180.24.221
  94.180.24.222
  94.180.24.223
-94.180.24.246
  94.180.24.251
  94.180.24.254
  94.180.24.255
@@ -154114,18 +146725,16 @@
  94.180.24.80
  94.180.24.9
  94.180.24.91
+94.180.245.221
  94.180.246.38
  94.180.247.20
  94.180.249.187
  94.180.25.0
  94.180.25.105
-94.180.25.109
  94.180.25.117
-94.180.25.122
  94.180.25.128
  94.180.25.132
  94.180.25.146
-94.180.25.152
  94.180.25.153
  94.180.25.163
  94.180.25.165
@@ -154140,7 +146749,6 @@
  94.180.25.203
  94.180.25.206
  94.180.25.208
-94.180.25.210
  94.180.25.214
  94.180.25.218
  94.180.25.219
@@ -154180,7 +146788,6 @@
  94.180.25.69
  94.180.25.7
  94.180.25.70
-94.180.25.73
  94.180.25.79
  94.180.25.86
  94.180.25.87
@@ -154266,7 +146873,6 @@
  94.182.222.66
  94.182.25.74
  94.183.12.92
-94.183.131.154
  94.183.149.101
  94.183.187.127
  94.183.225.101
@@ -154290,7 +146896,6 @@
  94.19.202.125
  94.19.211.216
  94.19.7.55
-94.19.73.106
  94.190.177.213
  94.190.187.9
  94.190.35.174
@@ -154320,7 +146925,6 @@
  94.191.71.246
  94.191.75.220
  94.191.81.127
-94.191.88.34
  94.191.90.85
  94.191.96.110
  94.191.99.243
@@ -154330,12 +146934,12 @@
  94.193.114.99
  94.194.234.179
  94.195.103.151
-94.196.146.30
  94.198.1.179
  94.198.110.205
  94.198.160.31
  94.198.195.42
  94.198.215.22
+94.198.236.83
  94.198.240.26
  94.198.42.85
  94.198.65.186
@@ -154354,10 +146958,8 @@
  94.20.21.251
  94.20.21.37
  94.20.64.42
-94.20.65.17
  94.200.114.161
  94.200.114.162
-94.200.126.14
  94.200.126.42
  94.200.149.186
  94.200.17.144
@@ -154386,11 +146988,14 @@
  94.212.31.69
  94.213.107.137
  94.216.195.27
+94.216.2.129
  94.217.218.84
  94.22.47.242
  94.224.100.185
+94.224.51.25
  94.224.83.208
  94.226.196.20
+94.227.227.186
  94.227.40.54
  94.228.10.70
  94.228.11.6
@@ -154417,7 +147022,6 @@
  94.23.13.27
  94.23.144.129
  94.23.150.165
-94.23.154.171
  94.23.16.30
  94.23.160.207
  94.23.172.28
@@ -154454,11 +147058,13 @@
  94.23.57.8
  94.23.62.116
  94.23.69.61
+94.23.70.195
  94.23.74.254
  94.23.8.167
  94.23.83.227
  94.23.86.67
  94.23.9.102
+94.230.119.144
  94.230.128.59
  94.230.134.77
  94.230.135.245
@@ -154476,7 +147082,6 @@
  94.231.184.155
  94.231.184.47
  94.231.216.105
-94.231.216.124
  94.231.216.15
  94.231.216.151
  94.231.216.180
@@ -154489,6 +147094,7 @@
  94.231.216.27
  94.231.80.100
  94.232.11.178
+94.232.124.25
  94.232.126.225
  94.232.136.126
  94.232.176.32
@@ -154500,30 +147106,27 @@
  94.232.44.52
  94.232.46.10
  94.232.46.11
+94.232.46.150
  94.232.46.20
  94.232.46.30
  94.232.46.50
+94.232.47.20
  94.232.63.136
-94.232.70.179
-94.236.128.131
  94.236.131.14
  94.236.134.60
  94.236.138.169
  94.236.141.235
  94.236.143.239
-94.236.143.64
  94.236.182.92
-94.236.195.7
  94.236.200.175
  94.236.210.132
  94.236.211.224
  94.236.212.170
  94.236.213.149
-94.236.215.7
  94.236.226.209
  94.236.23.242
-94.236.233.124
  94.236.252.139
+94.237.101.188
  94.237.112.186
  94.237.125.30
  94.237.64.138
@@ -154534,6 +147137,7 @@
  94.237.88.96
  94.237.90.178
  94.238.121.133
+94.24.41.237
  94.240.30.99
  94.240.38.170
  94.242.171.0
@@ -154556,13 +147160,11 @@
  94.242.171.159
  94.242.171.160
  94.242.171.161
-94.242.171.163
  94.242.171.164
  94.242.171.168
  94.242.171.171
  94.242.171.172
  94.242.171.173
-94.242.171.178
  94.242.171.18
  94.242.171.185
  94.242.171.186
@@ -154575,7 +147177,6 @@
  94.242.171.218
  94.242.171.219
  94.242.171.220
-94.242.171.221
  94.242.171.230
  94.242.171.238
  94.242.171.240
@@ -154596,7 +147197,6 @@
  94.242.171.68
  94.242.171.7
  94.242.171.73
-94.242.171.77
  94.242.171.8
  94.242.171.80
  94.242.171.82
@@ -154607,7 +147207,6 @@
  94.242.171.98
  94.242.206.227
  94.242.206.75
-94.242.213.102
  94.242.213.9
  94.242.221.70
  94.242.241.177
@@ -154628,7 +147227,7 @@
  94.243.26.141
  94.244.107.41
  94.244.157.176
-94.244.28.246
+94.244.180.101
  94.244.97.244
  94.245.131.55
  94.245.40.83
@@ -154640,6 +147239,7 @@
  94.247.179.224
  94.247.241.70
  94.249.1.105
+94.249.109.182
  94.249.2.55
  94.249.26.108
  94.249.31.24
@@ -154660,24 +147260,23 @@
  94.253.237.25
  94.253.3.208
  94.253.98.86
-94.254.19.97
  94.254.2.71
  94.254.20.55
  94.254.60.101
-94.254.75.149
  94.254.88.228
  94.254.96.21
  94.254.97.68
  94.255.169.22
  94.255.186.232
  94.255.196.75
-94.255.197.8
+94.255.197.33
  94.255.198.144
  94.255.199.13
  94.255.199.62
  94.255.206.196
  94.255.207.167
  94.255.207.174
+94.255.244.80
  94.255.246.112
  94.255.246.218
  94.255.246.227
@@ -154692,6 +147291,8 @@
  94.26.195.220
  94.26.200.17
  94.26.200.181
+94.26.203.27
+94.26.204.42
  94.26.212.9
  94.26.90.14
  94.26.90.140
@@ -154704,13 +147305,13 @@
  94.30.242.237
  94.31.101.43
  94.31.53.203
-94.32.242.186
  94.32.66.15
  94.32.66.48
  94.33.52.61
  94.34.224.165
  94.39.101.178
  94.40.127.166
+94.40.89.86
  94.41.157.193
  94.41.65.27
  94.41.85.229
@@ -154737,22 +147338,17 @@
  94.46.186.49
  94.46.3.139
  94.49.171.171
-94.49.175.71
  94.49.90.95
  94.50.161.142
  94.50.162.191
  94.50.163.5
+94.50.179.67
  94.50.180.75
  94.51.211.73
  94.51.220.167
  94.51.88.38
  94.52.112.227
-94.52.117.149
  94.52.168.188
-94.52.94.166
-94.53.105.178
-94.53.105.199
-94.53.105.202
  94.53.116.52
  94.53.120.109
  94.53.125.6
@@ -154761,126 +147357,8 @@
  94.53.198.137
  94.53.213.121
  94.53.232.219
-94.53.245.71
  94.53.71.214
-94.53.80.11
-94.53.80.119
-94.53.80.138
-94.53.80.170
-94.53.80.172
-94.53.80.174
-94.53.80.179
-94.53.80.18
-94.53.80.184
-94.53.80.185
-94.53.80.196
-94.53.80.205
-94.53.80.3
-94.53.80.41
-94.53.80.44
-94.53.80.53
-94.53.80.58
-94.53.80.61
-94.53.80.62
-94.53.80.71
-94.53.80.75
-94.53.80.85
-94.53.80.87
-94.53.81.111
-94.53.81.117
-94.53.81.12
-94.53.81.125
-94.53.81.189
-94.53.81.19
-94.53.81.190
-94.53.81.198
-94.53.81.2
-94.53.81.210
-94.53.81.233
-94.53.81.234
-94.53.81.250
-94.53.81.38
-94.53.81.68
-94.53.81.75
-94.53.82.117
-94.53.82.118
-94.53.82.119
-94.53.82.120
-94.53.82.149
-94.53.82.166
-94.53.82.173
-94.53.82.175
-94.53.82.222
-94.53.82.3
-94.53.82.42
-94.53.83.105
-94.53.83.111
-94.53.83.114
-94.53.83.115
-94.53.83.122
-94.53.83.124
-94.53.83.130
-94.53.83.151
-94.53.83.166
-94.53.83.227
  94.53.83.30
-94.53.83.56
-94.53.83.73
-94.53.83.77
-94.53.83.79
-94.53.83.92
-94.53.83.93
-94.53.84.105
-94.53.84.107
-94.53.84.115
-94.53.84.149
-94.53.84.198
-94.53.84.204
-94.53.84.218
-94.53.84.219
-94.53.84.229
-94.53.85.109
-94.53.85.115
-94.53.85.117
-94.53.85.124
-94.53.85.134
-94.53.85.135
-94.53.85.138
-94.53.85.151
-94.53.85.16
-94.53.85.169
-94.53.85.180
-94.53.85.213
-94.53.85.229
-94.53.85.230
-94.53.85.239
-94.53.85.29
-94.53.85.46
-94.53.85.51
-94.53.85.67
-94.53.85.70
-94.53.85.8
-94.53.85.88
-94.53.85.91
-94.53.86.11
-94.53.86.153
-94.53.86.154
-94.53.86.185
-94.53.86.21
-94.53.86.22
-94.53.86.237
-94.53.86.70
-94.53.86.99
-94.53.87.100
-94.53.87.163
-94.53.87.166
-94.53.87.181
-94.53.87.184
-94.53.87.201
-94.53.87.85
-94.53.88.200
-94.53.88.66
-94.53.89.102
  94.57.252.147
  94.6.196.227
  94.6.28.201
@@ -154888,7 +147366,6 @@
  94.60.231.90
  94.60.98.142
  94.62.201.87
-94.62.81.45
  94.64.126.144
  94.64.76.114
  94.64.82.153
@@ -154901,8 +147378,10 @@
  94.66.104.190
  94.66.170.166
  94.66.23.132
+94.66.56.177
  94.66.80.57
-94.67.102.134
+94.67.106.234
+94.67.194.1
  94.67.2.87
  94.67.207.203
  94.67.227.185
@@ -154910,13 +147389,12 @@
  94.67.253.174
  94.67.89.197
  94.67.92.138
-94.68.134.167
  94.68.147.127
  94.68.168.95
+94.68.79.243
  94.69.130.34
  94.69.226.48
  94.70.167.168
-94.70.45.88
  94.71.122.217
  94.71.131.29
  94.71.157.211
@@ -154924,7 +147402,7 @@
  94.72.143.26
  94.72.143.28
  94.73.145.120
-94.73.170.182
+94.73.151.176
  94.73.193.106
  94.73.199.57
  94.73.204.9
@@ -154933,26 +147411,26 @@
  94.73.250.66
  94.73.252.193
  94.74.124.248
-94.74.129.216
  94.74.130.169
  94.74.131.60
-94.74.133.11
-94.74.133.150
+94.74.133.126
  94.74.136.225
+94.74.138.99
  94.74.148.130
-94.74.148.156
  94.74.151.11
  94.74.151.238
-94.74.151.59
  94.74.151.79
  94.74.160.187
  94.74.160.86
+94.74.164.162
  94.74.164.208
+94.74.168.155
  94.74.168.192
  94.74.168.60
  94.74.172.146
  94.74.191.138
  94.74.191.221
+94.74.191.28
  94.75.228.26
  94.75.243.135
  94.75.245.36
@@ -154966,7 +147444,6 @@
  94.76.247.61
  94.76.81.58
  94.76.92.10
-94.79.128.142
  94.79.32.243
  94.79.4.53
  94.79.54.195
@@ -155011,18 +147488,15 @@
  95.0.206.62
  95.0.219.209
  95.0.219.241
+95.0.32.118
  95.0.37.74
  95.0.66.76
  95.0.66.97
  95.0.66.98
-95.0.7.140
  95.0.93.217
-95.102.132.121
-95.103.141.60
  95.104.114.50
  95.104.194.16
  95.104.54.227
-95.105.184.58
  95.105.212.113
  95.105.234.196
  95.105.253.100
@@ -155034,6 +147508,7 @@
  95.107.13.91
  95.107.163.114
  95.107.199.90
+95.107.39.208
  95.107.43.68
  95.107.53.155
  95.107.6.3
@@ -155050,7 +147525,6 @@
  95.110.200.241
  95.110.224.127
  95.110.224.30
-95.110.232.124
  95.110.234.93
  95.111.128.185
  95.111.128.43
@@ -155071,17 +147545,19 @@
  95.111.253.158
  95.111.254.160
  95.111.74.98
+95.112.64.147
+95.112.86.235
+95.114.55.159
  95.114.59.62
-95.114.92.97
+95.116.127.237
  95.116.147.78
  95.116.220.70
-95.116.82.43
-95.117.119.60
-95.117.147.25
+95.116.26.248
+95.117.0.75
+95.118.65.29
  95.12.143.143
  95.12.143.42
  95.12.252.187
-95.121.104.197
  95.122.154.149
  95.122.97.103
  95.123.41.94
@@ -155125,7 +147601,6 @@
  95.131.10.118
  95.131.102.39
  95.131.70.76
-95.132.16.222
  95.132.186.172
  95.132.186.186
  95.132.235.191
@@ -155134,7 +147609,6 @@
  95.133.247.56
  95.134.130.182
  95.134.141.22
-95.134.187.126
  95.134.195.166
  95.134.196.169
  95.134.232.185
@@ -155412,6 +147886,7 @@
  95.141.17.99
  95.141.35.15
  95.141.36.112
+95.141.41.24
  95.142.121.32
  95.142.161.63
  95.142.161.87
@@ -155437,7 +147912,6 @@
  95.143.200.95
  95.143.218.179
  95.143.220.18
-95.143.220.5
  95.143.82.202
  95.144.0.30
  95.149.204.205
@@ -155451,6 +147925,7 @@
  95.153.167.63
  95.153.31.84
  95.153.31.94
+95.153.86.117
  95.154.104.147
  95.154.118.97
  95.154.146.94
@@ -155465,7 +147940,6 @@
  95.155.205.100
  95.155.36.152
  95.156.125.190
-95.156.229.181
  95.156.230.141
  95.156.252.94
  95.156.54.73
@@ -155487,8 +147961,8 @@
  95.158.7.234
  95.159.48.15
  95.159.50.21
+95.159.51.179
  95.160.181.237
-95.160.39.22
  95.161.12.45
  95.161.169.170
  95.161.188.246
@@ -155508,7 +147982,6 @@
  95.163.141.86
  95.163.192.75
  95.163.196.101
-95.163.255.130
  95.163.71.126
  95.164.65.194
  95.165.104.89
@@ -155534,8 +148007,9 @@
  95.167.225.85
  95.167.243.167
  95.167.39.12
-95.168.118.76
+95.168.120.24
  95.168.170.105
+95.168.195.26
  95.168.227.113
  95.168.234.109
  95.168.26.179
@@ -155560,7 +148034,6 @@
  95.170.118.79
  95.170.166.233
  95.170.166.238
-95.170.207.38
  95.170.70.25
  95.170.88.58
  95.171.126.142
@@ -155575,7 +148048,6 @@
  95.173.182.90
  95.173.183.28
  95.173.253.215
-95.173.78.19
  95.174.0.176
  95.174.109.43
  95.174.118.12
@@ -155607,7 +148079,6 @@
  95.179.127.182
  95.179.127.194
  95.179.127.195
-95.179.127.2
  95.179.127.203
  95.179.127.204
  95.179.127.207
@@ -155633,8 +148104,6 @@
  95.179.127.41
  95.179.127.42
  95.179.127.45
-95.179.127.46
-95.179.127.48
  95.179.127.5
  95.179.127.50
  95.179.127.53
@@ -155646,7 +148115,6 @@
  95.179.127.83
  95.179.127.89
  95.179.127.9
-95.179.127.96
  95.179.127.99
  95.179.131.110
  95.179.132.92
@@ -155670,18 +148138,14 @@
  95.179.250.205
  95.180.167.208
  95.180.174.199
-95.180.234.112
  95.180.235.153
  95.180.235.65
-95.180.253.12
  95.180.253.2
  95.180.254.60
  95.181.131.153
  95.181.131.199
-95.181.148.109
  95.181.148.120
  95.181.148.125
-95.181.148.143
  95.181.148.164
  95.181.148.182
  95.181.148.211
@@ -155691,9 +148155,8 @@
  95.181.148.86
  95.181.149.23
  95.181.149.24
-95.181.149.32
-95.181.149.37
  95.181.149.38
+95.181.149.48
  95.181.149.52
  95.181.149.61
  95.181.149.72
@@ -155703,11 +148166,7 @@
  95.181.150.17
  95.181.150.18
  95.181.150.206
-95.181.150.30
-95.181.150.32
-95.181.150.80
  95.181.151.144
-95.181.151.184
  95.181.151.194
  95.181.151.198
  95.181.151.212
@@ -155717,7 +148176,6 @@
  95.181.151.41
  95.181.151.42
  95.181.151.60
-95.181.157.249
  95.181.172.138
  95.181.172.39
  95.181.188.200
@@ -155730,7 +148188,6 @@
  95.181.86.74
  95.182.113.34
  95.182.120.176
-95.182.120.250
  95.182.122.199
  95.182.122.22
  95.182.122.46
@@ -155751,7 +148208,6 @@
  95.19.50.4
  95.19.50.48
  95.19.50.83
-95.19.50.93
  95.190.120.42
  95.192.27.178
  95.192.60.127
@@ -155761,6 +148217,7 @@
  95.192.9.174
  95.194.32.164
  95.194.46.165
+95.194.61.244
  95.194.81.30
  95.194.86.40
  95.194.87.41
@@ -155794,6 +148251,7 @@
  95.204.219.192
  95.204.85.149
  95.208.253.143
+95.209.154.19
  95.209.155.91
  95.21.243.117
  95.211.10.160
@@ -155847,7 +148305,6 @@
  95.213.233.84
  95.213.236.64
  95.213.238.170
-95.214.179.136
  95.214.8.54
  95.214.8.86
  95.215.19.22
@@ -155878,6 +148335,7 @@
  95.216.12.173
  95.216.12.204
  95.216.12.243
+95.216.125.130
  95.216.140.50
  95.216.144.64
  95.216.145.1
@@ -155890,10 +148348,10 @@
  95.216.181.107
  95.216.187.94
  95.216.191.61
+95.216.192.143
  95.216.197.12
  95.216.198.89
  95.216.21.47
-95.216.214.160
  95.216.224.165
  95.216.224.251
  95.216.226.201
@@ -155938,12 +148396,12 @@
  95.216.96.167
  95.216.96.93
  95.216.97.16
-95.216.97.27
  95.216.99.213
  95.217.10.167
  95.217.10.7
  95.217.109.216
  95.217.109.218
+95.217.113.212
  95.217.114.36
  95.217.121.30
  95.217.125.203
@@ -156000,12 +148458,10 @@
  95.220.214.93
  95.222.180.222
  95.222.26.248
-95.223.75.22
  95.226.225.11
  95.227.198.80
  95.227.234.14
  95.229.138.72
-95.23.93.243
  95.232.235.194
  95.232.25.19
  95.232.252.151
@@ -156014,7 +148470,6 @@
  95.234.249.253
  95.235.174.145
  95.235.60.135
-95.236.224.129
  95.237.233.217
  95.238.7.108
  95.24.24.160
@@ -156022,39 +148477,41 @@
  95.243.136.198
  95.243.65.80
  95.245.110.131
-95.246.237.73
  95.246.25.52
  95.247.162.74
  95.247.171.181
  95.247.172.182
  95.247.210.55
  95.247.233.159
+95.247.48.48
  95.248.72.68
  95.249.201.184
-95.25.113.43
  95.25.248.185
  95.25.75.112
+95.250.143.134
  95.250.39.66
  95.251.213.197
  95.251.89.9
  95.251.9.69
+95.252.171.8
  95.252.236.58
  95.253.100.189
  95.253.238.77
  95.255.106.123
-95.255.130.177
  95.255.133.196
  95.255.36.81
  95.255.52.233
  95.255.60.110
-95.27.114.222
+95.26.73.47
  95.27.142.114
  95.27.152.73
  95.28.12.39
+95.28.244.228
  95.29.188.88
  95.29.42.110
  95.30.183.124
  95.30.218.152
+95.30.218.154
  95.30.218.184
  95.30.218.190
  95.30.25.163
@@ -156065,25 +148522,22 @@
  95.31.186.116
  95.31.209.113
  95.31.22.193
-95.31.23.157
  95.31.231.228
  95.31.241.178
  95.31.5.29
  95.31.73.96
-95.32.1.94
  95.32.11.168
  95.32.127.175
  95.32.127.244
+95.32.131.83
  95.32.132.144
  95.32.135.28
  95.32.141.220
  95.32.142.171
  95.32.149.51
  95.32.152.157
-95.32.158.155
  95.32.16.46
  95.32.162.226
-95.32.192.215
  95.32.196.57
  95.32.197.28
  95.32.198.3
@@ -156100,26 +148554,24 @@
  95.32.31.166
  95.32.31.188
  95.32.34.102
-95.32.68.115
  95.32.69.121
  95.32.76.231
  95.32.80.247
  95.32.93.49
  95.32.97.220
+95.33.19.22
  95.34.114.33
  95.34.169.12
+95.37.142.35
  95.37.170.88
-95.37.219.137
  95.38.14.11
-95.38.169.164
  95.38.211.50
-95.38.212.201
  95.38.214.208
  95.38.252.214
  95.38.40.180
  95.38.67.175
+95.38.79.90
  95.39.12.16
-95.42.102.195
  95.42.129.31
  95.42.189.34
  95.42.221.14
@@ -156141,14 +148593,13 @@
  95.51.180.226
  95.51.186.245
  95.51.210.81
-95.52.205.100
-95.52.242.187
  95.52.76.83
  95.53.206.83
  95.54.196.135
-95.54.58.254
  95.54.62.165
+95.55.81.236
  95.55.82.208
+95.56.139.225
  95.56.189.16
  95.56.201.39
  95.56.205.100
@@ -156168,11 +148619,11 @@
  95.58.145.22
  95.58.164.130
  95.58.18.90
+95.58.180.169
  95.58.252.151
  95.59.105.179
  95.59.116.66
  95.59.132.44
-95.59.149.207
  95.59.26.160
  95.59.26.9
  95.59.7.26
@@ -156182,6 +148633,7 @@
  95.6.70.66
  95.6.70.92
  95.6.77.61
+95.6.8.14
  95.6.85.38
  95.60.146.134
  95.61.52.47
@@ -156206,7 +148658,7 @@
  95.68.240.80
  95.69.137.209
  95.69.149.219
-95.69.166.58
+95.69.241.161
  95.69.249.63
  95.7.113.176
  95.7.227.189
@@ -156224,6 +148676,7 @@
  95.71.125.50
  95.71.126.178
  95.71.126.250
+95.71.133.58
  95.71.135.163
  95.71.185.110
  95.72.144.201
@@ -156236,7 +148689,7 @@
  95.73.43.212
  95.73.45.249
  95.73.64.148
-95.73.81.49
+95.76.1.238
  95.76.142.243
  95.77.104.79
  95.77.118.131
@@ -156247,6 +148700,7 @@
  95.78.162.117
  95.78.169.4
  95.78.183.156
+95.78.202.45
  95.78.251.116
  95.79.112.74
  95.79.121.115
@@ -156254,7 +148708,6 @@
  95.79.25.247
  95.79.34.35
  95.79.35.133
-95.79.50.121
  95.79.57.206
  95.80.10.185
  95.80.128.189
@@ -156265,6 +148718,7 @@
  95.80.79.106
  95.81.17.95
  95.81.2.110
+95.81.88.105
  95.82.136.170
  95.82.146.70
  95.83.73.31
@@ -156277,6 +148731,7 @@
  95.84.195.16
  95.84.240.62
  95.84.48.22
+95.84.54.25
  95.85.1.116
  95.85.10.43
  95.85.11.140
@@ -156344,7 +148799,6 @@
  95.9.180.128
  95.9.194.13
  95.9.199.224
-95.9.201.28
  95.9.206.234
  95.9.225.107
  95.9.237.183
@@ -156356,15 +148810,19 @@
  95.9.5.93
  95.9.65.231
  95.9.65.94
+95.9.67.155
  95.9.7.108
  95.9.84.134
  95.9.96.110
+95.90.148.141
  95.90.148.164
-95.90.180.177
  95.90.181.5
  95.90.181.52
  95.90.181.69
+95.90.32.180
+95.91.175.23
  95.91.193.44
+95.91.219.41
  95.91.45.50
  95.91.75.2
  95.92.74.9
@@ -156413,7 +148871,6 @@
  96.126.121.93
  96.126.123.143
  96.126.124.126
-96.126.124.64
  96.126.127.143
  96.126.127.19
  96.127.142.210
@@ -156434,28 +148891,28 @@
  96.2.133.21
  96.2.21.190
  96.20.45.179
-96.20.45.45
  96.20.87.164
  96.21.177.8
+96.22.233.43
  96.22.82.34
  96.224.227.210
  96.224.32.210
  96.225.97.17
+96.226.157.164
  96.228.53.12
  96.23.222.252
  96.23.226.194
  96.230.201.169
-96.230.39.67
  96.230.99.101
  96.231.141.105
  96.231.145.254
  96.231.244.92
  96.231.98.24
  96.232.235.99
+96.232.83.154
  96.233.194.4
  96.233.77.159
  96.234.42.12
-96.236.114.119
  96.237.114.206
  96.237.231.17
  96.238.29.97
@@ -156503,16 +148960,15 @@
  96.30.77.148
  96.30.84.21
  96.31.77.62
-96.35.86.14
-96.36.23.186
  96.37.63.182
  96.37.73.96
  96.38.233.146
  96.39.152.89
+96.39.166.117
  96.39.76.211
+96.39.86.106
  96.40.212.117
  96.41.157.101
-96.42.151.215
  96.43.141.186
  96.43.190.226
  96.44.128.250
@@ -156528,7 +148984,6 @@
  96.44.191.145
  96.46.0.208
  96.46.16.216
-96.46.212.70
  96.47.0.66
  96.47.147.169
  96.47.224.42
@@ -156557,12 +149012,11 @@
  96.56.55.147
  96.56.58.202
  96.57.103.138
-96.57.153.210
  96.57.24.186
  96.57.248.252
  96.57.5.210
+96.57.7.106
  96.57.99.138
-96.58.163.25
  96.59.11.140
  96.59.111.169
  96.59.172.84
@@ -156572,10 +149026,10 @@
  96.61.113.203
  96.61.133.134
  96.65.60.181
+96.66.109.189
  96.66.15.147
  96.66.200.209
  96.66.217.202
-96.66.78.65
  96.67.86.201
  96.67.86.202
  96.67.97.105
@@ -156591,7 +149045,6 @@
  96.69.18.162
  96.69.46.173
  96.69.47.229
-96.69.77.149
  96.69.8.235
  96.69.88.83
  96.70.52.227
@@ -156608,16 +149061,16 @@
  96.77.43.233
  96.77.77.53
  96.78.175.36
+96.78.175.41
  96.78.177.242
  96.78.178.158
  96.78.187.154
  96.79.7.210
  96.8.114.178
  96.8.115.26
-96.8.120.113
  96.8.121.32
+96.8.122.172
  96.8.122.180
-96.8.122.181
  96.8.122.185
  96.80.107.217
  96.80.251.85
@@ -156629,6 +149082,7 @@
  96.84.128.196
  96.85.162.2
  96.85.237.30
+96.85.243.77
  96.85.35.233
  96.86.107.113
  96.86.140.209
@@ -156640,7 +149094,6 @@
  96.87.188.193
  96.87.228.250
  96.87.237.210
-96.88.10.141
  96.88.104.242
  96.88.212.146
  96.9.183.85
@@ -156671,8 +149124,6 @@
  96.90.4.182
  96.91.14.37
  96.91.204.122
-96.91.63.198
-96.91.80.213
  96.92.10.154
  96.92.157.164
  96.92.208.34
@@ -156723,13 +149174,13 @@
  97.119.11.213
  97.120.1.3
  97.120.160.10
-97.123.113.255
  97.123.116.7
  97.123.15.35
  97.123.32.124
  97.123.53.71
  97.125.219.154
  97.126.1.232
+97.126.52.59
  97.127.139.114
  97.127.17.64
  97.127.20.166
@@ -156773,11 +149224,9 @@
  97.75.144.5
  97.75.148.152
  97.76.170.128
-97.77.82.250
  97.78.186.147
  97.78.198.94
  97.79.1.218
-97.79.203.242
  97.79.239.42
  97.80.200.117
  97.81.244.191
@@ -156787,15 +149236,12 @@
  97.83.108.94
  97.83.173.243
  97.83.248.117
-97.83.249.188
-97.83.250.216
-97.84.104.4
  97.84.225.94
  97.84.232.105
+97.84.6.53
  97.85.36.15
  97.88.101.87
  97.88.8.34
-97.89.157.0
  97.89.21.22
  97.90.110.160
  97.90.115.171
@@ -156806,14 +149252,11 @@
  97.92.133.43
  97.93.25.93
  97.93.49.220
-97.94.246.106
  97.95.161.255
  97.95.223.36
  97.98.26.185
  97.99.177.36
  97.99.205.241
-97.99.222.71
-97.99.231.157
  97.99.3.171
  97.ip-144-217-95.net
  970380605.servehalflife.com
@@ -156831,7 +149274,6 @@
  97pogonszczecininfo.pogon.max.pl
  97sm.org
  98.0.210.218
-98.100.191.51
  98.100.202.106
  98.100.250.202
  98.102.222.30
@@ -156842,7 +149284,6 @@
  98.109.159.216
  98.11.129.121
  98.110.234.97
-98.110.30.244
  98.113.162.148
  98.113.239.207
  98.114.181.134
@@ -156856,7 +149297,9 @@
  98.116.145.45
  98.116.234.182
  98.119.219.27
+98.124.111.137
  98.124.243.32
+98.124.38.4
  98.124.41.201
  98.125.104.165
  98.125.110.244
@@ -156901,6 +149344,7 @@
  98.128.180.99
  98.128.181.235
  98.128.181.244
+98.128.198.243
  98.128.211.232
  98.128.217.99
  98.128.219.24
@@ -156933,6 +149377,7 @@
  98.149.69.76
  98.15.140.226
  98.15.156.16
+98.15.197.66
  98.150.169.135
  98.151.19.47
  98.151.250.238
@@ -156940,7 +149385,6 @@
  98.151.88.104
  98.152.199.155
  98.152.217.142
-98.152.3.219
  98.153.109.186
  98.153.153.142
  98.153.153.62
@@ -156962,8 +149406,6 @@
  98.159.110.228
  98.159.110.231
  98.159.110.232
-98.159.83.114
-98.159.90.201
  98.159.99.102
  98.159.99.21
  98.159.99.212
@@ -156991,7 +149433,6 @@
  98.165.125.14
  98.167.124.171
  98.168.253.24
-98.171.178.205
  98.171.21.129
  98.172.142.6
  98.172.151.30
@@ -157000,6 +149441,7 @@
  98.172.69.141
  98.173.47.253
  98.174.204.209
+98.174.208.79
  98.175.197.111
  98.175.252.149
  98.176.124.166
@@ -157007,6 +149449,7 @@
  98.178.203.36
  98.178.240.9
  98.179.182.136
+98.182.212.15
  98.183.37.222
  98.183.75.161
  98.185.94.76
@@ -157040,6 +149483,7 @@
  98.2.233.131
  98.200.189.189
  98.200.213.136
+98.201.192.205
  98.202.193.108
  98.202.232.200
  98.202.242.231
@@ -157052,10 +149496,8 @@
  98.21.251.169
  98.211.33.202
  98.211.69.104
-98.212.15.187
  98.213.183.28
  98.217.111.234
-98.217.124.239
  98.219.121.217
  98.219.172.82
  98.219.212.12
@@ -157064,7 +149506,6 @@
  98.224.62.239
  98.224.72.168
  98.225.157.78
-98.226.179.220
  98.226.186.214
  98.226.204.55
  98.227.61.19
@@ -157082,6 +149523,7 @@
  98.236.57.166
  98.238.161.194
  98.239.128.154
+98.24.30.170
  98.242.225.185
  98.244.145.49
  98.247.106.211
@@ -157098,17 +149540,14 @@
  98.254.189.192
  98.254.247.209
  98.254.5.160
-98.254.56.184
  98.254.59.36
-98.255.71.58
-98.27.178.40
  98.28.241.120
  98.29.18.119
  98.29.195.204
+98.32.243.104
  98.33.59.125
  98.33.76.100
  98.34.138.143
-98.35.125.20
  98.35.16.77
  98.35.87.71
  98.36.134.183
@@ -157162,7 +149601,6 @@
  99.108.237.173
  99.11.1.97
  99.113.165.165
-99.113.188.39
  99.115.113.154
  99.115.25.13
  99.119.143.11
@@ -157170,6 +149608,7 @@
  99.124.216.71
  99.126.19.81
  99.127.234.110
+99.135.180.41
  99.137.20.45
  99.14.28.119
  99.14.51.66
@@ -157182,7 +149621,6 @@
  99.155.232.76
  99.164.139.172
  99.176.27.13
-99.18.204.84
  99.185.76.161
  99.188.36.50
  99.192.218.142
@@ -157231,6 +149669,7 @@
  99.231.79.201
  99.232.126.103
  99.233.0.248
+99.233.1.22
  99.233.41.140
  99.234.58.154
  99.235.52.151
@@ -157238,6 +149677,7 @@
  99.236.182.253
  99.236.76.38
  99.237.38.192
+99.238.31.4
  99.238.56.195
  99.238.94.137
  99.239.170.80
@@ -157249,16 +149689,18 @@
  99.242.65.99
  99.243.12.4
  99.243.162.115
+99.243.168.213
  99.244.131.236
  99.244.169.166
  99.244.40.156
  99.245.116.246
+99.245.16.105
  99.245.166.80
  99.245.25.86
  99.245.64.69
  99.246.165.190
  99.246.222.163
-99.247.106.13
+99.247.33.186
  99.248.135.241
  99.248.154.155
  99.248.37.236
@@ -157281,7 +149723,6 @@
  99.255.184.174
  99.255.244.77
  99.255.62.67
-99.26.72.169
  99.28.197.187
  99.29.112.187
  99.30.254.27
@@ -157290,12 +149731,14 @@
  99.35.124.46
  99.40.47.185
  99.44.78.234
+99.46.1.60
  99.47.175.18
  99.50.211.58
  99.54.134.182
  99.55.162.227
  99.56.114.255
  99.58.163.117
+99.61.135.143
  99.65.106.210
  99.67.57.104
  99.73.215.70
@@ -157309,7 +149752,6 @@
  99.83.242.58
  99.88.47.34
  99.89.34.3
-99.90.3.131
  99.90.34.142
  99.97.218.164
  99.98.219.253
@@ -157382,7 +149824,6 @@
  9adhity.com
  9ajbjo5llopczrhvfr7hhdr7vlkkxrmzqt64vwrjfjqcrenmecavfy.fccfc.org
  9az1.qweqwi.com
-9b80829350.000webhostapp.com
  9bhhr.cn
  9boom.com
  9bzzteus.xyz
@@ -157630,7 +150071,6 @@ a3b-h.jaysbrand.com
  a3dam221.ddns.net
  a3ew4fw148wq1fdqq.date
  a3infra.com
-a3lany.net
  a3tyn.svcoding.com
  a41b1e101c6f743fbbffa2b51334f0e22da164e9.ph
  a42h6.jaysbrand.com
@@ -157811,6 +150251,7 @@ aamazoon.myddns.me
  aambojovkbpwgleg-dot-millinium.ey.r.appspot.com
  aammzonn.myftp.biz
  aamqzdwqvx.top
+aamwsgmqhawnjstrbzq.top
  aamxafzlopnn.top
  aamzonddf.ylpiwdok.cn
  aamzonnmsn.temp.swtest.ru
@@ -158257,6 +150698,7 @@ absproyectores.com.mx
  absr.co.za
  absrhsvboaepumflpfcnpvhxdt-dot-gleowayel400503.uc.r.appspot.com
  abstainfraddling.com
+abstinent-apparatus.000webhostapp.com
  abstracted-repeated-brian.glitch.me
  abstractexplosion.com
  absuejpmorganc.com
@@ -158305,17 +150747,14 @@ ac-07616867.mehregantandis.ir
  ac-09739836.bidsolutions.cl
  ac-14256188.benaiahgeneration.com
  ac-15037708.benaiahgeneration.com
-ac-17624928.bidsolutions.cl
  ac-17706392.benaiahgeneration.com
  ac-18198309.benaiahgeneration.com
  ac-21425342.mehregantandis.ir
-ac-23901870.bidsolutions.cl
  ac-23995002.benaiahgeneration.com
  ac-41960154.benaiahgeneration.com
  ac-43465303.mehregantandis.ir
  ac-49569302.mehregantandis.ir
  ac-54322449.benaiahgeneration.com
-ac-62696748.bidsolutions.cl
  ac-69922914.bidsolutions.cl
  ac-70981525.benaiahgeneration.com
  ac-71525329.benaiahgeneration.com
@@ -158466,9 +150905,11 @@ accban-17990084.kahulasup.ch
  accban-18920711.kahulasup.ch
  accban-19010232.kahulasup.ch
  accban-19544480.kahulasup.ch
+accban-19655673.kahulasup.ch
  accban-20263959.kahulasup.ch
  accban-20550575.kahulasup.ch
  accban-21040570.kahulasup.ch
+accban-22204183.kahulasup.ch
  accban-22594756.kahulasup.ch
  accban-22604121.kahulasup.ch
  accban-24555949.kahulasup.ch
@@ -158717,6 +151158,7 @@ accessocliente.info
  accessoinstagramlogin.altervista.org
  accessonliiine.com
  accessopds2.000webhostapp.com
+accessopostale.com
  accessorya.com
  accesspower.buzz
  accesspress.rdsarkar.com
@@ -158981,6 +151423,7 @@ account-update-manage.com
  account-update.278y0.cn
  account-update.account.7daf0619cbd37d6a81227e.info
  account-update.account.c48596f029eabb5a.info
+account-update.amazon-helper.top
  account-update.amazon.co.jp.000caua5456aod4das98dcp10ad0456a0xa.club
  account-update.amazon.co.jp.0456a0xa80caua0095456aod4dasdcp10ad.club
  account-update.amazon.co.jp.056aod4dasdcp10ad0456a0xa80caua0954.club
@@ -159231,6 +151674,7 @@ accountbillinghelp.com
  accountbills-ee.com
  accountblizzard.net
  accountblocked-netflix.com
+accountblockedsupport.ml
  accountchckecker-update-now.drpiza.com
  accountcheckid.000webhostapp.com
  accountcheckinfo.com
@@ -159299,6 +151743,7 @@ accountonline44456qq.000webhostapp.com
  accountopen.dynip.org
  accountprivate.000webhostapp.com
  accountprosec.000webhostapp.com
+accountprotection-halifax.com
  accountprotectionlloyds.com
  accountrecovery00.com
  accountreminderupdatestatement89262.bamunas.com
@@ -159321,6 +151766,7 @@ accounts-team-e.com
  accounts-team-g.com
  accounts-techincal-support.com
  accounts-updateamazoonverify2456712674.sakitmamasku.com
+accounts-updates-co-jp.casa
  accounts-verifiedpayment.com
  accounts-verify-craigs-login.org
  accounts-verify.xyz
@@ -159377,6 +151823,7 @@ accountsecure.z13.web.core.windows.net
  accountsecurefeedback.net
  accountsecureid.serveirc.com
  accountsecuresupport.com
+accountsecurity-halifax.com
  accountsecurity-id.serveirc.com
  accountsecurity-lloydsuk.com
  accountsecurity-payee.link
@@ -159419,6 +151866,7 @@ accountsupportapple-wfjuf1.com
  accountsverify.serveirc.com
  accountt-conf.000webhostapp.com
  accountt-fb4.webnode.com
+accountterminatiowarning.weebly.com
  accounttfb63.webnode.com
  accounttfb9.webnode.com
  accounttfb958.webnode.com
@@ -159437,6 +151885,7 @@ accountupdate.amazon.lhxnmj.shop
  accountupdate.amazon.nlhxkw.ph
  accountupdate.amazon.pxki8ozt.xyz
  accountupdate.amazon.qghqkg.ph
+accountupdate.amazon.upadte-php.giize.com
  accountupdate.amazon.updaate-php.theworkpc.com
  accountupdate.amazon.updete-php.myddns.rocks
  accountupdate.amazon.xyhdqs.cloud
@@ -159486,6 +151935,7 @@ accses.socialpagebluecheck.xyz
  accsever.sdnnysqt.org.cn
  accsystemprblemhelp.site
  acct-altonrnc.com
+acct-customers-login.com
  acct-famres-inv.me
  acct-frederickcountymd-inv.com
  acct-piedmontcancerinstitute-inv.net
@@ -159539,7 +151989,6 @@ acega.com.sv
  acej.gazengel.com
  aceleradorasaturno.com
  acellr.co.uk
-acemisair.com
  acemoney.top
  acencoop-conciliaciones.com
  aceofspadesbarberstudio.com
@@ -159822,6 +152271,7 @@ activa.tu.cuenta.en.linea.viabcp.hoeve-te-koop.be
  activacion-alert.webcindario.com
  activacion-zonabetasegvra1bn.online
  activacionbancolombias.com
+activacionbg.webcindario.com
  activacionesdeproducto.com
  activacionessegurasclientes.com
  activadigitalsmszonabn-1.com
@@ -159836,6 +152286,7 @@ activartcompany.it
  activarwefferent.es1.cajagroup.net
  activaseguroandonlinebn2.com
  activate-dashboard-account.support
+activate-taxrepayment.com
  activate-your-account-information-002.000webhostapp.com
  activate-your-account-online-user-id902183921.000webhostapp.com
  activate-your-account.ru.com
@@ -159848,10 +152299,12 @@ activation-center-social-us2020.my.id
  activation-pages-invitation-site-100011245174772015.tk
  activation-pages-invitation-sites-10267531174772015.tk
  activation-pages-invitation-sites-1027531174772015.tk
+activatucuentabnmultired.com
  active-azuredirectory-875463247mc365.alnoorsmd.com.pk
  active-azuredirectory-87e7te247mc365.impactodenoticias.com.br
  active-instagram.1gb.ru
  active-olive.cloudvent.net
+active-prof.xyz
  active-recover.xyz
  active-scur.space
  active-snapchat-login.purposeoverpain.net
@@ -159924,6 +152377,7 @@ activityeventsmlbbnewss.tk
  activityeventsscodashop.cf
  activityeventsscodashop.ga
  activityeventsskinnews.tk
+activitygetskinkofmlbb.gq
  activitynewseventscodashop.cf
  activitynewseventscodashop.ml
  activitynewseventscodashop.tk
@@ -160054,6 +152508,7 @@ adamkosowski.pl
  adamkurier.top
  adamli.wirepathdns.com
  adammamrot.pl
+adamon01.com
  adamp78.com
  adampaczka.com
  adampettycreative.com
@@ -160284,6 +152739,7 @@ admin-snnbc.xyz
  admin.aldiarnoldi.com
  admin.casa.it.iltuoufficiostampa.it
  admin.casa.it.login.aspx.ducatidetroit.com
+admin.casa.it.login.aspx.slaghuistv.com
  admin.drivercheckcall.com
  admin.educacionvial.cl
  admin.foa.ae
@@ -160365,6 +152821,7 @@ admiradoresdaumbanda.com.br
  admiral-markets.com
  admiralmarketsltd.com
  admirelog.com
+admiring-goldstine-f942bc.netlify.app
  admiring-mcclintock-863f18.netlify.com
  admission.tuf.edu.pk
  admission.undip.org
@@ -160485,6 +152942,7 @@ adrushta.000webhostapp.com
  adrynroitlhyqmhw-dot-millinium.ey.r.appspot.com
  ads-checkmarketing-activity-reviewaccountivityatacheck.xyz
  ads-facebook.ga
+ads-fb-posting-3242345-id32372647253.com
  ads-fbstatistic.com
  ads-giris.com
  ads-google-think.blogspot.com
@@ -160511,6 +152969,8 @@ adsazpeigjxspxno-dot-millinium.ey.r.appspot.com
  adsbusinessaccountcredits.com
  adsbusinessaccountscoupon.com
  adsbusinesscampaigncreditaccount.com.denemexyz.xyz
+adsbusinesscampaing.com
+adsbusinesscouponcampaign.com
  adsbusinesscouponcredits.com
  adsbusinesscouponscampaigns.com
  adsbusinesscouponscreditaccount.com.denemexyz.xyz
@@ -160531,6 +152991,7 @@ adscouponscredit.com
  adscouponscreditaccounts.com
  adscouponscreditbusinesscampaign.com
  adscouponscreditcampaignaccount.com
+adscreditaccountcoupons.com
  adscreditaccountscampaigncoupons.com
  adscreditcoupons.com
  adscreditcouponsaccount.com
@@ -160540,6 +153001,7 @@ adsedsasfcsea.xyz
  adseguro.com.br
  adsense-community.info
  adsensetipsntricks.info
+adserfcbshjyted.xyz
  adservicemail-001-site1.1tempurl.com
  adsewrfdsfgcsd.xyz
  adsfactory.mobi
@@ -160549,6 +153011,7 @@ adsfcbwrtds.xyz
  adsfcbwrtscdws.xyz
  adsfexd19.xyz
  adsfvchgytrexds.xyz
+adsfweaoiashndfiawuhxuvcbhygvaoskjnfdawswas.toh.info
  adsgetapi.com
  adsgstncksfdfcbws01.my.id
  adsintcampaign.com
@@ -160598,7 +153061,6 @@ adv-repair-2020.my.id
  adv55555555555555555555ancedenablecertificatedpages017300120124.enable-advance-certificate-of-pages-notify-711756664752020487.my.id
  advait.us
  advaitatours.com
-advanc5555555ednabl45555555ecertificatedp555555ages029300120124.advanced-enable-certificated-pages-0636346436624655020.my.id
  advance-check.com
  advance-enable-certificate-of-pages-notify.my.id
  advance-hmrc.com
@@ -160612,6 +153074,7 @@ advanced-enable-certificated-pages-043300120124.tk
  advanced-enable-certificated-pages-044300120124.tk
  advanced-enable-certificated-pages-045300120124.tk
  advanced-enable-certificated-pages-052634643662020.tk
+advanced-enable-certificated-pages-0636346436624655020.my.id
  advanced-enable-certificated-pages-067634643662020.tk
  advanced-enable-certificated-pages-071634643662020.tk
  advanced-enable-certificated-pages-079634643662020.tk
@@ -161500,6 +153963,7 @@ ahappydesigner.com
  ahapropertisyariah.com
  ahavietnam.com.vn
  ahb-sbuaubsnmw.com
+ahbfhlqams.duckdns.org
  ahbywwtbxccvkkba-dot-millinium.ey.r.appspot.com
  ahccksevnfmngncmxp.top
  ahceibpdkxlcmnes-dot-millinium.ey.r.appspot.com
@@ -161622,6 +154086,7 @@ aib-scasettings.com
  aibaccountreview.live
  aibat.ru
  aibd.sn
+aibverifypayment.com
  aicaiqwpvjhpqesulkhjlyhgjq-dot-gleowayel400503.uc.r.appspot.com
  aicegrz.goruli.com
  aiceita.co.za
@@ -161807,7 +154272,6 @@ airbnbroo4.temp.swtest.ru
  airbnbroom.temp.swtest.ru
  airbnbtoom.temp.swtest.ru
  airborncor.com
-airborne.pw
  airborneclub.com
  airbornegroup.in
  airbornmotorscom.batwoqisep.top
@@ -161843,6 +154307,7 @@ airlydia.com
  airma.uz
  airmaildata.com
  airmanselectiontest.com
+airmaxcargo.site
  airmaxx.rs
  airmaxzoomturkey.com
  airmidhealthgroup.com
@@ -162469,9 +154934,11 @@ alert-disableupdate.servebeer.com
  alert-fb-security-account.nogueiracontabil.com
  alert-messageunderrequest.xyz
  alert-microsupportevadav.xyz
+alert-newdevice-attempt.link
  alert-newpayee.com
  alert-payee-detected.cc
  alert-paypal.me
+alert-ppl.xyz
  alert-security-uk.com
  alert-security.billingmeparde.com
  alert-security.servepics.com
@@ -162833,6 +155300,7 @@ alistblogging.net
  alitamo.us
  aliva.ca
  alivecomputerservice.top
+alivesupportcenter.com
  alivianutricion.com
  aliyavari.ir
  aliyeff.com
@@ -162890,6 +155358,7 @@ allaccountsseller.com
  alladsonline.co.za
  allage.at
  allahblesspalestine.000webhostapp.com
+allahbot.000webhostapp.com
  allahggdrop.xyz
  allamatberedare.se
  allamazon-company.com
@@ -163136,7 +155605,6 @@ almightypouldn.com
  alminarensemble.cl
  almintanode.shaxiasay.top
  almira.es
-almirelora.ru
  almirnapoleao.com
  almohada-dormir-bien.com
  almondhairistanbul.com
@@ -163446,12 +155914,10 @@ amaarhomes.ca
  amaasezon.com
  amaazon.buzz
  amaazon.top
-amaazonb.buzz
  amaazone.xyz
  amaazonh.xyz
  amaazonk.buzz
  amaazonk.xyz
-amaazonm.buzz
  amaazonm.xyz
  amaazonn.buzz
  amaazonn.online
@@ -163461,15 +155927,14 @@ amaazonq.buzz
  amaazonr.buzz
  amaazonr.top
  amaazonu.buzz
-amaazonv.buzz
  amaazonw.buzz
-amaazonx.buzz
  amaazony.xyz
  amaazonz.xyz
  amaazooncojp.icu
  amabai.org
  amabelloinfo.shaxiaoh.top
  amaccount.4a311d6b080a1500c67343.xyz
+amaccount.77beced7e5645ffc5d4c51ba7ed9.monster
  amaccount.f56b0a94a311d1280a150.top
  amaccount.feb4def7daf0619cbd37d6a81.monster
  amaccount.t94a311d1280a1500c67343.icu
@@ -163535,6 +156000,7 @@ amanvedanth.com
  amaone.co.ja.ruqrieujenfapleokxnuqisoxj.top
  amaonnoa.com
  amaonz-mail.xyz
+amaonzo.co.jp.signinog-amnzoc.in
  amaozn.co.jp.aw0.co
  amaozn.co.jp.dankegongyu.co
  amaozne.webstarterz.com
@@ -163575,6 +156041,7 @@ amatiran.online
  amatnage.gq
  amatormusic.com
  amaxillo.com
+amaxownxms.com
  amaxrhzwtzzcsjpuppskwxrqpv-dot-gleowayel400503.uc.r.appspot.com
  amaxzonprime-get100result.mailsignatureportable.com
  amayayurveda.com
@@ -163772,6 +156239,7 @@ amazon-check-co-jp.7o1.top
  amazon-check-co-jp.a1i.top
  amazon-check-co-jp.cfoyo.top
  amazon-check-co-jp.e1z.top
+amazon-check-co-jp.fdsfsd.buzz
  amazon-check-co-jp.fuogc.top
  amazon-check-co-jp.h1s.top
  amazon-check-co-jp.ifnd.top
@@ -163973,6 +156441,7 @@ amazon-service-alert.lordgoladsmunah.com
  amazon-serviceaccount-verifyamazon.gleeze.com
  amazon-serviceaccountsinformation.loseyourip.com
  amazon-serviceappid.myvnc.com
+amazon-servicepaymentaccount-webapsslogin.giize.com
  amazon-services-authfollow.season-key.com
  amazon-services-de.in
  amazon-services-de.ind.in
@@ -164042,6 +156511,7 @@ amazon-updatecovid19.gleeze.com
  amazon-updatefor-covid19.giize.com
  amazon-updatefor-covid19.gleeze.com
  amazon-updateinfo.helpsecurity.notice-support01.com
+amazon-updatepay.serveirc.com
  amazon-updates-payyments.theworkpc.com
  amazon-updates1005-accounts01-info-secure05.dynamic-dns.net
  amazon-updatetly.ddns.net
@@ -164119,6 +156589,7 @@ amazon.co-jp-login.shop
  amazon.co-jp.token-0xmk9tbqaxhvlkxu0mkulmfc.drive-apple.com
  amazon.co-jp.xyz
  amazon.co-login.jp
+amazon.co.2n1ne12nkmsdnqbwbdqbdwq.zhongba.tk
  amazon.co.jp-account.top
  amazon.co.jp-adminlogin.dskfjk9yuh980s.info
  amazon.co.jp-disable.com
@@ -164256,6 +156727,7 @@ amazon.co.jp.amirkenneddd1.monster
  amazon.co.jp.amx42ca362xcanbvxzsa.net
  amazon.co.jp.amzcoffee.com
  amazon.co.jp.amzm.shop
+amazon.co.jp.amznxckd.buzz
  amazon.co.jp.amzodssd.buzz
  amazon.co.jp.analtub.com
  amazon.co.jp.anayoiaudfonbv13fgcvbnnm.buzz
@@ -164391,6 +156863,7 @@ amazon.co.jp.gzddf.cn
  amazon.co.jp.gzhjkr.ph
  amazon.co.jp.gzhrkf.ph
  amazon.co.jp.gzhzkk.ph
+amazon.co.jp.hbckt.cn
  amazon.co.jp.hfng.vip
  amazon.co.jp.hgfhgjgfghjdk.top
  amazon.co.jp.hnss.com.pk
@@ -164440,6 +156913,7 @@ amazon.co.jp.link.updateto.id-586922365.confirmaccountupdate.com
  amazon.co.jp.login-amazon.co
  amazon.co.jp.m1-2-lkodk-2lo-m13.zthqkq.ph
  amazon.co.jp.m1t2w46ewx15ag69whqa.shop
+amazon.co.jp.m9y.cc
  amazon.co.jp.maoqp0jv9hf.u0005512m0125jp.m005jp3366.info
  amazon.co.jp.mb1va2e9fw9fwnmy.monster
  amazon.co.jp.mds3rw54ev154hb6r4g6.bid
@@ -164559,6 +157033,7 @@ amazon.co.jp.zenkevvichsudisslav.tokyo
  amazon.co.jp.zoan.shop
  amazon.co.jp.zwhtkz.ph
  amazon.co.jp.zzcoffee.cf
+amazon.co.kjbdaisasd.law
  amazon.co.uk.0psp.ru
  amazon.co.uk.2j0q.ru
  amazon.co.uk.8ij8.ru
@@ -164619,6 +157094,7 @@ amazon.cormfys.com
  amazon.customer.order-summary.co.uk
  amazon.customer.updates.homes-login.com
  amazon.customes-jp.xyz
+amazon.dctchiropractic.com.au
  amazon.de-ap-signin-encoding-utf8-ignoreauthstate-xz4.ru
  amazon.de-gp-cssc.ml
  amazon.de.openid315561.acredkavil.tk
@@ -164712,6 +157188,8 @@ amazon.secureserviceuk.com
  amazon.security-uk-eu.com
  amazon.securty.live
  amazon.sellercentral-security.com
+amazon.sellercentralsid201.giize.com
+amazon.sellersignids91.gleeze.com
  amazon.service-team.ofiewhj.com
  amazon.service.dgshoppingmall.com
  amazon.services-now.info
@@ -164792,6 +157270,7 @@ amazonaav.xyz
  amazonaaw.buzz
  amazonaaw.xyz
  amazonaax.com
+amazonaccount.club
  amazonaccountcheck.weebly.com
  amazonaccountiosu.tobauis.com
  amazonaccountpaymnt.serveirc.com
@@ -164942,6 +157421,7 @@ amazonmnv.xyz
  amazonmon.top
  amazonmz.buzz
  amazonmzx.buzz
+amazonn-aoba.pw
  amazonn-coo.oaao.ph
  amazonn-coo.oiio.ph
  amazonn-disini-jp.pw
@@ -165016,6 +157496,7 @@ amazonunlockaccount.serveirc.com
  amazonupdate-loginpage-cojp.wearehereweb.xyz
  amazonupdate-verifyaccount.gleeze.com
  amazonupdate.co
+amazonupdate.co.jp.a42b68ac6351a.pw
  amazonupdate.digitalbalanceweb.com
  amazonupdate.serveirc.com
  amazonupdateestatementcontentlockd.giize.com
@@ -165121,6 +157602,7 @@ ambrosiapaintingllc.com
  ambrotypeshirked.net
  ambtcex.com
  ambulanceicu.com
+ambushbin.top
  amc-con.net
  amc-sonthofen.de
  amc.swiss
@@ -165210,6 +157692,7 @@ ameli-service.com
  ameliapi.beget.tech
  ameliewagner.xyz
  amelimirror.ir
+amelitafeliza.ru
  amell.ir
  amelunxenbiz.shaxiarecord.top
  amemaes50.com
@@ -165543,11 +158026,12 @@ ammataranet.shuiacause.top
  ammazon.monsoon-sale.co
  ammazona.buzz
  ammazond.buzz
-ammazono.xyz
+ammazonf.buzz
  ammazonp.buzz
  ammazonq.buzz
  ammazonr.buzz
  ammazons.buzz
+ammazont.buzz
  ammazony.buzz
  ammazzonnz.com
  ammedieval.org
@@ -165590,6 +158074,7 @@ amosleh.com
  amotach-cn.com
  amowceuamazon.monster
  amoy.biz
+amozamn-6dzbw.cc
  amozamn-e2gpx.cc
  amozamn-qbjz7.cc
  amozan-signinscure.servebeer.com
@@ -165764,12 +158249,12 @@ amzncdm.xyz
  amznncard.xyz
  amznprime-service.serveirc.com
  amznupdates-verificationrequired.zdviint.com
-amznxckd.buzz
  amzome.co.ja.zxamxzsdyl.top
  amzon-confirm.ddns.net
  amzon-update.unlock-seurmy.com
  amzon-verificatcon.com
  amzonad.bgwrzt.cn
+amzonallouttheactivityseptembre2020.giize.com
  amzoncustverify.3utilities.com
  amzoneid54620-jp.com
  amzons.000webhostapp.com
@@ -166136,6 +158621,7 @@ anies-sandi.ilmci.com
  anikklnzlejmdjpg-dot-millinium.ey.r.appspot.com
  animalclub.co
  animalfootprints.org
+animalgiftideas.icu
  animalhospital.groundwork-partners.jp
  animaljambetarewritten.000webhostapp.com
  animalkeepers.icu
@@ -166160,6 +158646,7 @@ anisha-patel.com
  anisoph.com
  anita5437543.xyz
  anitaarneitz.at
+anitacsantiago.com
  anitavanmegen.com
  aniventure.co.uk
  aniversario-e-nosso-presente-e-seu.com
@@ -166178,6 +158665,7 @@ anjqzuxhwiikcpfbpqysnqlkcr-dot-gleowayel400503.uc.r.appspot.com
  anjuman-e-islamhubli.com
  anjumanpolytechnichubli.com
  anjumpackages.com
+anjzfwyxgs.002.sh.cn
  ankama-account.live
  ankama-accueil.com
  ankama-actualites.com
@@ -167089,8 +159577,11 @@ app-post-suisse-ch.com
  app-regularizecadastrobb.com
  app-reports.curiousmedia.com
  app-resgatesuasmilhasemate24hrs.com
+app-review-1485.info
+app-review-1637.info
  app-review-2613.info
  app-review-3244.info
+app-review-4171.info
  app-review-5138.info
  app-review-6530.info
  app-review-7512.info
@@ -167120,6 +159611,7 @@ app-support-pages-society-2020.co
  app-support-pages-society-depart-2020.co
  app-support.request-details.com
  app-t-mobile.com
+app-updatehalifax-secureonlinesupport.com
  app-updateuserid.serveirc.com
  app-verified.com
  app-verifyamazon.serveirc.com
@@ -167135,6 +159627,7 @@ app.applymailproblemchanges.com
  app.appstore.payment-service.gebvea.com
  app.asilm.cn
  app.atualizacaodedados.link
+app.auth-informationaccount.verify.billingsecureid-de.cf
  app.autoappbba.tk
  app.bbatualize.com
  app.beepn.pw
@@ -167509,6 +160002,7 @@ apple-info.co
  apple-international-verification.oscartechs.website
  apple-invoicepay.serveirc.com
  apple-ios-gps-slgn-ln.us
+apple-ip.top
  apple-itempurchases.serveirc.com
  apple-jp.cc
  apple-lbusca.com
@@ -167913,6 +160407,7 @@ apple.ioszr.com.cn
  apple.iphone-id-inc.us
  apple.jp.kyptzn.top
  apple.jp.ooa.fm
+apple.jp.ooc.ag
  apple.jp.scfbkp.top
  apple.jp.ydnfmr.top
  apple.korea-kr.com
@@ -167935,6 +160430,7 @@ apple.ooc.fm
  apple.phoneidtw.com
  apple.publina.com
  apple.restoreserver1.com
+apple.roomscash.xyz
  apple.service-usersresponses.cybersolutionstz.com
  apple.sign-in-gps-iphone.us
  apple.sign-in-gps.us.com
@@ -168401,6 +160897,7 @@ appleld-apple.accountlocked-page.us.suitkilo.com
  appleld-apple.accountlocked-pageid.lalapanasw.com
  appleld-apple.accountlocked.page-id.feedback.dudqret.com
  appleld-apple.accountlocked.page.logins.id.bhneheheah.com
+appleld-apple.accountlocked.page.us.qwertying-6.com
  appleld-apple.accountlocked.pageid.verifynows.com
  appleld-apple.accountlockeds-feedback.us.kintillol.com
  appleld-apple.accountlockeds-pageid.ghaedgeadvertising.com
@@ -168433,6 +160930,7 @@ appleld-apple.securesaccount-feedback.us.mtiriea.com
  appleld-apple.securesaccount-page.us.strncmp.com
  appleld-apple.securesaccount-pageid.theyagea.com
  appleld-apple.securesaccount-us.pageld.casekntl.com
+appleld-apple.securesaccount.id-page.salcersgc.com
  appleld-apple.securesaccount.page.feedback.opioibhes.com
  appleld-apple.securesaccounts-feedback.page.cgogs.com
  appleld-apple.securesaccounts-us.pageld.awdhahwa.net
@@ -168447,6 +160945,7 @@ appleld-appsecure.serveirc.com
  appleld-appsecureds.serveirc.com
  appleld-appsecureld.serveirc.com
  appleld-appsecurely.serveirc.com
+appleld-appssecured.serveirc.com
  appleld-appsupdated.serveirc.com
  appleld-appsverifyl.serveirc.com
  appleld-limiteacc.serveirc.com
@@ -168456,6 +160955,7 @@ appleld-limitsapps.serveirc.com
  appleld-manageacces.serveirc.com
  appleld-mysecureacc.serveirc.com
  appleld-recoveryacc.serveirc.com
+appleld-securedaccs.serveirc.com
  appleld-securedsapp.serveirc.com
  appleld-securesaccs.serveirc.com
  appleld-securesigns.serveirc.com
@@ -169106,6 +161606,7 @@ aproveiteamaiorlojaonline.com
  aproveiteblackoff.64-b.it
  aproveitegrandediadecomprarbarato.club
  aproveitehojee.online
+aproveitemegablacksuperoff.com
  aproveitemesdejulho.com
  aproveiteojavirtualofreta.com
  aproveitesempreconsciente.com
@@ -169195,6 +161696,7 @@ aquahlppge01recvrcnfrm01.my.id
  aquai.pl
  aquapremium.net
  aquarell.spb.ru
+aquariahub.com
  aquariumfishblog.com
  aquariumsbydennis.com
  aquariushand.com
@@ -169963,7 +162465,6 @@ arubiavgf.monster
  arufels.com
  arumment.xyz
  arundarekar.com
-aruntech.xyz
  arures.000webhostapp.com
  arushaone.co.tz
  arux.gikorip.net
@@ -170023,6 +162524,7 @@ asadairtravel.com
  asadarifphotographyfilms.com
  asadebokep01.000webhostapp.com
  asadedektor.com
+asadochatting.cf
  asafe.com.br
  asahdesigns.co.uk
  asakashi.online
@@ -170351,6 +162853,7 @@ askpharma.co.uk
  asktech.io
  asktheneurosurgeon.com
  askthepiercingexpert.com
+askwadezigemaneaswanjay.com
  askyounow.com
  asl.teudeynskla.com
  asldesign.org
@@ -170390,7 +162893,6 @@ asodeuwgbeads.com
  asoehqjmmlckuxtp-dot-millinium.ey.r.appspot.com
  asoerxzs.000webhostapp.com
  asofezrh.gikorip.net
-asojournerproject.com
  asoklaxcugysropjjsyliorgin-dot-gleowayel400503.uc.r.appspot.com
  asokopro.com.ar
  asolucaonetwork.com.br
@@ -170404,6 +162906,7 @@ asparkter.net
  aspas.ru
  aspasnetwork.cloudaccess.host
  aspcindia.com
+aspdwe-71.cf
  aspectivesolutions.com
  aspenclone.org
  aspendigitallife.com
@@ -170574,6 +163077,7 @@ assurancesproetrangercom.shuiacontrast.top
  assure.ameli.fr.assurance-maladi.com
  assuredgunner.com
  assxs.xyz
+assyatransports.fr
  ast-ug.kz
  astacefaim.com
  astakozy.com
@@ -170624,6 +163128,7 @@ astraone.casacam.net
  astrixantechnologies.com
  astro-icsa.ru
  astro-mist.ru
+astro-voyance-coaching.fr
  astroamericanchenical.com
  astrocorfu.gr
  astrocricketpredictions.com
@@ -170748,7 +163253,6 @@ ataristore.xyz
  atasehirrehberi.net
  atasehirtadilattesisatci.com
  atatatttt.weebly.com
-atattmaniliyaho.weebly.com
  ataulizarwapdigital.com
  atayahotels.com
  atazomna.weebly.com
@@ -170837,6 +163341,7 @@ atf0poyy0tryyl.godaddysites.com
  atfalanabeebturkey.com
  atfbd.com
  atfqngkrqmypiouu-dot-millinium.ey.r.appspot.com
+atfs.online
  atftcwpdjwwfanbe-dot-millinium.ey.r.appspot.com
  atg7yhp0t45tlty.godaddysites.com
  atgdfd.weebly.com
@@ -170898,7 +163403,6 @@ ativar-50milpontos.ml
  ativar-acesse.com
  ativar-app.ml
  ativar-app.tk
-ativara.digital
  ativarmeuacess0.me
  ative.nl
  atjhqmqqxopafgejjazgfangzs-dot-gleowayel400503.uc.r.appspot.com
@@ -171018,6 +163522,7 @@ att-control-panel.weebly.com
  att-covid19.com
  att-csptickets.com
  att-currently-centre.weebly.com
+att-currently-sbcglobal.weebly.com
  att-currently-sign-in.weebly.com
  att-customer-rewards.com
  att-customermailsupport.000webhostapp.com
@@ -171222,6 +163727,7 @@ attdomainliinks.weebly.com
  attdomainlinkupdate.weebly.com
  attdomainlog.weebly.com
  attdomainmainservices.weebly.com
+attdomainsaveserice.weebly.com
  attdomainservicee.weebly.com
  attdomainservicess.weebly.com
  attdomainservicest.weebly.com
@@ -171435,6 +163941,7 @@ attmailonlineverificationupgardeaccount.weebly.com
  attmailpro.weebly.com
  attmailprovider.weebly.com
  attmailsecure.weebly.com
+attmailserverconnect.weebly.com
  attmailserverlogin.weebly.com
  attmailservice123.weebly.com
  attmailservicedesk.weebly.com
@@ -171530,6 +164037,7 @@ attnetwerhshealertconnect.weebly.com
  attnetwirbweorkconnection.weebly.com
  attnetworkalertconecth.weebly.com
  attnetworkconnect.weebly.com
+attnetworkload.weebly.com
  attnetworkupload.weebly.com
  attnetworkuptoo.weebly.com
  attnetwotrjjuconnetion.weebly.com
@@ -171615,6 +164123,7 @@ attractionsinwesterncape.top
  attractiveassembly.com
  attractivetrade.com
  attreal.weebly.com
+attrepairservice.weebly.com
  attreplay.weebly.com
  attres.000webhostapp.com
  attrfn.net
@@ -171749,6 +164258,7 @@ atttnerbxbjolarealteeserive.weebly.com
  atttnesyt.weebly.com
  atttnetcom.weebly.com
  atttnetservicecomm.weebly.com
+atttonllllinee.weebly.com
  atttsdhd0000oooeere0000ooo.weebly.com
  atttservice.yolasite.com
  atttservices.weebly.com
@@ -172368,6 +164878,7 @@ auth.netflix.logs.com.khanza.biz.id
  auth.pageid-support.appleid.apple.com.farleysbsikuit.com
  auth.scotiaonline.scotiabank.com.wo-ix.com
  auth.scotiaonline.scotiabank.com.wzx-ox.com
+auth.scotiaonline.scotiahanhs.com
  auth.secureinformation.verify.billingproblem-de.cf
  auth.suportingforyounowfr.com
  auth.ubrbonos.com
@@ -172414,6 +164925,7 @@ authenticate-device-online.com
  authenticate-halifax-device.com
  authenticate-help.com
  authenticate-info.com
+authenticate-lloydsbank.co.uk
  authenticate-login-advanced-security.com
  authenticate-login-pp-details.com
  authenticate-recovery.com
@@ -172460,6 +164972,7 @@ authorcheck.com
  authorisable-closur.000webhostapp.com
  authorisation-support.com
  authorisationsecured.com
+authorise-accounts.com
  authorise-cancellation.cc
  authorise-device.co.uk
  authorise-mobilebanking.com
@@ -172474,6 +164987,7 @@ authorisepayments.org
  authoriseyouracc.000webhostapp.com
  authorization-login-account.site
  authorization.instag.repl.co
+authorizationsupportcascade.000webhostapp.com
  authorize-billing.servehttp.com
  authorize-payee.cc
  authorize-secure-paypa.com
@@ -172494,6 +165008,7 @@ authormacchaz.com
  authorwed.com
  authourize-paypal0.serveirc.com
  authowawebmailgo.com
+authpayee-hali.com
  authpaym-halifax.com
  authpayments-secure.com
  authref-historypay-enid0973611.ml
@@ -172505,6 +165020,7 @@ authsecure-unauthorized.com
  authsecuredocumentdbx4f8ehsmumqauemoffice15.azurewebsites.net
  authsecurepagr.ir
  authsecurity.tk
+authservamzverify.com
  authservicebilling.myvnc.com
  authsharepoint0ndqnqdanesreoo0o0othdhn.s3-ap-northeast-1.amazonaws.com
  authsignin1c-amaz0n.serveirc.com
@@ -172571,7 +165087,6 @@ autodemontagenijmegen.nl
  autodepannage.ch
  autodesk-com-dot-gl494903049.wl.r.appspot.com
  autodiscover-83303.web.app
-autodiscover-owa-securitypanel.glitch.me
  autodiscover-owa.ultco-us.com
  autodiscover-owa2.web.app
  autodiscover.accountverification.online
@@ -172874,6 +165389,7 @@ avito-payn.ru
  avito-paysecure.pro
  avito-reserv.ru
  avito-rus.ru
+avito.co-pay.be
  avito.delivery-orders.ru
  avito.forma-pay.ru
  avito.oplatapay.su
@@ -173576,6 +166092,7 @@ azzhplehoslogkunabsver.my.id
  azzil1.info
  azzmtool.com
  azzqqtlukectgqrd-dot-millinium.ey.r.appspot.com
+azzsposc.000webhostapp.com
  azzunapedia.com
  azzvzs.000webhostapp.com
  b-0-f-a.com
@@ -173782,6 +166299,7 @@ babi24ngepet.tukang-lompat.com
  babikauamazon.servecounterstrike.com
  babireinc.com
  babkastilak.000webhostapp.com
+babo.great-site.net
  babobando.ga
  babochek-kukolki.ru
  babolat-jobs.com
@@ -174035,6 +166553,7 @@ baichoi.tranbaocuong.top
  baicomtechng.com
  baidaremis.lt
  baidu.honker.info
+baiduthi1.xyz
  baiduthi2050.xyz
  baiduwanba.com
  baiduyisheng.com
@@ -174163,6 +166682,7 @@ balimeilitravel.com
  baliplantation.com
  balirichtuban.com
  balispadallas.com
+balisterait.com
  balistreriwell.buzz
  balitransithotel.com
  baliwholesalemarket.com
@@ -174355,8 +166875,16 @@ bancodelpacifici.webcindario.com
  bancodelpacificl.webcindario.com
  bancodelpacifico.in.net
  bancodelpacificx.webcindario.com
+bancodelpacifioa.webcindario.com
+bancodelpacifiod.webcindario.com
+bancodelpacifiog.webcindario.com
+bancodelpacifiol.webcindario.com
+bancodelpacifion.webcindario.com
+bancodelpacifioq.webcindario.com
  bancodelpacifiot.webcindario.com
+bancodelpacifiov.webcindario.com
  bancodelpacifiox.webcindario.com
+bancodelpacifioz.webcindario.com
  bancodelpacifise.webcindario.com
  bancodelpacifisi.webcindario.com
  bancodelpacifiso.webcindario.com
@@ -174956,6 +167484,7 @@ bargraffiti.com
  bargsoas-maoso.com
  barhampacking.com.au
  barheartyou.com
+bariach-lock-service.co.il
  bariatricfusionme.com
  bariindaga.000webhostapp.com
  barij-essence.ru
@@ -175005,6 +167534,7 @@ barotechf.gq
  barotechf.ml
  barotechf.tk
  barperez.xyz
+barrenproductivevideogames.figueroaads123.repl.co
  barriobistro.com
  barristerstevemoore.com
  barrmatchs.com
@@ -175176,7 +167706,6 @@ baubuchecom.nckila.gdn
  bauer-total.de
  bauers.nu
  bauertree.com
-bauhzjoyfudjnmnklixbpaqmhqkbvqzkqosx-dot-offglen.uk.r.appspot.com
  baulaung.org
  baumemekbot.cupboardcons.com
  baumerteam.org
@@ -175382,6 +167911,7 @@ bbs.chudance.com
  bbs.idol-project.com
  bbs.tax-helper.info
  bbs.zgfhl.com
+bbseguranca.digital
  bbsignage.com
  bbsmobler.se
  bbsolucoesdigitais.com
@@ -175441,7 +167971,6 @@ bcards.sucure-uk.ga
  bcbdbsodcowkdbqu-dot-millinium.ey.r.appspot.com
  bcbkhnccyxqiawzzbxahehbwoy-dot-gleowayel400503.uc.r.appspot.com
  bcblxbgoqdwxltboxuzwdadtinpnmjphiyyk-dot-cryptic-now-290917.ey.r.appspot.com
-bccom-bc.com
  bccr-certificado.com
  bccr-digital.com
  bccrdigitalcr.com
@@ -175556,6 +168085,7 @@ bcpzonasegura-viabcp.br-cov.com
  bcpzonasegura-viabcp.es-cuz.com
  bcpzonasegura-viabcp.na-cop.com
  bcpzonasegura-viabcponline.jp-bcs.com
+bcpzonasegura.hindi-sayari1.com
  bcpzonasegura.sviabcp.com
  bcpzonasegura.viabcps.digital
  bcpzonasegura.viabcps.link
@@ -175990,6 +168520,7 @@ beca.goruli.com
  becakgalonkencang13.guhweoro.com
  becamputahor.biz
  beccahorner.com
+beccapect.digital
  beccu.link
  becharakam.ddns.net
  bechemical.net
@@ -176034,7 +168565,6 @@ beditychliondatana.xyz
  bedmatchst.com
  bednarscy.pl
  bedradingsschemaz.theworkpc.com
-bedraggled-combinat.000webhostapp.com
  bedrijfinkaart.nl
  bedroom.hairstylesday.com
  bedroomcritic.com
@@ -176108,7 +168638,6 @@ beheer-29.info
  beheshtsoft.com
  behfarmer.com
  behighrewind.com
-behind-nameplates.000webhostapp.com
  behkerepair.com
  behmining.com
  behnasan.com
@@ -176275,7 +168804,6 @@ bemaxx.in
  bemedic.digital
  bemeom.com
  bemindfulmich.com
-bemmvpgxcpkeeivqcqtpqxwzvlmvtbueiqwh-dot-offglen.uk.r.appspot.com
  bemnessa.com.br
  bemsnet.com
  bemtgfbmebjyimjctopzwuhwps-dot-gleowayel400503.uc.r.appspot.com
@@ -176480,6 +169008,7 @@ bermuda666.000webhostapp.com
  bermudaztudio.com
  bernardoalamos.com
  bernardspal.com
+bernettatuesday.ru
  bernexxuspzkpbce-dot-glexcel1.ue.r.appspot.com
  bernhardheld.de
  bernierislands.buzz
@@ -176870,6 +169399,7 @@ bethesdaalur.org
  bethhorner.com
  bethhuuqbmklypdq-dot-millinium.ey.r.appspot.com
  bethjester.com
+bethlehemcharityandorphange.com
  bethlouella.com
  bethmichaelsevents.com
  bethrow.co.uk
@@ -177083,6 +169613,7 @@ bgcreativedesigns.com
  bgdclvvernrnsqgn-dot-millinium.ey.r.appspot.com
  bgdirectory.net
  bgeneraal.webcindario.com
+bgeneral-403.cba.pl
  bgeneral-sesion.webcindario.com
  bgeneral-sesion2.webcindario.com
  bgeneral1.webcindario.com
@@ -177534,7 +170065,6 @@ billing-portal-three.com
  billing-ref254.com
  billing-renewal.com
  billing-secure.co.uk
-billing-secured.co.uk
  billing-secured.com
  billing-sep20-three-uk.stasmobila.ro
  billing-setup.uk
@@ -177557,7 +170087,6 @@ billing-verify.info
  billing-vodafone.com
  billing.3dsecure.uk
  billing.3my-account.com
-billing.eemylogin.com
  billing.hypercode.ca
  billing.netflix.user.solution.id2.client-redirection.com
  billing.o2-secure.com
@@ -178163,6 +170692,7 @@ bkprqerxqbldzonslyktrhpgahecqfoaapbv-dot-cryptic-now-290917.ey.r.appspot.com
  bkps11.duckdns.org
  bkpsange63.zzux.com
  bkpsugionovsmiakhalifa.m-whatsapp.ml
+bkpwhtaspp.whatsappyub.tk
  bkpwhyaaa.hoaztbokep.ga
  bkqhvpvbglhrekgw-dot-millinium.ey.r.appspot.com
  bkrb.gazengel.com
@@ -178318,7 +170848,6 @@ blazztgroup.com
  blbxvsviteyzcvggqwbgjbdpuzadypijsufi-dot-cedar-code-289917.nn.r.appspot.com
  blck66rmh001.my.id
  blck999rmh01.my.id
-blckcbe.com
  blckfrdcreative.com
  blckgoldd.com
  blcpqkrgfqgsutovyezlctvkrc-dot-gleowayel400503.uc.r.appspot.com
@@ -178439,6 +170968,7 @@ blockerinformationxmaxs.com
  blockford.buzz
  blockmarketplace.asia
  blockme.ug
+blockpayee-secureinfo.com
  blockprobably.com
  blocomplimited.biz
  bloemistvlijmen.nl
@@ -178544,6 +171074,7 @@ blog.ruthlopezbeautyconcept.com
  blog.s-se.ru
  blog.saigon247.vn
  blog.sanaozel.site
+blog.scarletskitchen.co.uk
  blog.schlichte.xyz
  blog.skrap.xyz
  blog.smyrnaweb.com
@@ -178720,6 +171251,7 @@ blueheartfeed.com
  bluehillsvillage.com.au
  bluehost.theoceanweb.com
  bluehots18th.000webhostapp.com
+blueigtickform.com
  blueins.0fees.us
  blueion.com.au
  bluejwebdesigns.com
@@ -178782,6 +171314,7 @@ blufoutantib.tk
  blugsf.lang0.cn
  bluhltgrrhgarkbl-dot-millinium.ey.r.appspot.com
  bluishknare.com
+bluishperilous.top
  blulinknetwork.com
  blumarsrlcom.shaxiarecord.top
  blumenbintigcom.shaxiasay.top
@@ -178908,6 +171441,7 @@ bndmjdk.com
  bndwx.com
  bnemati.ir
  bnet.aaplumb.org
+bnet.becomingmyownboss.biz
  bnet.dinevenice.com
  bnet.donnaleejones.com
  bnet.sellstatemillenniumrealty.com
@@ -178915,6 +171449,7 @@ bnet.unveilinghealth.me
  bnf-6.onderhost.com
  bnforpari026.firebaseapp.com
  bnfwnjfoudwaevli-dot-millinium.ey.r.appspot.com
+bngfrbalkdetsdsank.com
  bngke-7854-com.preview-domain.com
  bngsmartshop.com
  bngwyuqmtmeabfjv-dot-millinium.ey.r.appspot.com
@@ -178959,6 +171494,8 @@ bnovvdoycziiyapfctaqusaaft-dot-gleowayel400503.uc.r.appspot.com
  bnp-activation.smartteacuppoodlepuppyhome.com
  bnp-belgium.com
  bnp-bk.000webhostapp.com
+bnp-registratie-be.com
+bnp-registratie-verlengen.com
  bnp-verlengen-be.com
  bnp-webbe.firebaseapp.com
  bnp-webmail.com
@@ -180086,21 +172623,26 @@ bqzgqdkjsfschupjst.top
  br-abayat.com
  br-brazil-netonline.com
  br-inc.ltd
+br-instagram.com
  br.com.ru
+br.fbook-00488302.safimmo.com
  br.fbook-02012362.safimmo.com
  br.fbook-02630169.safimmo.com
  br.fbook-04613923.safimmo.com
  br.fbook-05112674.safimmo.com
+br.fbook-05446918.safimmo.com
  br.fbook-06190526.safimmo.com
  br.fbook-06667378.safimmo.com
  br.fbook-06681535.safimmo.com
  br.fbook-06990592.safimmo.com
  br.fbook-07155809.safimmo.com
+br.fbook-07985378.safimmo.com
  br.fbook-08403131.safimmo.com
  br.fbook-10202866.safimmo.com
  br.fbook-11127844.safimmo.com
  br.fbook-11676316.safimmo.com
  br.fbook-13428889.safimmo.com
+br.fbook-13449417.safimmo.com
  br.fbook-14243007.safimmo.com
  br.fbook-14688103.safimmo.com
  br.fbook-14811228.safimmo.com
@@ -180131,16 +172673,20 @@ br.fbook-31260359.safimmo.com
  br.fbook-35978457.safimmo.com
  br.fbook-37420273.safimmo.com
  br.fbook-37755706.safimmo.com
+br.fbook-39611439.safimmo.com
  br.fbook-42847600.safimmo.com
+br.fbook-45888263.safimmo.com
  br.fbook-47014302.safimmo.com
  br.fbook-48044251.safimmo.com
  br.fbook-48299080.safimmo.com
+br.fbook-48531796.safimmo.com
  br.fbook-50427018.safimmo.com
  br.fbook-51527234.safimmo.com
  br.fbook-53114736.safimmo.com
  br.fbook-53687025.safimmo.com
  br.fbook-56616612.safimmo.com
  br.fbook-57130768.safimmo.com
+br.fbook-62536386.safimmo.com
  br.fbook-63490238.safimmo.com
  br.fbook-66190996.safimmo.com
  br.fbook-66344017.safimmo.com
@@ -180155,6 +172701,7 @@ br.fbook-70662564.safimmo.com
  br.fbook-70753400.safimmo.com
  br.fbook-71848625.safimmo.com
  br.fbook-74441008.safimmo.com
+br.fbook-74570843.safimmo.com
  br.fbook-76526223.safimmo.com
  br.fbook-79208991.safimmo.com
  br.fbook-83177411.safimmo.com
@@ -180166,6 +172713,7 @@ br.fbook-93858619.safimmo.com
  br.fbook-94449540.safimmo.com
  br.fbook-95148904.safimmo.com
  br.fbook-95769058.safimmo.com
+br.fbook-95972180.safimmo.com
  br.fbook-96546854.safimmo.com
  br.fbook-99220283.safimmo.com
  br.fbook-99457595.safimmo.com
@@ -180248,8 +172796,6 @@ brainfuck.site
  brainhorn.org
  brainloopsite.nckithailand.gdn
  brainmasterclasses.com
-brainmemory.buzz
-brainnewmainfeattaionmagic.us
  brainora.com
  brainpayments.com
  brainplow.com
@@ -180276,6 +172822,7 @@ bramblebaybowlsclub.com.au
  brambles-uk.com
  bramptonhairsalon.com
  branch.irfarabi.com
+branchcanecat.com
  brand-identity.in
  brandadvertising.cc
  brandagencyportland.com
@@ -180438,6 +172985,7 @@ brenda3721378.xyz
  brenda64534.xyz
  brendaladd.com
  brendamcfarland.com
+brendapotts73624.info
  brendenpunya.mskamksmkams.com
  brendfinefurniture.com
  brennerishere.xyz
@@ -180584,6 +173132,7 @@ brindisi.ml
  brindleandglass.buzz
  bringitbeats.com
  bringitupnow.weebly.com
+bringloverback.com
  bringmybillsdown.com
  bringthemlrd.ru
  brinkdev.eu
@@ -180826,6 +173375,7 @@ bruze2.ug
  brvlhmyhfoapfzhq-dot-millinium.ey.r.appspot.com
  brwb.addroits.com
  brwd.svcoding.com
+brwntechncal.com
  brxalprzgmifqqyqgpadurvfrdslyngqptfz-dot-solar-vertex-285913.rj.r.appspot.com
  bryanajeffries.com
  bryanbuchan.com
@@ -181227,6 +173777,8 @@ bugsbunnyy.com
  bugseason12.com
  bugseason13.com
  bugskinuc.com
+bugspinn.dnset.com
+bugspins15.dnset.com
  bugt.ga
  bugtkvgvqshcuablkctdvgnsbqewecpxucbe-dot-cedar-code-289917.nn.r.appspot.com
  bugunistanbul.com
@@ -181354,6 +173906,7 @@ bundlesbyb.com
  bunec.newweb.al
  bung-alkaf.id
  bungaabeauty.com
+bungakamboja.dns05.com
  bungeejumps.xyz
  bungkoos.com
  bungled-party.000webhostapp.com
@@ -181448,6 +174001,7 @@ buscar-dispositivo-ios.com
  buscar.iphone-app.info
  buscar.iphone-maps.info
  buscas.search-out.xyz
+busccampamentos.com
  buschfarbende.nckidoctor.gdn
  buseacycle.com
  buseguzellikmerkezi.com
@@ -181459,6 +174013,7 @@ bushilclasses.in
  bushireinlondon.co.uk
  bushub.com.ua
  businecessity.com
+businemanagemen.com
  businesinc.com
  business-247ltd.top
  business-center.app.link
@@ -181665,6 +174220,7 @@ buysellassignments.ca
  buysellez.com
  buyshell.co.s3-website.us-east-2.amazonaws.com
  buysmartgasii.top
+buysplitpen.cyou
  buytampahousesfast.com
  buyteches.top
  buythebest.pw
@@ -182437,6 +174993,7 @@ cajamar-alerta.com
  cajamar-es-caja-rural.bp-pt.com
  cajamargrup.com
  cajasparabotella.com
+cajaybolsasdesantander.com
  cajocalf.pt
  cakeboob.com
  cakecoati.com
@@ -182744,6 +175301,7 @@ canceled-options.servehttp.com
  canceledacc-payment.servehttp.com
  cancellation-immediate.com
  cancellation-payment.cc
+cancellation-payment.net
  cancellation-payment.uk
  cancellation-payments.info
  cancellation-removing.com
@@ -182824,12 +175382,14 @@ cannabiscanada.is
  cannabisdeals.co.uk
  cannabisenglish.com
  cannabisindustryexpos.com
+cannabismos.ca
  cannabispropertybrokers.com
  cannabistrademarket.com
  cannaherbalstore.com
  cannapillar.com
  cannaworld.io
  cannellandcoflooring.co.uk
+cannibalengine.monster
  cano.zapto.org
  canobit.com
  canon.myap.co.za
@@ -182847,7 +175407,6 @@ canstamber.me
  canstamber.net
  cansuyusulama.com
  cant1.club
-cantabrigian-slashe.000webhostapp.com
  cantana.booster-testing.com
  cantecme.xyz
  cantelemblaccurr.info
@@ -182950,6 +175509,7 @@ capitalone.acct-access.com
  capitalone.com.authsigninverified.top
  capitalone2u.com
  capitalonebank2u.com
+capitalonebankgroup.com
  capitalonebankgroup.ltd
  capitalonebnk.online
  capitalonedeclined.hopto.org
@@ -183107,7 +175667,6 @@ careficient.com
  careforthesheep.org
  carefullyinputto.opentoamazon.pw
  careinsurance247.com
-careless-sunset.000webhostapp.com
  carelifesfoundation.in
  carelinknurse.xyz
  caremeinternational.com
@@ -183425,6 +175984,7 @@ case-97780724.wavesofdesign.gr
  case-batle.ru
  case-battle.tk
  case-customer-apple.com
+case-gift.com
  case-id-4041.com
  case-id0233.com
  case-id0399.com
@@ -183474,7 +176034,6 @@ caseid-116191471.pale.pk
  caseid-125571759.pale.pk
  caseid-132556791.pale.pk
  caseid-148591662.pale.pk
-caseid-153469347.pale.pk
  caseid-171733723.pale.pk
  caseid-173144144.pale.pk
  caseid-190976986.pale.pk
@@ -183484,20 +176043,16 @@ caseid-235197321.pale.pk
  caseid-264272917.pale.pk
  caseid-277952372.pale.pk
  caseid-289346033.pale.pk
+caseid-311985625.pale.pk
  caseid-345953846.pale.pk
  caseid-37698908.saasconsulting.ae
  caseid-388896262.pale.pk
  caseid-411481720.pale.pk
  caseid-427006515.pale.pk
-caseid-430568255.pale.pk
-caseid-443772149.pale.pk
  caseid-473479937.pale.pk
  caseid-476159807.pale.pk
-caseid-476771551.pale.pk
  caseid-499550331.pale.pk
-caseid-552461829.pale.pk
  caseid-563612359.pale.pk
-caseid-580319071.pale.pk
  caseid-583494286.pale.pk
  caseid-652865990.pale.pk
  caseid-770667638.pale.pk
@@ -183506,14 +176061,10 @@ caseid-859590536.pale.pk
  caseid-862851228.pale.pk
  caseid-873032930.pale.pk
  caseid-88175997.saasconsulting.ae
-caseid-897985826.pale.pk
  caseid-927396753.pale.pk
-caseid-949670073.pale.pk
  caseid-956149615.pale.pk
  caseid-962170731.pale.pk
-caseid-976033890.pale.pk
  caseid-977316716.pale.pk
-caseid-979660947.pale.pk
  caseid-accountdisabel-uptedapple.yangterukirdalam.com
  casekolo.xyz
  caseleen.xyz
@@ -183703,6 +176254,8 @@ catskillvintageshop.com
  catslovingcats.com
  catswiz.com
  cattelenitalia.icu
+cattlemaidday.com
+cattlemaidday.cyou
  cattleyadessert.online
  cattskiespina.com
  catuto.cl
@@ -183959,7 +176512,6 @@ ccqmuulnjxwr.in
  ccquxnduhfexqjbnbn.top
  ccrushers.site
  ccs-assistantamazon.serveirc.com
-ccs1967-doc-auth.cf
  ccsau.com
  ccse.awaykart.com
  ccsnyc.kbmbk.com
@@ -184309,6 +176861,7 @@ cekrkdcmpaxukdhr-dot-millinium.ey.r.appspot.com
  cekrsppjtrddqnioaeosrmvgkc-dot-gleowayel400503.uc.r.appspot.com
  ceks-acounts01.000webhostapp.com
  ceks01-fages.000webhostapp.com
+cekuprzrjpcztpptda.top
  cel.dermals.org
  celall.com
  celanadalam-whatsappgrup.joins-wagrup10.cf
@@ -184333,6 +176886,7 @@ celensecurity.com
  celeratured.xyz
  celestemost.ddns.net
  celestialclean.com
+celestinoklinkoski.creatorlink.net
  celestinotrafficway.buzz
  celestron.pro
  celiamay.com
@@ -184421,6 +176975,7 @@ centerai.vot.pl
  centercitydogtraining.com
  centered-crawl.000webhostapp.com
  centerfax.tk
+centerforcopyright.com
  centerforsustainablehappiness.com
  centergeo.com.br
  centerhelps.com
@@ -184474,6 +177029,7 @@ centre-telephoneproinfo.web.app
  centrebill.com
  centreforitexcellence.com.au
  centrehotel.vn
+centreoutreach.org
  centricarepharmacy.com
  centriotticiesperti.it
  centripetal-bottoms.000webhostapp.com
@@ -184572,10 +177128,7 @@ cert-chase.com.a8f5f167f44f4964e6c998dee827110c.com
  cert-upgrservtrust.com
  certaintrouble.com
  certainvelvet.com
-certi77777777777777777ficatedpagesnvitationteam1623114541112020.advanced-enable-certificated-pages-0636346436624655020.my.id
-certifi00catedpages12120145411120200000000000000000000000000.advanced-enable-certificated-pages-0636346436624655020.my.id
  certifi777777777777777777777777777777catedpages1392014541112020.advance-enable-certificate-of-pages-notify-000300120124.my.id
-certifi77777777777777777catedpagesinvitationteam162034541112020.advanced-enable-certificated-pages-0636346436624655020.my.id
  certifiably.xyz
  certifica-app.info
  certifica-dati-personali-app.com
@@ -184906,6 +177459,7 @@ chalets4saisonsauquebec.ca
  chaletsaunord.ca
  chaletvalinouet.com
  chalicejury.com
+chalkmarketsea.cyou
  challengedcreditautos.com
  challengefools.com
  challengerllfts.com
@@ -185674,6 +178228,7 @@ chat-whatsappgvmu.xxuz.com
  chat-whatsappgvwm.xxuz.com
  chat-whatsapph.ygto.com
  chat-whatsappindovirall.free94.tk
+chat-whatsappjoinkangruppbokep.tk
  chat-whatsappku.hot1.shop
  chat-whatsappku1.v1z.shop
  chat-whatsappku18.fresh12.gq
@@ -185966,6 +178521,7 @@ chatwhatsapp2.giize.com
  chatwhatsapp2.top
  chatwhatsapp23346.ooguy.com
  chatwhatsapp235.ooguy.com
+chatwhatsapp24.zyns.com
  chatwhatsapp2435.ooguy.com
  chatwhatsapp259.giize.com
  chatwhatsapp26332.ooguy.com
@@ -185983,6 +178539,7 @@ chatwhatsapp642.giize.com
  chatwhatsapp872.giize.com
  chatwhatsapp981.giize.com
  chatwhatsapp998.giize.com
+chatwhatsappbgqblh4c0j950a5rsjqnlm.tk
  chatwhatsappbokep.myftp.org
  chatwhatsappbokep.xxuz.com
  chatwhatsappbokepindo.log-wa8.ml
@@ -186192,6 +178749,7 @@ checkmyaccounts-ee.com
  checkmyadress.com
  checkmybill-ee.co.uk
  checkmyinfo-ee.co.uk
+checkmyinfo-ee.com
  checkmynewphotos.com
  checkmypayee-online.com
  checkmypayee.com
@@ -186242,6 +178800,7 @@ checktodrivers.com
  checktrueworld.xyz
  checkuo11.xyz
  checkupassistantmlicroftupaccourntacceslivesecuiredirectsc.ga
+checkupdater.gq
  checkviolationis-temp376.ga
  checkvk.hop.ru
  checkwp.top
@@ -186252,6 +178811,7 @@ checviolatinaqes-temp.ga
  checviolatinaqes-temp0001.ga
  chedea.eu
  cheebuski.ml
+cheedpalm.com
  cheekie2.neagoeandrei.com
  cheematransxpressinc.com
  cheerfulgiversneverlack.com
@@ -186277,6 +178837,7 @@ chelatefor.cf
  chelitos.com.ve
  chelpil-inv-auth.com
  chelpil-inv-auth.org
+chelpil.ga
  chelseafc-dot-skype-meeting.uc.r.appspot.com
  chelseajane.com
  chelseamodel.cc
@@ -186547,6 +179108,7 @@ chipmarkets.com
  chippendaleslv.com
  chipsflix.com
  chiquigatito.com
+chiquiticasbellas.xyz
  chiquiticasdivertidas.xyz
  chiquiticasvideos.xyz
  chirbtwjxobwmcamouacywrnwb-dot-gleowayel400503.uc.r.appspot.com
@@ -186692,6 +179254,7 @@ chrissieperry.com
  chrissmith33.com
  christ-michael.net
  christaindiormgt.com
+christeanzitella.ru
  christian-communica.000webhostapp.com
  christian-financial.com
  christiancoffeemug.top
@@ -186970,7 +179533,6 @@ cincosiglos.org
  cind.shoesmogul.com
  cinderconstruction.com
  cinderellainvegascom.shaxiareal.top
-cinderellamargaux.ru
  cindiciated.info
  cindy-miller.xyz
  cindy84236288.xyz
@@ -187169,6 +179731,7 @@ citysammy.casacam.net
  citytrallbus.xyz
  cityvslyon.com
  citywerkz.com
+ciugq7834es.com
  ciuj.ir
  ciupekcapitalcoin.com
  civic-depth-281113.oa.r.appspot.com
@@ -187328,6 +179891,7 @@ cl-financial-departmnt.com
  cl-item-29898.com
  cl-p0st-id-92497238279.info
  cl-rbcroyalbank.com
+cl-verify-account.us
  cl.com-account-verification-02850183109.creditomio.com.mx
  cl.flagedposting.com
  cl005-t07.ovh
@@ -187346,6 +179910,7 @@ claim-hmrc.com
  claim-incubatorxm8.web1.holz3.x24hr.com
  claim-kbc.com
  claim-mytaxrebates-govuk.com
+claim-mytaxrefunds-govuk.com
  claim-pulsa-token-psbb.000webhostapp.com
  claim-tax-gov.uk
  claim-tax-rebate.com
@@ -187375,9 +179940,11 @@ claimgov-refund.cf
  claimgratis61.2waky.com
  claimhadiahgratisbulanjuni-eventgarena2020.topup9.com
  claimhexcrypto.com
+claiminfo3.ga
  claimitemff876.ml
  claimitempubg.otzo.com
  claimiventincu.guied7.my.id
+claimlatehip.com
  claimluckyspin.com
  claimmlbbevent.wikaba.com
  claimmpubgmobile.com
@@ -187430,6 +179997,7 @@ claralaluna.com
  clareiamente.clareiamente.com
  clarifyadjust.com
  clarifyproduction.com
+clarinelavena.ru
  clarislaborbuilder.com
  claritcentre.org
  claritybusinessfunding.com
@@ -187440,6 +180008,7 @@ clarkelectric-my.sharepoint.com
  claro-net-emta.aceite.fbiz.com.br
  clarrywillow.top
  clarve.club
+clashfailurepot.cyou
  clashmode0ivuz5.000webhostapp.com
  clasich.com
  clasificadoscochabamba.com
@@ -187505,7 +180074,6 @@ clavesecundariadina.zz.com.ve
  claw-ywca-169.com
  claybian.life
  claycenterks.xyz
-claycenterkz.xyz
  clayheart.com
  clayscalendar.com
  claytonclanprojects.dactylological.com
@@ -187642,6 +180210,7 @@ clickaffiche.com
  clickbackpacks.com
  clickbankbreakstheinternet.com
  clickbankstealth.com-best-bonuses.info
+clickbillinglink.atfacebook.net
  clickchic.ir
  clickdorm.com
  clickhail.com
@@ -187656,7 +180225,6 @@ clicknobaitsserverappstorehasbeencompletes.jamesmithor.com
  clicknojoinwhatsappbokep.benong.gq
  clicknojoinwhatsappbokep.idcom.gq
  clicknow-whatsapp.jav22.org
-clickontheonlinestatementslinkfromtheaccountactivitynbvcx539.000webhostapp.com
  clickonthewindmarketing.cf
  clickperfected.surveysparrow.com
  clickrecover.ga
@@ -187741,6 +180309,7 @@ clientesdigital.xyz
  clientesegurancathe.epizy.com
  clientesegurobb.ml
  clientesespeciaisdasemana.club
+clientesmultired1bn-corm-pe.xyz
  clientesmvltired1bn-corm-pe.xyz
  clienteverifica-account.it
  clientfibbe.com
@@ -187830,6 +180399,7 @@ clipsexmoiviet96.ddns.net
  clipsexmoivietnam7.ddns.net
  clipssssx.000webhostapp.com
  cliqueaquiparaatualizar.com
+cliquedin.com.br
  cliquefluctuation.xyz
  cliqueservico.com.br
  cliquote.com
@@ -187858,6 +180428,7 @@ clockdalcop.com
  clockowner.com
  clocktowercommunications.com
  clodbrdfkcixkzqbgpoyddxrmuycyoxjguhp-dot-cedar-code-289917.nn.r.appspot.com
+clogincapitalone2.com
  clogwars.com
  clone.affordable.cm
  clonedranme.cloudaccess.host
@@ -187936,6 +180507,7 @@ cloudfusion.me
  cloudgetmailfaster.xyz
  cloudgiveaways.ml
  clouding-world.online
+cloudmail-setup4040.firebaseapp.com
  cloudmento.com
  cloudmetric-analytics.com
  cloudnada.site
@@ -188091,6 +180663,7 @@ cmphotos.es
  cmpny22work01.xyz
  cmqzcwkoajhseulo-dot-millinium.ey.r.appspot.com
  cms.bosna-s.ba
+cms.ngrok.club
  cms.securityoperationscenter.de
  cms.vicloud.vn
  cmsbased.net
@@ -188108,6 +180681,7 @@ cmuwydlrfgowvxxd-dot-millinium.ey.r.appspot.com
  cmvcapital.co.za
  cmwdundtgkzkdatl-dot-millinium.ey.r.appspot.com
  cmweenergy.it
+cmwi.net
  cmxczstwheupibrq-dot-millinium.ey.r.appspot.com
  cmzdsg.com
  cn-list.info
@@ -188152,7 +180726,6 @@ cn.mxsjb614.com
  cn.tdfnmx.com
  cn1-e.addroits.com
  cn1.ru
-cn11298.tmweb.ru
  cn37106.tmweb.ru
  cn38.svcoding.com
  cn44588.tmweb.ru
@@ -188201,6 +180774,7 @@ cnfirm32page1.my.id
  cnfzm.com
  cngbzhuqhywfsums-dot-millinium.ey.r.appspot.com
  cngdfqhomlqkqcns-dot-millinium.ey.r.appspot.com
+cngfrbalkdetsdsank.net
  cngjsvzgcxomgypp-dot-millinium.ey.r.appspot.com
  cngsjhionidmjvxj-dot-millinium.ey.r.appspot.com
  cnhdin.cn
@@ -188242,6 +180816,9 @@ cntkqyyilmgguljz-dot-millinium.ey.r.appspot.com
  cntnt-04490384.shiraztvto.ir
  cntnt-26556971.shiraztvto.ir
  cntnt-31183822.shiraztvto.ir
+cntnt-31534077.shiraztvto.ir
+cntnt-50579213.shiraztvto.ir
+cntnt-90203051.shiraztvto.ir
  cntrol.duckdns.org
  cntrzsxjnrruunjc-dot-millinium.ey.r.appspot.com
  cnttateful.com
@@ -188317,7 +180894,6 @@ co.uk.5ooz.xyz
  co.uk.6du5.ru
  co.uk.8b0g.xyz
  co.uk.aj7a.ru
-co.uk.app-review-1637.info
  co.uk.aumf.ru
  co.uk.bvn6.ru
  co.uk.lphw.xyz
@@ -188382,6 +180958,7 @@ cocanphxulxycqouxdhdgqrakn-dot-gloff849483.uk.r.appspot.com
  cochesev-cuents.es
  cocheymotos.com
  cockapoosidjfjr.com
+cockologins.cf
  cockroachexterminationperth.com.au
  cocktailcontent.com
  cocktailpayment.com
@@ -188548,7 +181125,6 @@ coinmastergiftspinsnow.xyz
  coinmasterquarantine.xyz
  coinmastertools.xyz
  coinminingbtc.com
-coinmoz.com
  coinmst3.club
  coinmst4.club
  coinnow101228859.monster
@@ -188925,7 +181501,6 @@ combinedenergytech.com
  combiokbaltadpepp.xyz
  combioticglobal.com
  combiphar-com.000webhostapp.com
-combocomp.com
  combocore53.xyz
  comboguardagency.com
  comboswitch53.icu
@@ -189169,7 +181744,6 @@ compagnidiviaggioavventuristiorg.nckitickets.gdn
  compagniebadenya.com
  compagnons-alzheimer.com
  compagnonvoyage.com
-compalsmt.com
  companhiaitaunense.com.br
  company-partenariat-investissement.com
  company01.sutoweb.com
@@ -189510,7 +182084,6 @@ confirm-csupportin.cf
  confirm-csupportin.ga
  confirm-device-reference962.com
  confirm-device.com
-confirm-devicederegistration.co.uk
  confirm-fbservice.xyz
  confirm-hs-payee.com
  confirm-lnstagram.com.de
@@ -189642,6 +182215,7 @@ confirmsvipsmk.xyz
  confirmterapon.com
  confirmtoinfo.com
  confirmyouraccount.xyz
+confirmyourinformationa10010.blogspot.com
  confirmzelle-acount.get-now.live
  conflitbean.cf
  confortonacompra.com
@@ -189774,6 +182348,7 @@ connecte11.temp.swtest.ru
  connecte12.temp.swtest.ru
  connecte13.temp.swtest.ru
  connecte14.temp.swtest.ru
+connecte15.temp.swtest.ru
  connectedace.com
  connectedcoders.com
  connectedmemberatt.weebly.com
@@ -189891,6 +182466,7 @@ constructorameneses.com.mx
  constructoramun.cl
  constructoraramirezsac.com
  constructoravallereal.com
+constructoravascal.cl
  construguayas.gob.ec
  construlok.com.do
  construpir.com.br
@@ -189929,7 +182505,6 @@ consultoriaeninnovacion.com.co
  consultoriaiunit.com.mx
  consultoriajuridicaec.com
  consultorias.smartdevmx.com
-consultoriobeltran.ml
  consumer-e2e-nightly.consumer.fe-spectrum.net
  consumerassociationmm.org
  consumeromar.info
@@ -189975,6 +182550,7 @@ contactassistamazon.servecounterstrike.com
  contactautomation.net
  contactconsultoria.com
  contactinfo-ee.com
+contactinstagram.cf
  contactinstagram.eko.rest
  contactinstagramverifiedbadges.com
  contactmadarauchiha.ddns.net
@@ -190009,19 +182585,25 @@ contel.jp
  contemporaryclosets.com
  contendbilliesv.com
  content-01585644.voltoq.com
+content-02072673.latuka.com.bo
  content-02688149.interiorholic.net
+content-02816678.latuka.com.bo
  content-039137562.helenquan.ca
  content-05179239.interiorholic.net
  content-06707416.voltoq.com
  content-08593819.voltoq.com
  content-136391473.helenquan.ca
+content-13942128.latuka.com.bo
  content-148819635.helenquan.ca
  content-17931446.voltoq.com
+content-18403184.latuka.com.bo
  content-197881736.helenquan.ca
  content-245598993.helenquan.ca
  content-245683065.curetrick.com
  content-27314790.voltoq.com
  content-28371409.interiorholic.net
+content-29127518.latuka.com.bo
+content-29504139.latuka.com.bo
  content-30013810.interiorholic.net
  content-314517629.helenquan.ca
  content-32741670.smartux.ma
@@ -190033,6 +182615,7 @@ content-416198395.helenquan.ca
  content-487988786.helenquan.ca
  content-48993756.smartux.ma
  content-493329539.curetrick.com
+content-49782492.latuka.com.bo
  content-512810952.curetrick.com
  content-528527410.curetrick.com
  content-54283452.interiorholic.net
@@ -190045,13 +182628,16 @@ content-580327136.helenquan.ca
  content-58117416.smartux.ma
  content-62432431.voltoq.com
  content-657251038.helenquan.ca
+content-66127752.latuka.com.bo
  content-66858790.interiorholic.net
  content-669331165.curetrick.com
  content-67403187.interiorholic.net
  content-68876276.interiorholic.net
  content-703684168.helenquan.ca
+content-71595517.latuka.com.bo
  content-71757835.voltoq.com
  content-724169532.helenquan.ca
+content-72436611.latuka.com.bo
  content-77749454.interiorholic.net
  content-796468717.helenquan.ca
  content-80692424.bidsolutions.cl
@@ -190059,8 +182645,10 @@ content-808801491.helenquan.ca
  content-821961247.helenquan.ca
  content-837936425.helenquan.ca
  content-88601815.voltoq.com
+content-90935479.latuka.com.bo
  content-92023737.tex-garesnica.hr
  content-927489061.helenquan.ca
+content-94519533.latuka.com.bo
  content-955348399.helenquan.ca
  content-95566987.interiorholic.net
  content-982307904.helenquan.ca
@@ -190073,6 +182661,7 @@ content-fbook-03562353.roggiehouse.it
  content-fbook-07316862.roggiehouse.it
  content-fbook-10210604.roggiehouse.it
  content-fbook-12272021.roggiehouse.it
+content-fbook-12675011.roggiehouse.it
  content-fbook-14569177.roggiehouse.it
  content-fbook-14797405.roggiehouse.it
  content-fbook-15721461.roggiehouse.it
@@ -190243,6 +182832,7 @@ conversepolska.com
  conversesleva.cz
  conversiobot.com
  conversiobotlatests.buzz
+conversiobotnew.buzz
  conversionehub.ru
  conversionseo.co
  convert.gr
@@ -190371,6 +182961,7 @@ copular-sword.000webhostapp.com
  copulative-destroye.000webhostapp.com
  copyfuti.hu
  copyhgritstsupportteam.ml
+copyrgihtcontactaccount-inst.cf
  copyright-belform.ml
  copyright-bussines.com
  copyright-centers-contact.com
@@ -190424,6 +183015,7 @@ copyrighthelpsupportscenter.com
  copyrighthelpteams.com
  copyrightinfohelp.com
  copyrightinsagram.000webhostapp.com
+copyrightk-instagram.tk
  copyrightlnstagramverification.com
  copyrightmediacontact-100348765.com
  copyrightmediasupport-10000387168.com
@@ -190460,6 +183052,7 @@ copyrigt-help-security.ml
  copyrihem.000webhostapp.com
  copystar.co.uk
  copytak.ir
+copywriter.org
  coq2.hyperphp.com
  coque-avec-photo.com
  coquetteblume.com
@@ -191211,7 +183804,6 @@ cp.dogepay.info
  cp.marqueeroofing.ca
  cp.us.na.cloud.im
  cp0c7pc.du.r.appspot.com
-cp14841.tmweb.ru
  cp51072.tmweb.ru
  cp58751.tmweb.ru
  cpa.downworld.cc
@@ -191381,6 +183973,7 @@ cpcalendars.instagrambusinessaccount.com
  cpcalendars.join-chatwhatsapp0547514824.ffku-5.gq
  cpcalendars.join-chatwhatsapp0547514824.wa-bkp99.cf
  cpcalendars.join-group-whatsaap-bokep-2020.wa-group1.ga
+cpcalendars.joingrup18.whatsapp4.ga
  cpcalendars.leadersneeded.top
  cpcalendars.lforgot-appleld.com
  cpcalendars.linkedin.pro.br
@@ -191577,6 +184170,7 @@ cplordfqwlbxwohp-dot-millinium.ey.r.appspot.com
  cploriginal.com
  cplrenovationsinc.com
  cplspiwuuzqymueo-dot-millinium.ey.r.appspot.com
+cplus3.com.br
  cpmeow.com
  cpmred.com
  cpndhjgscq.duckdns.org
@@ -191608,7 +184202,6 @@ cpwhifsguhostviq-dot-millinium.ey.r.appspot.com
  cpxraoqectqvfwqw-dot-millinium.ey.r.appspot.com
  cpywbcqcznzwzakkht.top
  cpz1032212244-com.preview-domain.com
-cq51944.tmweb.ru
  cq75800.tmweb.ru
  cq9.jaysbrand.com
  cqae.svcoding.com
@@ -191724,6 +184317,7 @@ crackeur.com
  crackhahanono.000webhostapp.com
  crackhomes.com
  cracking-advertisem.000webhostapp.com
+crackle-wall.000webhostapp.com
  crackowrld.blogspot.com
  cracovidfunds.com
  crad-co-jp.xyz
@@ -191809,6 +184403,7 @@ craigslistorg-19595438.kahulasup.ch
  craigslistorg-22110701.kahulasup.ch
  craigslistorg-22342212.kahulasup.ch
  craigslistorg-24937034.kahulasup.ch
+craigslistorg-27204378.kahulasup.ch
  craigslistorg-29115128.kahulasup.ch
  craigslistorg-31348539.kahulasup.ch
  craigslistorg-32066289.kahulasup.ch
@@ -192036,6 +184631,7 @@ credit-agricole-securite-operations.djshfdufhjjdfurehf.com
  credit-agricole-securite-renforcee.friseur-andrea.de
  credit-agricole-serviceneligne-wwh.info
  credit-agricole-servicepermanat-compte.fkdjjfddfddkfdre.com
+credit-agricole.dctchiropractic.com.au
  credit-agricole.fr-authentification.aanibrothers.in
  credit-agricolebank.amoremiog.com
  credit-agricoles-centresecurse-aide.dapoli.net
@@ -192050,6 +184646,7 @@ credit-rapide-en-ligne.fr
  credit-sautour.be
  credit-security.epizy.com
  credit-suisse.services
+credit.agricole.fr.caperiverresources.com.au
  creditacc.info
  creditagric0le.fr
  creditapp-beta.capitalone.bonitor.ir
@@ -192243,7 +184840,7 @@ crossborderblues.com
  crossbrookwinery.com
  crosscalf.guru
  crosscloudsorg.shaxiabuy.top
-crossdrum.guru
+crossenit.world
  crossfieldconsultingllc.is-certified.com
  crossfire.ddns.net
  crossfitcsg.com
@@ -192378,6 +184975,7 @@ cryptosone.com
  cryptosplenetic.xyz
  cryptosuissecapital.com
  cryptotest.beget.tech
+cryptozy.co
  cryson.com.br
  crystal-interfinance.com
  crystal42762.xyz
@@ -192404,6 +185002,7 @@ cs-analyzer.tk
  cs-assistamazon.servecounterstrike.com
  cs-dazzler.com
  cs-empire.ga
+cs-free-skins.xyz
  cs-gorun.info
  cs-happy.xyz
  cs-info-softbank-accountjp.com
@@ -192439,6 +185038,7 @@ csbeheer.it
  csbrocase.com
  csburo.lu
  csc-vision.de
+csc2membershipaccountupdate-amzprime.com
  cscasedrop.xyz
  csccambodia.com
  cscclabs.com
@@ -192892,6 +185492,7 @@ cueword.tk
  cuezxmqpllqcarbdtwzajrxnuhhgchnwbicn-dot-solar-vertex-285913.rj.r.appspot.com
  cuffed-cavities.000webhostapp.com
  cufflinkunvented.com
+cufiqq-khye.com
  cugcwkjwkgelxluq-dot-millinium.ey.r.appspot.com
  cuhce.bounceme.net
  cuhmkdxaioxllegz-dot-millinium.ey.r.appspot.com
@@ -193462,7 +186063,6 @@ cw32125.tmweb.ru
  cw56.dilshantg.com
  cw6x.awaykart.com
  cw7qt.jaysbrand.com
-cw86816.tmweb.ru
  cwa.mx
  cwarchhol.typeform.com
  cwasuhgbclltkwlq-dot-millinium.ey.r.appspot.com
@@ -193642,7 +186242,6 @@ cyclingvacations.net
  cyclistendeared.com
  cyclobenzaprine.xyz
  cycloidgrow.com
-cyclopedic-coin.000webhostapp.com
  cycy.198424.com
  cydfkyryfnnlesfiltpwickaeidgimwukagt-dot-cryptic-now-290917.ey.r.appspot.com
  cye-fscp.com
@@ -194023,6 +186622,7 @@ daguogroup.com
  dah6f.addroits.com
  dahadpattern.com
  dahdnbdcaiqahoqy-dot-millinium.ey.r.appspot.com
+dahentel.life
  dahil.net
  dahlinperingab.uk
  dahnishaw.com
@@ -194342,6 +186942,7 @@ darcyeqution.com
  dardaseafoodrestaurant.com
  dare-dare.000webhostapp.com
  dareckleyministries.com
+daredeclinetry.cyou
  dareforyoufriend.000webhostapp.com
  darekun.twilightparadox.com
  darerow.buzz
@@ -194371,7 +186972,6 @@ darknova.eu
  darkpanel.ddns.net
  darkplains.com
  darkrat.lh1.in
-darksalmonyouthfulpup.olivercaba.repl.co
  darksteal.tech
  darktool.org
  darktoxicity.com
@@ -194484,6 +187084,8 @@ data-covid19.net
  data-fargo-help.site
  data-github.com
  data-nashville.webredirect.org
+data-new-login.ga
+data-new-login.ml
  data-new-login.tk
  data-paymentdetail.serveirc.com
  data-paypal.com
@@ -194554,7 +187156,6 @@ datcenterr1.me
  datcenterr1.net
  datcenterr1.org
  dateandoando.com
-datecheap.cyou
  datedivorcedsingles.com
  datelsolutions.co.uk
  datempus.pl
@@ -194616,6 +187217,7 @@ daumhanmailkakao.000webhostapp.com
  daumm.ddns.net
  daumm.duckdns.org
  daumonhapkhau.com
+daunhotq10.com
  daurn.tk
  daurnkakaomail.com
  dautaonebeen.droppages.com
@@ -195158,10 +187760,10 @@ deanmorgan.000webhostapp.com
  deannarings.com
  deannolen.com
  deapplemoundo.blogspot.com
+dearcustomers.nednewamazoncard.cyou
  dearcustomers.newamazoncojpdns.monster
  dearcustomers.newamazonjp.cyou
  dearden2860264.xyz
-dearestdimpledwebsites--five-nine.repl.co
  dearmomimokay.com
  dearthway.000webhostapp.com
  death-tone.000webhostapp.com
@@ -195233,6 +187835,7 @@ deciss.ga
  deciss.gq
  decitum.com
  deckensystemenet.baerseventeam.top
+decknodespy.com
  deckpiscinasembauru.com.br
  declarated.xyz
  declife.biz
@@ -195327,7 +187930,6 @@ deeplsleeps.us
  deepmail-0.weebly.com
  deeprootministry.org
  deepsabrina.za.net
-deepsleepsdiabetes.buzz
  deepsouthclothingcompany.com
  deeptisinghacademy.com
  deepvenom.000webhostapp.com
@@ -195429,6 +188031,7 @@ dekeukenbladenfabriek.nl
  dekkinngay.com
  dekm.goruli.com
  dekmantel.com
+deko-bundd.de
  deko-vizyon.com
  deko4you.at
  dekoker.be
@@ -195444,6 +188047,7 @@ del-05027113.delhigatepaphos.com
  del-08262665.delhigatepaphos.com
  del-09971860.delhigatepaphos.com
  del-13292018.delhigatepaphos.com
+del-20988187.laracatesworld.com
  del-32668836.delhigatepaphos.com
  del-35775177.delhigatepaphos.com
  del-49327654.laracatesworld.com
@@ -195525,6 +188129,7 @@ deloilte.com
  delongade.nckitickets.gdn
  delopa.org
  delow.co.uk
+delphic-consulting.com
  delpradoapartment.com
  delsano.in
  delsector.com
@@ -195818,6 +188423,7 @@ deregisterdevice-security.com
  deregisterdevice-verified.co.uk
  deregisterdevice.link
  deregisternewdevice.cc
+deregistration-newdevice-security.com
  derekrubin.com
  deres-ya1.com
  deresve.com
@@ -195966,6 +188572,7 @@ designerforuiy.com
  designergazi.com
  designerinteriorfabrics.com
  designerjeddah.com
+designerliving.co.za
  designermall.ru
  designerseguroweb.com
  designersnake.top
@@ -196014,6 +188621,7 @@ desjardins1securityalert.com
  desjardins3fraudalert.com
  desjardinsval.info
  desjardlns.ca
+desjardlns.link
  desjverification-1compte.com
  desjverification-compte1.com
  desk4succes.nl
@@ -196078,6 +188686,7 @@ destinyvillageinstitute.com
  destituteputt.com
  destress.co.nz
  destrox60.ddns.net
+destruction.annzaon.co.economic1.xyz
  destructionachievement.com
  destructoring.com
  desvsed.com
@@ -196205,13 +188814,13 @@ dev.shottershondhane.tv
  dev.smartshopmanager.com
  dev.snmp.kr
  dev.strkdesign.nl
+dev.thecoinshoppe.ca
  dev.typetraction.com
  dev.viewafricaconnect.co.za
  dev.xatanet.zp.ua
  dev.xn--blockchin-c2d.com
  dev.xn--lockchain-zy5d.com
  dev.ynkwebservices.com
-dev1.assar.in
  dev1.beonweb.pro
  dev1.myflobot.com
  dev1.xicom.us
@@ -196261,6 +188870,7 @@ deviancymeadowlark.com
  deviantstickers.com
  deviationsection.xyz
  deviatory-armament.000webhostapp.com
+device-alert-security.com
  device-alert-uk.com
  device-alertregistered.com
  device-approve.com
@@ -196291,6 +188901,7 @@ device-limited.com
  device-login-halifax.com
  device-manage.hutakataextreme.info
  device-manager.cc
+device-payeeinfringement.link
  device-personal-wells.site
  device-registerationalert.com
  device-registeredalert.com
@@ -196321,6 +188932,7 @@ devicechecksecurity.000webhostapp.com
  devicederegistration-verify.com
  deviceful-errors.000webhostapp.com
  devicegive.us
+deviceinfo-secure.com
  devicemanagerhalifax.com
  devicemoon.com
  deviceprotection-unknown.link
@@ -196826,8 +189438,8 @@ diabasic-balances.000webhostapp.com
  diabbetes.net
  diabetcentro.info
  diabetes-insight.info
-diabetes2freedowm.us
  diabetesfreedom.net
+diabetesfreedoms.buzz
  diabeticgoodbaking.icu
  diabeticsolutionsnetwork.com
  diablobets.com
@@ -196956,6 +189568,7 @@ diaque.cn
  diardexpertisesfr.shaxiareason.top
  diarea.site
  diariodeumnoveleiro.com
+diarydismemberment.top
  diaryofadroid.com
  diasdosnamorados-com.umbler.net
  diasmelhoresparavoce.com
@@ -197130,12 +189743,12 @@ digisham.ir
  digisofttechnologies.com
  digital-02-form.com
  digital-banking-ita.com
+digital-cancel-payee.auth230.com
  digital-desbloqueio.com
  digital-design.com.cn
  digital-edc-santander.net
  digital-marketing-institute-delhi.empeeevents.com
  digital-outlook-1drive.com
-digital-unicredlt.com
  digital.active-restrict.com
  digital.app-user.com
  digital.eudoratrading.com
@@ -197323,7 +189936,6 @@ dinhatagovernmentiti.com
  dinhdaiphat.com
  dinheiro-de-volta-no-superapp.net
  dinheiro-de-volta-no-superapps.com
-dinirepasysvi.ml
  dinizfla.com
  dinl.gq
  dinna-fashion.ru
@@ -197415,6 +190027,7 @@ disable-01968703.tehran123.ir
  disable-92946009.tehran123.ir
  disable-accountid-verifapple.wdawdwadnjkef.co.uk
  disable-devhalireg.com
+disable-mobilebanking.com
  disable-newpayee.com
  disable772account.sistemaaccountprima26252sistemserverus-2.com
  disabled-45907143.ifms-enargeia.gr
@@ -197811,6 +190424,7 @@ dkb-onlinehelpservice.com
  dkb.de-banking-online-transaktionen.edelweiss.com.py
  dkb.de-banking.online-transaktion.edelweiss.com.py
  dkb1231ag.site44.com
+dkb377774.blogspot.com
  dkbb-de.com
  dkbdebankinginternet.com
  dkbtan2go.net
@@ -198419,7 +191033,6 @@ doklhe9odzkrhzt.e8273.pro
  dokoncit.pro
  doktorlarrehberim.com
  doktorpotenz.xyz
-dokumen.memangbeda.website
  dokyit.000webhostapp.com
  dol.dance
  dol.gov.1ln.cc
@@ -198577,6 +191190,7 @@ dombog9.co.vu
  domchargechime.duckdns.org
  domeenx.com
  domekhoroos.com
+domeneuswasaretancomander.com
  domenicaroute.buzz
  domerbon.com
  domessoda.ml
@@ -198824,6 +191438,7 @@ doserveradmin.com
  dosiertechnikonlinecom.baerseventhings.top
  dosimax.today
  dositeoromeropresenter.com
+doskidlyapodachi.ru
  dosligabbr.com
  dosman.pl
  dosnmxgviepmmstmnmobdbwqre-dot-gloff849483.uk.r.appspot.com
@@ -199219,13 +191834,13 @@ dracogalaxy.com
  dracomills.com
  dradaeze.com
  drafterchat.com
-dragging-jurisdicti.000webhostapp.com
  dragoa.com.ar
  dragonautics.com
  dragoncity003.000webhostapp.com
  dragonfang.com
  dragonflytattoo.com.my
  dragongiveaways.ga
+dragonheelflu.com
  dragonpunchint.com
  dragonsknot.com
  dragoparks.com
@@ -199267,6 +191882,7 @@ drbox.life
  drcchile.com
  drchandradental.com
  drcorreamejoresimplantes.com
+drcristianoamaral.com.br
  drctech.co.za
  drctzjgvlvhekjnunvpiadjgwr-dot-gleowayel400503.uc.r.appspot.com
  drcur.smevmail.com
@@ -199409,6 +192025,7 @@ drivenbymagneticscom.postfix-01.com
  driventodaypodcast.com
  driveonedrive0i.000webhostapp.com
  driveonelodriver.serveirc.com
+driver1downloads.com
  driver1sharepoint.xyz
  driveragentplus.com
  driverandbutler.com
@@ -199468,6 +192085,7 @@ drmkqxgsprefqmnavanizlvzsu-dot-gleowayel400503.uc.r.appspot.com
  drmugisha.com
  drnasre2019.ddns.net
  drnedioatolini.com.br
+drneshimangah.com
  drnet.zapto.org
  drnet1920.ddns.net
  drnhhfnpyielyppb-dot-millinium.ey.r.appspot.com
@@ -199742,7 +192360,6 @@ dsullhdrx.goruli.com
  dsumpbaakaeeinal-dot-millinium.ey.r.appspot.com
  dsuw5jbqe7xdzi.com
  dsv.cubotec.com.br
-dsv65erdv654we.easy.co
  dsvist.zzz.com.ua
  dsvzodnburvwaflo-dot-millinium.ey.r.appspot.com
  dsw-japan.com
@@ -200125,6 +192742,7 @@ dvla-tax-return-gov.com
  dvla-taxpayment-renew.www1.biz
  dvla-uk-refund.com
  dvla-uk-security.www1.biz
+dvla-uk.veri-online.ir
  dvla-uk.we-transfer.ir
  dvla-vehicletax.com
  dvla-vehicletaxrefund.com
@@ -200661,6 +193279,7 @@ e.transfer.interac.ca-inpay.com
  e.transfer.interac.ca-nowpay.com
  e.transfer.interac.ca-paygc.com
  e.transfer.interac.ca-payin.com
+e.transfer.interac.ca-qpay.com
  e.transfer.interac.ca-spay.com
  e.transfers.interac.ca-ed.club
  e.uremenber.ru
@@ -200800,6 +193419,7 @@ eaglevision.ir
  eaglewebster.net
  eagqfstmcjpaqxvh-dot-millinium.ey.r.appspot.com
  eagwebs.com
+eahfxmobilelegend.vipu76.com
  eahm.jaysbrand.com
  eaidalimatata.com
  eakwdkxsfvbxybgbpbxr.top
@@ -200884,7 +193504,6 @@ easterprizes.com
  eastexs.com
  eastindianbajaar.com
  eastkorea.ga
-eastlock.monster
  eastpennlandscape.com
  eastrandpsychologist.co.za
  eastt.gq
@@ -201018,6 +193637,7 @@ ebanking-bawagpsk-id794719711.xyz
  ebanking-bawagpsk-id794719712.xyz
  ebanking-bawagpsk-id794719716.xyz
  ebanking-bawagpsk-id794719718.xyz
+ebanking-ing-berichten.com
  ebanking-login.best
  ebanking-verificatieprocess.com
  ebanking.bawagpsk.com.id594719722.xyz
@@ -201402,6 +194022,7 @@ ebayisapi.dllsigninusingssl.dubaitoursbooking.com
  ebaykleinan-zeigen.de
  ebaykleinanze1-001-site1.itempurl.com
  ebaymotors.de.ekauferschutz-session37106094.de
+ebayupdatebilling.com
  ebbindrum.de
  ebblackenterprise.com
  ebbvdkdehqlxxvhy-dot-millinium.ey.r.appspot.com
@@ -201431,6 +194052,7 @@ ebigcoins.com
  ebik.com
  ebike4all.com
  ebill-on.line-port.icu
+ebilling-secure.co.uk
  ebilling-secured.co.uk
  ebills.thetrissilent.com
  ebillupdateshaw.is-an-accountant.com
@@ -201675,7 +194297,6 @@ ecosolarion.com
  ecosouthafrica.icu
  ecosro.com
  ecotaskforce.com
-ecotechone.world
  ecotermra.ro
  ecoterre-scop.fr
  ecotimes.cl
@@ -202011,6 +194632,8 @@ ee-billcentre.com
  ee-billdashboard.com
  ee-billdirect.com
  ee-billed.com
+ee-billfailed-uk.com
+ee-billfailure-fail.com
  ee-billform.com
  ee-billhelp.com
  ee-billiing.net
@@ -202025,6 +194648,7 @@ ee-billing-failedeu.com
  ee-billing-faileduk.com
  ee-billing-failure-uk.com
  ee-billing-fix.com
+ee-billing-guide.com
  ee-billing-help.com
  ee-billing-infoid.com
  ee-billing-issues.com
@@ -202051,10 +194675,12 @@ ee-billinginfo.com
  ee-billinginsupport.com
  ee-billingplan.com
  ee-billingrestrictions.com
+ee-billings-update.com
  ee-billings.com
  ee-billingsecure.com
  ee-billingservice.co.uk
  ee-billingservice.com
+ee-billingsupdates.com
  ee-billingsupports.com
  ee-billingtec.com
  ee-billingtech.co.uk
@@ -202091,6 +194717,7 @@ ee-co.uk-id-4v-user.com
  ee-co.uk-id-6-user.com
  ee-co.uk-id-61t-user.com
  ee-co.uk-id-71p2.com
+ee-co.uk-id-update11i-login.com
  ee-co.uk-id-user-0ip.com
  ee-co.uk-id-user-7g.com
  ee-co.uk-id-user990.com
@@ -202125,7 +194752,9 @@ ee-digitalprofile.com
  ee-digitalsupport.com
  ee-digitalupdates.com
  ee-directdebit.com
+ee-error-billing.com
  ee-error.com
+ee-expire.com
  ee-fix-billing.com
  ee-fix.com
  ee-fixed.com
@@ -202140,6 +194769,7 @@ ee-id-payment.com
  ee-id-uk.org
  ee-infohub.com
  ee-issues.com
+ee-limited-error.com
  ee-limited.com
  ee-login-account.com
  ee-login-auth.com
@@ -202236,11 +194866,11 @@ ee-securepayment.com
  ee-securesafe.com
  ee-securesupport.com
  ee-security-alert.com
-ee-servicehub.com
  ee-servicesite.com
  ee-servicesuk.com
  ee-signin.com
  ee-submitform.com
+ee-subscription.com
  ee-support-acc.com
  ee-support.network
  ee-support.webtechsupports.com
@@ -202317,7 +194947,6 @@ ee.co.uk.billing-updates.limited-3ds.info
  ee.co.uk.billing.june2020.icu
  ee.co.uk.cgi-bin.icu
  ee.co.uk.cgi-bin.link
-ee.co.uk.ref7946.link
  ee.co.uk.ref895.com
  ee.co.uk.secure-auth.ir
  ee.confirm-billing.com
@@ -202338,6 +194967,7 @@ ee.monthly-directdebit-error.com
  ee.my-ee-login.com
  ee.myee-paymonthly.com
  ee.myeebillingaccount.com
+ee.mylogin3.com
  ee.network-paymonthly.co.uk
  ee.online-billingtech.co.uk
  ee.online-paymonthly.com
@@ -202473,6 +195103,7 @@ eegroup2020.co.uk
  eehelp-page.com
  eehelp.net
  eehelpdesk-customerbill.com
+eehelpsupport.com
  eehesfsqtiebhmts-dot-millinium.ey.r.appspot.com
  eehome-payhub.com
  eehub-online.com
@@ -202516,6 +195147,7 @@ eepcsiemhhuhalldbowwdcaovvhggyszpxcf.cryptic-now-290917.ey.r.appspot.com
  eeportal.cc
  eeqibjsmfunlfcht-dot-millinium.ey.r.appspot.com
  eerecovery.000webhostapp.com
+eeredirect-auth.com
  eeredirect-support.com
  eeredirect.info
  eerna.com.bd
@@ -202528,6 +195160,7 @@ eesecurebill-accountinfo.com
  eesecuremyaccount.com
  eeservice.xyz
  eeserviceuk.com
+eesetup-billing.com
  eesgw.xyz
  eesss.online
  eesupport-groups.000webhostapp.com
@@ -202592,6 +195225,7 @@ efenergyplus.com
  efeomzpybxcrqfbx-dot-millinium.ey.r.appspot.com
  efetiva.net.br
  effafrica.org
+effbwewqjhhdwqolas.weebly.com
  effcoegypt.com
  effectivequestionableeyestrain.rafi9898.repl.co
  effectivisit.info
@@ -202628,7 +195262,6 @@ efpnjpoovluhcest-dot-millinium.ey.r.appspot.com
  efrdmzdmkcbayaqefw.top
  efremovconsulting.com
  efrlcznkhgfbzfhslsxccqzklgdjxfsfuhmt-dot-cedar-code-289917.nn.r.appspot.com
-efrmaxvzhrahbayshvpcvtixpkmawlwwwdwo-dot-offglen.uk.r.appspot.com
  efrrdvoefbxlkhna-dot-millinium.ey.r.appspot.com
  efs.co.rs
  efs.timeihekou.cn
@@ -202828,7 +195461,6 @@ ehwsxfr.goruli.com
  ehxbdcwbprqabivx-dot-millinium.ey.r.appspot.com
  ehy1q.awaykart.com
  ehyqtazdopfmfjmj-dot-millinium.ey.r.appspot.com
-ei-5900.us-south.cf.appdomain.cloud
  ei-rbcroyalbank.com
  eiadelerhizmetbasvurun.tk
  eiadetalep-turkiyegovtr.com
@@ -202863,7 +195495,6 @@ einewdxkejsmlmda-dot-millinium.ey.r.appspot.com
  einheitlicheransprechpartnercom.nckiaccounting.gdn
  einihutintl.gq
  einkaufen-in-kuchl.at
-einkkp.cam
  einloggen-ebayde-apps.news.centralagronegocios.com.br
  einloggen-promosite.com
  einloggim-eboy.de
@@ -203202,6 +195833,7 @@ elevatedmath.com
  elevationadvertising.com
  elevationshairboutique.com
  elevatormarches.com
+eleven-september.com
  elevenpuppy.com
  elevhnthseccu.ml
  elexbet167.com
@@ -203305,6 +195937,7 @@ eljumvo.goruli.com
  elkablog.ru
  elkanis-agribusinessblog.com.ng
  elkbeetroots.net
+elkemarybelle.ru
  elkeoldenburgnet.shaxiaanti.top
  elkgroveairporter.com
  elkhaper.com
@@ -204492,6 +197125,7 @@ eq5ahiqg.firebaseapp.com
  eqapakua.xyz
  eqbfjdhsltjcjcavoghgsygylgsqwcmyfcdi-dot-glegen303939423233.ue.r.appspot.com
  eqbqttvzxoicsxzuaeavsvmepmsibhbtgupw-dot-glenxpecial3009493.ey.r.appspot.com
+eqbrhcqjhx.melusfkp.com
  eqbryum.ml
  eqbw9bdho9.firebaseapp.com
  eqc6.jaysbrand.com
@@ -205174,6 +197808,7 @@ esxtw.xyz
  esxvd.xyz
  esyacode.com
  esybpf15.firebaseapp.com
+esysterb.life
  et-0bill-cred.com
  et-accept-ca4gwf.com
  et-education.ru
@@ -205394,6 +198029,7 @@ etransfers.interac.ca-accweb2.com
  etransfers.interac.ca-agc.info
  etransfers.interac.ca-an.com
  etransfers.interac.ca-desjardins.com
+etransfers.interac.ca-dg.com
  etransfers.interac.ca-est.com
  etransfers.interac.ca-gv.com
  etransfers.interac.ca-jq.club
@@ -205734,6 +198370,7 @@ eve-audio.com.ua
  eve-marin.com
  eveequeenbulksms.com
  evehouseland.com
+evelinesmith54305.info
  evelynjordanclay.com
  even-lucky-terbaru.claim55.my.id
  even-tempered-const.000webhostapp.com
@@ -205799,6 +198436,7 @@ eventffgratis.ddns.net
  eventffterbarugratizz2020.dumb1.com
  eventffterbarugratizz2020.dynamic-dns.net
  eventfreefire-gratis2020.ddns.info
+eventfreefire-terbaru2020.mrbonus.com
  eventfreefire.vipu76.com
  eventfreefire2020new.getsviip7.com
  eventfreefire2020real.ml
@@ -205835,6 +198473,7 @@ eventpubg.itemdb.com
  eventpubg71.zzux.com
  eventpubgesport.com
  eventpubgfree14.com
+eventpubghallowen.com
  eventpubgm.pubgmzone.com
  eventpubgm.xfree1.com
  eventpubgm11.com
@@ -206169,6 +198808,7 @@ exbejxavouqdwdwd-dot-millinium.ey.r.appspot.com
  excalmore-8888.000webhostapp.com
  excasa3530.com.br
  excavationguay.com
+exceedwinis.com
  excel-auth-service.gq
  excelacademy.co.in
  excelaires.com
@@ -206501,6 +199141,7 @@ eyeoftheprophet.com
  eyeover.it
  eyeseepotential.com
  eyesigh.com
+eyesmove.buzz
  eyesonvaughan.ca
  eyespyprop.co.za
  eyestopper.ru
@@ -206797,7 +199438,6 @@ f0477484.xsph.ru
  f0478531.xsph.ru
  f0479624.xsph.ru
  f0482519.xsph.ru
-f0485977.xsph.ru
  f04qvvbwwhmxc09y.com
  f0b.casa
  f0bea11ce084c97ca99bce9df2a07eec-dot-dbenitonline.ey.r.appspot.com
@@ -207077,7 +199717,6 @@ faceb00k-verify-account.com
  faceb00k-verrify-accounnt.com
  faceb00k.com.account.update.new.facebook.app.growmaxmedia.com.au
  faceb00k.listing-ad2208523962-item1pwrvob8m53vnka4vq4f6k5pp.com
-faceb00k.tw
  faceb00k12322.000webhostapp.com
  faceb00k132.000webhostapp.com
  faceb00k14.000webhostapp.com
@@ -207405,6 +200044,7 @@ facebook-copyright-media-1000513946.com
  facebook-copyright-review.com
  facebook-copyrights-page.netlify.app
  facebook-customer.tajpharmalb.com
+facebook-data43.tk
  facebook-english.com
  facebook-ferrelukas.server949367.nazwa.pl
  facebook-followers.com
@@ -207424,6 +200064,7 @@ facebook-item.5490192757750319247.best
  facebook-item.912347984902021566930492147.pro
  facebook-item.934102352310505332.pro
  facebook-items.3412347o3746o3791134o.rest
+facebook-items.8940375091973750141.best
  facebook-konkurs.5v.pl
  facebook-listing-forsale.36ge.xyz
  facebook-listing-forsale.54ee.xyz
@@ -207556,6 +200197,7 @@ facebook-restrictions82726.xyz
  facebook-restrictions92837.xyz
  facebook-review-terms-conditions-ticket-id-2364323433.thenewsclues.com
  facebook-robertreich.de
+facebook-search-listing26455.local-realtor-ads.com
  facebook-security-account.ml
  facebook-security-cancel-blockir.tk
  facebook-security-check.cf
@@ -207577,6 +200219,7 @@ facebook-support-customer.asharpevent.com
  facebook-support-customer.oiltankersale.com
  facebook-support-secure.id2020102873.com
  facebook-support.levelteknoloji.com
+facebook-supportmail-helpcenter.ml
  facebook-supports.com
  facebook-team-support.analysthawk.com
  facebook-terms-conditions.analysthawk.com
@@ -207605,6 +200248,7 @@ facebook-videos-apps.weebly.com
  facebook-wallpaper.tk
  facebook-youtube.weebly.com
  facebook.18page64329568236.com
+facebook.1mxcuentas.xyz
  facebook.3-rod.com
  facebook.46823item.online
  facebook.48100915618938885.cam
@@ -207722,6 +200366,7 @@ facebook.com.ads-business.live
  facebook.com.allo-photo.tk
  facebook.com.amfintl.com
  facebook.com.astikya.cf
+facebook.com.bo.hormigasgo.com
  facebook.com.checking.fbcvm.com
  facebook.com.checkpoint.icu
  facebook.com.ciitigrp.com
@@ -207998,7 +200643,6 @@ facebookcomlogin-facebook.mrsfeed.com
  facebookcomm-00801750.pawsaccesories.com
  facebookcomm-02027974.pawsaccesories.com
  facebookcomm-02610910.pawsaccesories.com
-facebookcomm-05926438.pawsaccesories.com
  facebookcomm-08870516.pawsaccesories.com
  facebookcomm-10830165.pawsaccesories.com
  facebookcomm-12253063.pawsaccesories.com
@@ -208007,7 +200651,6 @@ facebookcomm-17707463.pawsaccesories.com
  facebookcomm-23530095.pawsaccesories.com
  facebookcomm-27284847.pawsaccesories.com
  facebookcomm-27685731.pawsaccesories.com
-facebookcomm-29838471.pawsaccesories.com
  facebookcomm-33664479.pawsaccesories.com
  facebookcomm-33913047.pawsaccesories.com
  facebookcomm-37682916.pawsaccesories.com
@@ -208017,9 +200660,6 @@ facebookcomm-47332015.pawsaccesories.com
  facebookcomm-49172378.pawsaccesories.com
  facebookcomm-55091217.pawsaccesories.com
  facebookcomm-55224750.pawsaccesories.com
-facebookcomm-57708784.pawsaccesories.com
-facebookcomm-63449628.pawsaccesories.com
-facebookcomm-64470083.pawsaccesories.com
  facebookcomm-66738235.pawsaccesories.com
  facebookcomm-68593421.pawsaccesories.com
  facebookcomm-79338546.pawsaccesories.com
@@ -208171,6 +200811,7 @@ faceboookcom.0fees.us
  facebooook1.online
  facebooookmail.com
  facebooq1.com
+faceboouki.tk
  faceboouuok.byethost9.com
  faceboox.xyz
  facebouk.live
@@ -209071,6 +201712,7 @@ fb-block.com
  fb-business-item-938692603825.com
  fb-business-page.item93084710029476.com
  fb-business-page76233763.com
+fb-business-real-estate-business-id123.000webhostapp.com
  fb-buy-sell-trade.online
  fb-buy-swap-equip.club
  fb-buy-trade-sell.club
@@ -209163,11 +201805,14 @@ fb-market-placenumber723548.club
  fb-marketplace-1254158458.com
  fb-marketplace-1836.com
  fb-marketplace-215284154.com
+fb-marketplace-215465326.com
+fb-marketplace-21552145214.com
  fb-marketplace-2158420120.com
  fb-marketplace-2514158478.com
  fb-marketplace-25145848.com
  fb-marketplace-263362.com
  fb-marketplace-316497.com
+fb-marketplace-32654853645.com
  fb-marketplace-34991101.com
  fb-marketplace-355279.com
  fb-marketplace-36276735.com
@@ -209246,6 +201891,7 @@ fb-page34256776.com
  fb-page345223.com
  fb-page5445487512.com
  fb-page9962211.com
+fb-pages-properties-listing1807644.com
  fb-pages-realestateid-listing7539640.com
  fb-photography-listingid-87039922.com
  fb-photography-listingid1345654.com
@@ -209258,6 +201904,7 @@ fb-profile-carlafrueh.online
  fb-profile-charlene-spangler.club
  fb-profile-cindy-hunt.club
  fb-profile-colleenoharel.online
+fb-profile-customer.appsdreamers.com
  fb-profile-helenlarick007575684833.club
  fb-profile-helenlarrick08958474.club
  fb-profile-jenniferturner.online
@@ -209273,6 +201920,7 @@ fb-profilen.com
  fb-profille-amanda.club
  fb-profille-haley35oaklyn.club
  fb-profille-haley39oaklyn.club
+fb-profille-krista43carter.club
  fb-properties-listed.com
  fb-properties-page9432456.net
  fb-properties3567783.net
@@ -209365,6 +202013,7 @@ fb-recovery-100006835584-hk.tk
  fb-recovery-100006835585-hk.tk
  fb-recovery-100006835586-hk.tk
  fb-recovery-100006835589-hk.tk
+fb-rentals.com
  fb-review-account.com
  fb-review-secure.com
  fb-routine-updates.page6094385378.com
@@ -209601,7 +202250,6 @@ fb57893-page57869-real-estate-item25634.house
  fb64834-page76463-real-estate-item43364.house
  fb67123-page46758-real-estate-item76425.house
  fb67354-page89254-real-estate-item57634.house
-fb67835-page48924-real-estate-item57863.house
  fb6824824-pages8455543-item-photos485423.com
  fb68253-page89564-real-estate-item82679.house
  fb6853552-item-photos8674341.online
@@ -209627,6 +202275,7 @@ fb83647-page18764-real-estate-item56734.house
  fb84756824-real-estate-item5784-page78245367.com
  fb86538-page56378-real-estate-item93287.house
  fb87645-page67198-real-estate-item36794.house
+fb87665-page28645-real-estate-item84567.house
  fb87945-page29834-real-estate-item78456.house
  fb89.com2021w2822page311312-item-ad22h664.xyz
  fb89254-page82453-real-estate-item87654.house
@@ -209686,6 +202335,7 @@ fbcom-61437580.chekkos.mx
  fbcom-67023669.chekkos.mx
  fbcom-67920099.intertrans-inc.com
  fbcom-69650079.intertrans-inc.com
+fbcom-72564869.premiumboxes.com
  fbcom-72663250.intertrans-inc.com
  fbcom-80119271.chekkos.mx
  fbcom-88251189.intertrans-inc.com
@@ -209702,6 +202352,7 @@ fbcom7.webnode.com
  fbcom82672520.the222.ca
  fbcom84923912.the222.ca
  fbcomrc0106.000webhostapp.com
+fbconnect-loginew.siselrich.com
  fbcontactmanager.com
  fbcontainment.000webhostapp.com
  fbcopyrightconnect.com
@@ -209801,6 +202452,7 @@ fbk-authentication.000webhostapp.com
  fbk-itm.482942.xyz
  fbk-realtor-listing-property-business-id34234.000webhostapp.com
  fbk-team-support.com
+fbk-team-support.us
  fbk.freefacefree.xyz
  fbk20101.com2021w2166page311312-item-ad22h664.xyz
  fbk2019.com2213w8684page311312-item-ad22h664.xyz
@@ -209848,6 +202500,7 @@ fblogin.neelumsoft.com
  fbloginverifyyy.tcp4.me
  fblok.my.id
  fblooker15687.000webhostapp.com
+fbmanager.biz
  fbmanagermedia.com
  fbmania23.000webhostapp.com
  fbmarketplace.realtorrproperts.us
@@ -209869,6 +202522,7 @@ fbmarketplaceitem718479678895983.com
  fbmarketplaceitem719795892115055.com
  fbmarketplaceitem731690500952012.com
  fbmarketplaceitem744016979710151.com
+fbmarketplaceitemf3501339902616401792.com
  fbmarketqld.live
  fbmarketsplace.us
  fbmcffkpcjpankbq.top
@@ -209894,7 +202548,6 @@ fbook-00206656.kakatiyainfra.com
  fbook-08398724.solarenablers.com
  fbook-08804524.solarenablers.com
  fbook-16073289.solarenablers.com
-fbook-20846488.solarenablers.com
  fbook-2090302.wp2app.io
  fbook-26447956.solarenablers.com
  fbook-27131389.solarenablers.com
@@ -209908,13 +202561,10 @@ fbook-52059561.solarenablers.com
  fbook-56570942.solarenablers.com
  fbook-64019895.safimmo.com
  fbook-65985461.solarenablers.com
-fbook-77328636.solarenablers.com
-fbook-82062926.solarenablers.com
  fbook-82521972.solarenablers.com
  fbook-83895011.safimmo.com
  fbook-85701266.solarenablers.com
  fbook-87410688.almajd.ps
-fbook-91664726.solarenablers.com
  fbook-92360512.solarenablers.com
  fbook-93005558.solarenablers.com
  fbook-93167133.almajd.ps
@@ -209951,152 +202601,43 @@ fbook-syte.000webhostapp.com
  fbook-weeb.000webhostapp.com
  fbook-yellowteeth.000webhostapp.com
  fbook.com-12276767.mrubens.mx
-fbook.com-13442418.mrubens.mx
-fbook.com-14174148.mrubens.mx
-fbook.com-14217472.mrubens.mx
  fbook.com-15357733.mrubens.mx
-fbook.com-15628975.mrubens.mx
-fbook.com-16667742.mrubens.mx
-fbook.com-16949674.mrubens.mx
  fbook.com-17764858.logintek.ma
-fbook.com-17898292.mrubens.mx
-fbook.com-18143228.mrubens.mx
-fbook.com-18546995.mrubens.mx
-fbook.com-18766216.mrubens.mx
  fbook.com-18898247.logintek.ma
-fbook.com-18924435.mrubens.mx
  fbook.com-19142716.mrubens.mx
-fbook.com-19168916.mrubens.mx
  fbook.com-19273635.mrubens.mx
-fbook.com-19365262.mrubens.mx
-fbook.com-19382354.mrubens.mx
-fbook.com-19972431.mrubens.mx
-fbook.com-19987167.mrubens.mx
-fbook.com-21688891.mrubens.mx
-fbook.com-21943533.mrubens.mx
  fbook.com-22384934.mrubens.mx
  fbook.com-22539569.mrubens.mx
  fbook.com-22695136.logintek.ma
  fbook.com-23605953.logintek.ma
  fbook.com-25712546.mrubens.mx
-fbook.com-26565823.mrubens.mx
  fbook.com-27379262.mrubens.mx
-fbook.com-28433719.mrubens.mx
-fbook.com-31497264.mrubens.mx
-fbook.com-32462567.mrubens.mx
-fbook.com-33754973.mrubens.mx
-fbook.com-33872946.mrubens.mx
-fbook.com-34896217.mrubens.mx
-fbook.com-36735265.mrubens.mx
  fbook.com-36781994.logintek.ma
-fbook.com-36838551.mrubens.mx
-fbook.com-36926962.mrubens.mx
  fbook.com-37146327.logintek.ma
  fbook.com-37413179.mrubens.mx
-fbook.com-37637864.mrubens.mx
  fbook.com-37669321.mrubens.mx
  fbook.com-37842947.mrubens.mx
  fbook.com-38344637.mrubens.mx
  fbook.com-38491558.mrubens.mx
-fbook.com-38865187.mrubens.mx
-fbook.com-39349941.mrubens.mx
-fbook.com-39525791.mrubens.mx
  fbook.com-39526433.mrubens.mx
-fbook.com-39569246.mrubens.mx
-fbook.com-39794283.mrubens.mx
-fbook.com-39829289.mrubens.mx
-fbook.com-39972413.mrubens.mx
-fbook.com-41935927.mrubens.mx
-fbook.com-42481186.mrubens.mx
-fbook.com-42555691.mrubens.mx
  fbook.com-43668364.mrubens.mx
-fbook.com-43966418.mrubens.mx
-fbook.com-43986281.mrubens.mx
-fbook.com-44591225.mrubens.mx
-fbook.com-45166289.mrubens.mx
-fbook.com-46439695.mrubens.mx
-fbook.com-46479288.mrubens.mx
-fbook.com-46988344.mrubens.mx
-fbook.com-47177384.mrubens.mx
  fbook.com-47859922.mrubens.mx
-fbook.com-48657492.mrubens.mx
-fbook.com-49679524.mrubens.mx
-fbook.com-51332813.mrubens.mx
-fbook.com-51635719.mrubens.mx
-fbook.com-52297349.mrubens.mx
  fbook.com-52966929.mrubens.mx
-fbook.com-55729326.mrubens.mx
  fbook.com-56018080.betterdeal.pk
  fbook.com-56737882.betterdeal.pk
-fbook.com-56951372.mrubens.mx
  fbook.com-57296393.mrubens.mx
-fbook.com-57412197.mrubens.mx
-fbook.com-59452995.mrubens.mx
-fbook.com-59947423.mrubens.mx
-fbook.com-62971567.mrubens.mx
-fbook.com-63942987.mrubens.mx
-fbook.com-64525421.mrubens.mx
-fbook.com-64915981.mrubens.mx
-fbook.com-64966325.mrubens.mx
-fbook.com-65387863.mrubens.mx
  fbook.com-67767254.mrubens.mx
-fbook.com-67936821.mrubens.mx
-fbook.com-68325712.mrubens.mx
-fbook.com-68879492.mrubens.mx
  fbook.com-70227956.betterdeal.pk
-fbook.com-71549794.mrubens.mx
-fbook.com-72529382.mrubens.mx
-fbook.com-72767121.mrubens.mx
-fbook.com-72985794.mrubens.mx
-fbook.com-74295524.mrubens.mx
  fbook.com-74573732.mrubens.mx
-fbook.com-75556772.mrubens.mx
-fbook.com-75756587.mrubens.mx
-fbook.com-75864697.mrubens.mx
-fbook.com-76355518.mrubens.mx
-fbook.com-77463259.mrubens.mx
-fbook.com-77925495.mrubens.mx
  fbook.com-77977691.mrubens.mx
-fbook.com-78798331.mrubens.mx
-fbook.com-79292535.mrubens.mx
-fbook.com-79827229.mrubens.mx
  fbook.com-81517847.mrubens.mx
-fbook.com-81586145.mrubens.mx
-fbook.com-81675614.mrubens.mx
-fbook.com-81919422.mrubens.mx
-fbook.com-82448663.mrubens.mx
-fbook.com-82577893.mrubens.mx
-fbook.com-82813958.mrubens.mx
-fbook.com-82931863.mrubens.mx
  fbook.com-83253294.betterdeal.pk
-fbook.com-83985911.mrubens.mx
-fbook.com-84116498.mrubens.mx
-fbook.com-85143627.mrubens.mx
  fbook.com-85148562.mrubens.mx
  fbook.com-85685373.logintek.ma
  fbook.com-86361622.mrubens.mx
  fbook.com-86684296.mrubens.mx
-fbook.com-88268657.mrubens.mx
-fbook.com-88336938.mrubens.mx
-fbook.com-88657779.mrubens.mx
-fbook.com-89251161.mrubens.mx
-fbook.com-91153774.mrubens.mx
-fbook.com-91652955.mrubens.mx
-fbook.com-91925489.mrubens.mx
  fbook.com-91954322.mrubens.mx
-fbook.com-91956194.mrubens.mx
-fbook.com-92733241.mrubens.mx
-fbook.com-93315479.mrubens.mx
-fbook.com-93586659.mrubens.mx
-fbook.com-94721115.mrubens.mx
-fbook.com-94736569.mrubens.mx
-fbook.com-95818797.mrubens.mx
-fbook.com-95984152.mrubens.mx
-fbook.com-96381692.mrubens.mx
-fbook.com-96936711.mrubens.mx
-fbook.com-96964343.mrubens.mx
  fbook.com-97195845.mrubens.mx
-fbook.com-97498921.mrubens.mx
  fbook.com-98998799.mrubens.mx
  fbook.com-abytedko.docvivo.com
  fbook.com-udbmriod.docvivo.com
@@ -210119,6 +202660,7 @@ fbookcom-14612056.kayaclinic.ir
  fbookcom-16302038.kayaclinic.ir
  fbookcom-17484391.consultemerald.org
  fbookcom-18141532.kayaclinic.ir
+fbookcom-18489956.consultemerald.org
  fbookcom-20034747.kayaclinic.ir
  fbookcom-20055568.kayaclinic.ir
  fbookcom-21364818.kayaclinic.ir
@@ -210226,6 +202768,7 @@ fbpassport.com
  fbpeintures.com
  fbplsagratis.000webhostapp.com
  fbpolicy-review.com
+fbpolicy-update.us
  fbpolicy.g00dchk.com
  fbpolicy.pol2762.com
  fbpolicy.vrfd902.com
@@ -210413,6 +202956,7 @@ fcnbzvoe.goruli.com
  fcncjpgmsunzxafw-dot-millinium.ey.r.appspot.com
  fcnh.goruli.com
  fcnord17.com
+fcompanycom.com
  fconnieao.club
  fcoxzinc.nn.r.appspot.com
  fcpkhoughgopbqww-dot-millinium.ey.r.appspot.com
@@ -210497,7 +203041,6 @@ fdsawertygt.gq
  fdsdfgdfgdf.ru
  fdsdy.co
  fdsfddfgdfgdf.ru
-fdsfsd.buzz
  fdsfsgagdfgdf.ru
  fdsjfjdsfjdsdsjajjs.info
  fdsjfjdsfjdsjfdjsfh.com
@@ -211181,6 +203724,7 @@ fidapeste.duckdns.org
  fidapeyzaj.com
  fiddlemarches.com
  fidelit.com.br
+fidelity-access-gh.com
  fidelitysecure.azurewebsites.net
  fidelltycapitalonline.com
  fideln.com
@@ -211294,6 +203838,7 @@ files-get.pw
  files-get.site
  files-get.space
  files-get.world
+files-safe.cf
  files-view.app.link
  files-wetranfer.000webhostapp.com
  files.47f3-bdc1-b86401530bef.cloudns.asia
@@ -211681,6 +204226,7 @@ firstclassmuslimfoundation.org
  firstclickwork.com
  firstcoastrestoration.com
  firstcreditsuisse.com
+firstdiscoveries.co
  firstfinancesllc.com
  firstfive.net
  firstiniciosesion.000webhostapp.com
@@ -211792,7 +204338,6 @@ fitzroyman.free.fr
  five9seo.com
  fiveabb.com
  fivebuckleads.com
-fiveelectric.monster
  fiveenergypointscom.nckibasketball.gdn
  fiveheadcorporal.com
  fiveheaddearest.com
@@ -211836,6 +204381,7 @@ fixerrors-mail.tk
  fixertawa.blogspot.com
  fixfly.cf
  fixgameit.com
+fixglucakjs.us
  fixi.mobi
  fixitestore.com
  fixlab.pl
@@ -211954,7 +204500,6 @@ flab-skins.com
  flacland.ir
  flacourtiaceous.xyz
  flag-09604382.royal-eng.ps
-flag-19436048.royal-eng.ps
  flag-24167805.royal-eng.ps
  flag-37212174.royal-eng.ps
  flag-84857437.royal-eng.ps
@@ -212126,7 +204671,6 @@ flgmedia.nl
  flickertheflame.com
  flie0010000.000webhostapp.com
  flightarabia.com
-flightdrone.casa
  flightgoexpress.com
  flightstoeurope.us
  flikh.com
@@ -212196,7 +204740,6 @@ floradna.com
  florance92830.club
  florapansiyonotel.com
  floraselfcom.nckifrance.gdn
-floraspringhelthsupplemnt.us
  florenceorganics.fr
  florenceshen.net
  florenzakhamsin.com
@@ -212401,6 +204944,7 @@ fndsdaytings.com
  fndtmc.com
  fneh.ml
  fnemwwuenomspcrg-dot-millinium.ey.r.appspot.com
+fngfrbalkdetsdsank.com
  fngfxactvypyrbfd-dot-millinium.ey.r.appspot.com
  fngiwpkhowzqnjll-dot-millinium.ey.r.appspot.com
  fnixasia.com
@@ -212449,6 +204993,7 @@ focariongorda.duckdns.org
  foceboak.0fees.us
  focebook-video.tk
  focebook76.000webhostapp.com
+focedook.tk
  focgroup.ca
  focitobyt.com
  focohub.com
@@ -212805,7 +205350,6 @@ forthrightgoodbaitware.vkb.repl.co
  fortify.work
  fortigate.be
  fortis-diensten.info
-fortis-paribas-login.xyz
  fortis-prime.com
  fortispc-be.firebaseapp.com
  fortnite-game.online
@@ -212868,7 +205412,6 @@ fosterholiday.com
  fosterscomp.com
  foston.qc-care.com
  fotaonline.24.eu
-fotballpuls.no
  fotdipcduylnnqdr-dot-millinium.ey.r.appspot.com
  foteczkipolska.mygamesonline.org
  fotistax.com
@@ -213292,6 +205835,7 @@ freechecknow.freeupgradelive.com
  freeclaim-event61.mrbonus.com
  freeclaim-evt.my.id
  freeclaim-mlbb606.tk
+freeclaimmembernew.ga
  freeclaimpubgm14.zzux.com
  freecomus.shuiaeat.top
  freecontent.date
@@ -213465,6 +206009,7 @@ freeskinpubgmobiletencent.com
  freeskinsoy.tk
  freeskinspubg.com
  freeskinsshallowen.com
+freeskinsx.giize.com
  freeskinucpubgx.onedumb.com
  freeslits.net
  freesoft.website
@@ -214227,6 +206772,7 @@ fusionautosales.net
  fusionenterprises.ca
  fusionfiresolutions.com
  fusionmediafilms.com
+fusionsports.de
  fusis.in
  fuskxldf.info
  fussey.co.uk
@@ -214252,7 +206798,6 @@ future-advannture.xyz
  future-healthcare.ro
  future-maintenance.com
  future-thought.com
-future.doitnow20.icu
  futureassociationcom.shaxiaapplication.top
  futurecare-bh.com
  futurecargoexpress.com
@@ -214398,7 +206943,6 @@ fy0506.cn
  fy1i0cipn.et.r.appspot.com
  fy3s3x.xyz
  fyaehnvmuxckbmsj-dot-millinium.ey.r.appspot.com
-fyaicibbfmtsqgqefeivruvjpaolkkwogzqu-dot-offglen.uk.r.appspot.com
  fybcaeslj.goruli.com
  fybckakcqzxqfgvk-dot-millinium.ey.r.appspot.com
  fyccrdoxppqmkgph-dot-millinium.ey.r.appspot.com
@@ -214471,6 +207015,7 @@ fzqhjcvhjvzmmfvc-dot-millinium.ey.r.appspot.com
  fzqnnolziygyyecf-dot-millinium.ey.r.appspot.com
  fzrhdnrmdheflczbjbuifnwqongbkcksgrtr-dot-solar-vertex-285913.rj.r.appspot.com
  fzrmkiyziwyjwkxw-dot-millinium.ey.r.appspot.com
+fzrr.top
  fzrysxx.top
  fzsbdepbwjaltxbi-dot-millinium.ey.r.appspot.com
  fzsztslfvforiljmsiahmebvkjwucyrlmlar-dot-solar-vertex-285913.rj.r.appspot.com
@@ -215156,6 +207701,7 @@ gatehub.online
  gatehub.services
  gatehub.site
  gatehub.tech
+gatenormant.com
  gateomar.net
  gaterevenueservices.servehttp.com
  gatertayer.xyz
@@ -215231,6 +207777,7 @@ gaynori527365.xyz
  gayquytuthien.club
  gaytanconstructioninc.com
  gaytripsyllium.com
+gaz-tec.ru
  gaz.rogagot.com
  gazeindia.com
  gazellecommunications.net
@@ -215597,6 +208144,7 @@ gemoen.com
  gemphotographynj.com
  gemriverside-datxanh.xyz
  gemrocksart.org
+gemsdarknessrises.top
  gemsjewelbeads.com
  gemsocgh.gpmedialtd.com
  gemstatedev.com
@@ -215918,6 +208466,7 @@ getdrop.beget.tech
  geteabordu.duckdns.org
  getegroup.com
  getesap.com
+geteventpubgmfree.com
  geteventscodashop5.wikaba.com
  getfitat50.com
  getfitbit.gq
@@ -215946,6 +208495,7 @@ geticcunl.nl
  geticend.com
  getinspace.com
  getinsta100.000webhostapp.com
+getirsrefund.com
  getit12.com
  getitdone.ga
  getitemspubg.com
@@ -216000,7 +208550,6 @@ getsharktank.com
  getskinmobilelegends.ml
  getskinpubgs13.loseyourip.com
  getskinrewardpubg.freeddns.com
-getsmartifi.com
  getsmartlead.com
  getsnewssfreex.mlbbcollect.com
  getsoft.site
@@ -216120,7 +208669,6 @@ gfixprice.space
  gfjgjhjkkk.page.link
  gfjl.com.cn
  gfknoohfndnllhjr-dot-millinium.ey.r.appspot.com
-gflightgammer.casa
  gfmtrader.com
  gfnewagh.com
  gfnlmtcolrrb.pw
@@ -216589,6 +209137,7 @@ girlyougotthischallenge.com
  girlzempoweredsl.com
  gisel2020.dynamic-dns.net
  gisell1.com
+giselviral.juaratembak.com
  gispen.group
  gisvarna.com
  gisy028946038documents2020.wm.r.appspot.com
@@ -216636,7 +209185,6 @@ give-s13.lflink.com
  giveaaway-bm.loseyourip.com
  givealittlegamealot.com
  givealittlegraceblog.com
-giveaway-b6.ddnsfree.com
  giveaway-blockchain-com.preview-domain.com
  giveaway-hadiah21jt.ooguy.com
  giveaway-payypal.000webhostapp.com
@@ -217053,6 +209601,7 @@ glosujemy-konkursy.eu
  glosvk2020.beget.tech
  glotusutsav.com
  glovecrack.com
+glovecupboard.com
  glovein.says.it
  glovm.com
  glow-deeply-divan.glitch.me
@@ -217078,6 +209627,7 @@ gluacafixkj.us
  glubasourse.myftp.org
  glucosamine.site
  gluecn.com
+gluecoinant.cyou
  gluee.xyz
  glueknife.club
  glueturn.nn.r.appspot.com
@@ -217308,6 +209858,7 @@ godaddycusservicecc2.com
  godaddycusservicecc3.com
  godadoresyou.org
  godandgoddess.com
+godanswer1.com
  godatemetoday.site
  godbayern.shaxiaassessment.top
  godbloodcc.000webhostapp.com
@@ -217394,6 +209945,7 @@ gohoga.org
  gohyzevvvzstncww-dot-millinium.ey.r.appspot.com
  goialuis.com
  goijzktmq.goruli.com
+goimagewar.cyou
  goimail002.signin-appleid-apple.com
  goimail2.appleidappstore.com
  goimail4.apps-appleid-store.com
@@ -217639,7 +210191,6 @@ goodmoodconcept.it
  goodmorningsleeperbus.com
  goodmusicapps.com
  goodnamesgo.com
-goodnaturedserenebackend.ygfyedgfvcr.repl.co
  goodnesspets.com
  goodnewsland.xyz
  goodnight.com.br
@@ -217807,6 +210358,7 @@ gornjimilanovac.rs
  goronkrl.goruli.com
  gorrasnissin.com
  gorumriwjuezresw-dot-millinium.ey.r.appspot.com
+gosdfkm.gq
  goseka.co
  goshmanconsulting.com
  gosia.rozen.it
@@ -217919,6 +210471,7 @@ gov-ukreclaim.com
  gov-uktax.services
  gov-uktaxrefund.com
  gov-verifytaxinfo.com
+gov-virusclaim.com
  gov-warszawa.pl
  gov.apply-tax-return.uk
  gov.caixa.servicoprime-br.ml
@@ -217976,6 +210529,7 @@ gov.regainmytax.com
  gov.return-pay1.com
  gov.return-pay2.com
  gov.support-gb-form.com
+gov.supporting-grant.co.uk
  gov.tax-regain.com
  gov.tax-reimbursement.uk
  gov.tax.refunds.applied.refer-2.co.uk
@@ -218006,7 +210560,6 @@ gov.uk-taxclaim.net
  gov.uk-taxing.com
  gov.uk-taxit-or-loseit.com
  gov.uk-taxit-orloseit.com
-gov.uk-taxitloseit.com
  gov.uk-vehicle-dvla.co.uk
  gov.uk-verifyid.info
  gov.uk.claim-tax-refund.dfur.pw
@@ -218073,7 +210626,6 @@ govuk.rebates01.com
  govuk.rebates08.com
  govuk.rebates20.com
  govuk.rebates2020.com
-govuk.refundmeuk.com
  govyqzoqxqkbjsul-dot-millinium.ey.r.appspot.com
  govywlwetransfer.000webhostapp.com
  gowder.com
@@ -218219,7 +210771,10 @@ gqzwutykumrkhvwy-dot-millinium.ey.r.appspot.com
  gr-remodelaciones.com.ar
  gr.upobancolombia.cc
  gr.upobancolombia.club
+gr.upobancolombia.icu
  gr0upbokep-asia4.duckdns.org
+gr0upbokep-japan42.duckdns.org
+gr0upbokep-xnv1.duckdns.org
  gr0upfriendswithbenefitsfbgroupfaceb00kfb.000webhostapp.com
  gr2we4b43q89v7reh54.loan
  gr8skn.club
@@ -218383,6 +210938,8 @@ gratisdrop.000webhostapp.com
  gratisinstal.otzo.com
  gratispresent.se
  gratiss-hadiah.000webhostapp.com
+gratisshadiah-coms.forumz.info
+gratizztopup.forumz.info
  gratyana.com
  gravel-grove-belt.glitch.me
  gravelpolygraphists.com
@@ -218414,6 +210971,7 @@ greatafterbefore77.000webhostapp.com
  greatarchaeology.com
  greatbbrand.su
  greatbookswap.net
+greatdrumfat.com
  greatenterprises.ca
  greaterhightz.com
  greatermontanarealty.com
@@ -218432,6 +210990,7 @@ greatmusica.com
  greatnews.digital
  greatnorthernpartyband.co.uk
  greatnorthsteam.com
+greatransferring.com
  greatshope.su
  greatsteal.kl.com.ua
  greattastesmb.ca
@@ -218576,6 +211135,7 @@ greenzing.top
  greenzo.xyz
  greer-rotary.com
  greet22.theworkpc.com
+greetguitarhut.cyou
  greetingoffbeat.com
  greetingseuropasqq.com
  greetingsfromjamaica.pro
@@ -218650,6 +211210,7 @@ grillitrestaurant.com
  grim-4875933.app.link
  grimacepasture.com
  grimahotel.pe
+grimhnc.com
  grinandbearit.us
  grinchildcare.com
  grindtimegym.com
@@ -218709,6 +211270,7 @@ grosery2frdyhomicandelectronicspmarket.duckdns.org
  groseryhomicandelectronicptusdy2market.duckdns.org
  grosircelanaanak.net
  grossularia.xyz
+grossunknowndecompilers.figueroaads123.repl.co
  groteandsons.com
  grotta-di-sale.changeland.com
  grottedisaledesenzano.com
@@ -218752,6 +211314,7 @@ group-porn82uji.dynamic-dns.net
  group-porn82ulnl.dynamic-dns.net
  group-porn82ulnw.dynamic-dns.net
  group-porn82ulp.dynamic-dns.net
+group-porn82ulpd.dynamic-dns.net
  group-porn82uo.wikaba.com
  group-porn82uoop.dynamic-dns.net
  group-porn82uosk.dynamic-dns.net
@@ -218832,6 +211395,7 @@ groupbokepwa18plus.tk
  groupbokepwa69.000webhostapp.com
  groupbokepwhatsapp.grub-wa23.my.id
  groupbokepwhatsapp7.mrslove.com
+groupbokepwhtsappindojoin.ezua.com
  groupbookepterbaruu.000webhostapp.com
  groupbudi01gaaming.zyns.com
  groupbudi01gaming.zyns.com
@@ -218874,6 +211438,7 @@ groupkhususorangdewasa.000webhostapp.com
  groupkongkox.000webhostapp.com
  groupmabar.itemdb.com
  groupmabarbudi01gaming.cf
+groupmabarfrontal.ga
  groupmabarmoba.000webhostapp.com
  groupon-deals.net
  grouppbokepterbaru18.000webhostapp.com
@@ -218933,24 +211498,31 @@ groupwa526.zzux.com
  groupwa533.zzux.com
  groupwa536.zzux.com
  groupwa540.zzux.com
+groupwa542.zzux.com
  groupwa547.zzux.com
  groupwa553.zzux.com
  groupwa556.zzux.com
  groupwa560.zzux.com
  groupwa562.zzux.com
  groupwa567.zzux.com
+groupwa571.zzux.com
  groupwa621.zzux.com
+groupwa622.zzux.com
  groupwa628.zzux.com
  groupwa629.zzux.com
  groupwa631.zzux.com
+groupwa637.zzux.com
  groupwa648.zzux.com
  groupwa653.zzux.com
+groupwa670.zzux.com
+groupwa677.zzux.com
  groupwa684.zzux.com
  groupwa685.zzux.com
  groupwa687.zzux.com
  groupwa700.zzux.com
  groupwa706.zzux.com
  groupwa708.zzux.com
+groupwa709.zzux.com
  groupwa712.zzux.com
  groupwa713.zzux.com
  groupwa715.zzux.com
@@ -219004,6 +211576,7 @@ groupwhatsappbokep99918.joinsgroup12.tk
  groupwhatsappbokepviral2020-join.thols18.ga
  groupwhatsappbokepviral2020.wa-hot188.ga
  groupwhatsappbokepvirall.hot1.shop
+groupwhatsappbokpjojn.jetos.com
  groupwhatsappbudi01gaming.vskhaugs-september.my.id
  groupwhatsappbudii01.grub-wa11.my.id
  groupwhatsappenaena.jetos.com
@@ -219144,6 +211717,7 @@ grp02.id.rakuten.co.jp.23ed3f978a5e1dbec9fe23c48b7ebc9e7b96a355.xyz
  grp02.id.rakuten.co.jp.edfd217c9270db99772758d905918ac821efdcaa.info
  grp08-id.rakuten.co.jp.updateinfo-id-343956804.com
  grp5j.weblium.site
+grpbkp03.accesscam.org
  grpbkpwa.xx.ygto.com
  grptrades.co.uk
  grpwhatsap.holls91.tk
@@ -219381,6 +211955,7 @@ grubwajualbeliakunfreefire.000webhostapp.com
  grubwaku.ga
  grubwamabarpubg.event-games21.my.id
  grubwasange.ooguy.com
+grubwaterbaru2020.wikaba.com
  grubwaterbaru202047.000webhostapp.com
  grubwatsapbokep2020.000webhostapp.com
  grubwatsappsexxx2020.join-news001.tk
@@ -219436,6 +212011,7 @@ grup-albokep.4dq.com
  grup-b0kp18plus.itsaol.com
  grup-b0okep.itsaol.com
  grup-baru-berbagi-video.000webhostapp.com
+grup-baumemek-sex18.zyns.com
  grup-berbagi-enakenak2020.000webhostapp.com
  grup-berbagi-video-dewasa-bokep-id.000webhostapp.com
  grup-bf-2020.000webhostapp.com
@@ -219461,6 +212037,7 @@ grup-bokep-mantap-mantap-vidio.000webhostapp.com
  grup-bokep-ngentot.000webhostapp.com
  grup-bokep-nobocil-bocil-club2020.000webhostapp.com
  grup-bokep-terbaru-2020-edisi-jepang.000webhostapp.com
+grup-bokep-terbaru.mywire.org
  grup-bokep-terbaru69.000webhostapp.com
  grup-bokep-terhot-xnxx.000webhostapp.com
  grup-bokep-terhotxnxx.000webhostapp.com
@@ -219515,6 +212092,7 @@ grup-sexxx94.claimses.org
  grup-tante-ngecrot.simontok32.cf
  grup-tantehot-mudamempesona.claim654.com
  grup-vidhotterbaru.000webhostapp.com
+grup-vip28.ezua.com
  grup-viral-1818.000webhostapp.com
  grup-viral-bersama.000webhostapp.com
  grup-viral-hits.000webhostapp.com
@@ -219766,6 +212344,7 @@ grupbokepindoplus2020.000webhostapp.com
  grupbokepjapansex.deafult.com
  grupbokepjavan.000webhostapp.com
  grupbokepjepangnew18.authorizeddns.us
+grupbokepkhususdewasa.giize.com
  grupbokepmomsexhot2020terbaru.000webhostapp.com
  grupbokepnew.jkub.com
  grupbokepnew827.000webhostapp.com
@@ -219881,11 +212460,13 @@ grupjamin-crot.000webhostapp.com
  grupjandasange.dynamic-dns.net
  grupjapanwhastup.get7.es
  grupjhv347.000webhostapp.com
+grupjoin-450.ml
  grupjoin.zyns.com
  grupjoinnew.join452.net
  grupjoinwhatsap.wa-hotnew.gq
  grupjoinwhtsapp.dumb1.com
  grupkhusus18-indo.wa-sex.com
+grupkhususdewasa.2waky.com
  grupkhususdewasabocildilarangmasuk.000webhostapp.com
  grupkususdewasa18.000webhostapp.com
  grupmabar-klikdisini.event-resmigarena81.ga
@@ -220069,6 +212650,7 @@ gruppwaa131.zyns.com
  gruppwaa139.my03.com
  gruppwaa139.zyns.com
  gruppwaa141.zyns.com
+gruppwaa143.zyns.com
  gruppwaa147.zyns.com
  gruppwaa204.zyns.com
  gruppwaa216.dns05.com
@@ -220097,6 +212679,7 @@ gruppwaa778.dns05.com
  gruppwaa83.zyns.com
  gruppwaa839.dns05.com
  gruppwaa845.dns05.com
+gruppwaa90.dns05.com
  gruppwaa92.zyns.com
  gruppwaa95.zyns.com
  gruppwavirallterbaru.gabung.org
@@ -220172,6 +212755,7 @@ grupwa206.dumb1.com
  grupwa21.gleeze.com
  grupwa22.com
  grupwa22.deafult.com
+grupwa233.dumb1.com
  grupwa238.dumb1.com
  grupwa241.dumb1.com
  grupwa245.dumb1.com
@@ -220412,7 +212996,6 @@ grupwhatshapp105.new9.my.id
  grupwhatshapp178.new9.my.id
  grupwhatshappddewasa.wa-gruupsex18.gq
  grupwhatssaap.myinfo91.ml
-grupwhatssupbudi01gaming.000webhostapp.com
  grupwhattsapp.otzo.com
  grupwhattsappboke.wa-sex.com
  grupwhattsappvideoviralterbaru111690.000webhostapp.com
@@ -220722,13 +213305,11 @@ guide-09263233.zjlions.org
  guide-20922961.zjlions.org
  guide-35053861.zjlions.org
  guide-35309792.zjlions.org
-guide-55264331.zjlions.org
  guide-57747925.zjlions.org
  guide-58187148.zjlions.org
  guide-86385722.zjlions.org
  guide-coin.com
  guidegdanskcom.chifanassociate.top
-guidehimalayan.com
  guideinengland.ru
  guider1.com
  guiderite.org
@@ -221560,6 +214141,7 @@ halifax-authentication.com
  halifax-authorisation.com
  halifax-authorisedevice.com
  halifax-authorisedevices.com
+halifax-banking-alert.com
  halifax-banking-alerts.com
  halifax-banking-security-help.com
  halifax-banking-security.com
@@ -221574,9 +214156,12 @@ halifax-device-alert.com
  halifax-device-alert.info
  halifax-device-authenticator.com
  halifax-device-authorisation.com
+halifax-device-verify.com
  halifax-deviceauthenticator.com
  halifax-deviceauthorisation.com
  halifax-deviceauthorised.com
+halifax-devicecheck.com
+halifax-devicelogin.com
  halifax-devicemanager.com
  halifax-devicemanagment.net
  halifax-devicepair.com
@@ -221584,6 +214169,7 @@ halifax-deviceregistered.com
  halifax-devices.cc
  halifax-devicesecurity.com
  halifax-devicespaired.com
+halifax-deviceverify.com
  halifax-fraud-alert.com
  halifax-fraud-prevention.com
  halifax-fraudalert.com
@@ -221594,10 +214180,13 @@ halifax-gb-secure.com
  halifax-groupsonline.com
  halifax-help.co.uk
  halifax-issue-online.com
+halifax-issues.info
  halifax-livechat.com
+halifax-liveteam.com
  halifax-login-online.com
  halifax-login.secure-device.co.uk
  halifax-manage-device.com
+halifax-manage-payees.com
  halifax-manageyourdevices.com
  halifax-me.com
  halifax-mobilepayment.com
@@ -221622,6 +214211,7 @@ halifax-onlineuk.com
  halifax-onlineverify.com
  halifax-payee-auhtorisation.com
  halifax-payee-error.info
+halifax-payee-help.com
  halifax-payee-online.com
  halifax-payee-security.net
  halifax-payee-support.com
@@ -221629,10 +214219,13 @@ halifax-payee.co.uk
  halifax-payeealerts-check.com
  halifax-payeeservice.com
  halifax-payeeservices.com
+halifax-payeeupdate.com
  halifax-paymentauthentication.com
  halifax-paymentauthorize.com
  halifax-paymentconfirm.com
  halifax-paymentsalerts.com
+halifax-paymentsecure.com
+halifax-paymentsuspended.com
  halifax-personal.aut1.co.uk
  halifax-protection-support.com
  halifax-queries.com
@@ -221643,6 +214236,7 @@ halifax-review.link
  halifax-reviewteam.com
  halifax-sec.net
  halifax-secure-bank-alerts.live
+halifax-secure-dev.com
  halifax-secure-mobile.com
  halifax-secure-my-account.com
  halifax-secure-my-banking.com
@@ -221650,6 +214244,7 @@ halifax-secure-my-payee-info.com
  halifax-secure-my-payee-security.com
  halifax-secure-my-payee.com
  halifax-secure-mypayee.com
+halifax-secure-online.org
  halifax-secure-payment.com
  halifax-secure.info
  halifax-secure.online
@@ -221667,14 +214262,18 @@ halifax-security-update.com
  halifax-securitypayees.com
  halifax-securityprompt.com
  halifax-securityupdate.com
+halifax-ssecure.link
  halifax-support-team.com
  halifax-support.com
  halifax-uk-account.com
+halifax-uk-alerts.link
  halifax-uk-security.com
  halifax-ukmobilepayment.com
  halifax-unusual-device.com
  halifax-update.com
  halifax-updatedevice.com
+halifax-updatesecurity.com
+halifax-validatelogin.com
  halifax-verify-device.com
  halifax-verify-online.com
  halifax-verifyaccount.com
@@ -221690,6 +214289,7 @@ halifax.accessmypayee.com
  halifax.accessmypayee.uk
  halifax.action-helpcentre.com
  halifax.active-payee.co.uk
+halifax.add-device.com
  halifax.add-new-device.com
  halifax.add-newdevice.com
  halifax.approval-request.co.uk
@@ -221715,6 +214315,7 @@ halifax.authentictedeviceverification.com
  halifax.authnew-payee.link
  halifax.authnewpayee.link
  halifax.authorise-login.com
+halifax.authorise-logins.com
  halifax.authorise-my-device.uk
  halifax.authorise-my-payee.com
  halifax.authorise-my-payee.uk
@@ -221759,7 +214360,6 @@ halifax.co.uk-new-devices.com
  halifax.co.uk.app-review-0679.info
  halifax.co.uk.app-review-0787.info
  halifax.co.uk.app-review-1365.info
-halifax.co.uk.app-review-1485.info
  halifax.co.uk.app-review-1676.info
  halifax.co.uk.app-review-2067.info
  halifax.co.uk.app-review-2096.info
@@ -221775,7 +214375,6 @@ halifax.co.uk.app-review-3516.info
  halifax.co.uk.app-review-3745.info
  halifax.co.uk.app-review-3804.info
  halifax.co.uk.app-review-4163.info
-halifax.co.uk.app-review-4171.info
  halifax.co.uk.app-review-4577.info
  halifax.co.uk.app-review-4853.info
  halifax.co.uk.app-review-4912.info
@@ -221827,6 +214426,7 @@ halifax.co.uk.login-review-7244.info
  halifax.co.uk.login-review-7295.info
  halifax.co.uk.login-review-7438.info
  halifax.co.uk.login-review-765.info
+halifax.co.uk.login-review-9378.info
  halifax.co.uk.login-review-9483.info
  halifax.co.uk.online-loginauth.com
  halifax.co.uk.payee-review-2849.info
@@ -221860,6 +214460,7 @@ halifax.device-deregister.com
  halifax.device-deregistration.com
  halifax.device-paired.com
  halifax.device-registered.com
+halifax.device-secure.uk
  halifax.disable-newdevice.com
  halifax.disablenew-device.com
  halifax.fix-my-payee.uk
@@ -221911,6 +214512,7 @@ halifax.manage-devicepaired.com
  halifax.manage-mypayee.uk
  halifax.manage-new-device.com
  halifax.manage-newdevices.com
+halifax.manage-newpayment.com
  halifax.manage-payee.org
  halifax.manage-safety.com
  halifax.manage-yourdevices.com
@@ -221929,6 +214531,7 @@ halifax.mobile-payee-auth.com
  halifax.mobile-review-auth.com
  halifax.mobile-secure-access.com
  halifax.mobile-verified-access.com
+halifax.mobilebanking-online.com
  halifax.mobilepayee-setup.com
  halifax.my-payees.co.uk
  halifax.my-secure-check.co.uk
@@ -221949,8 +214552,9 @@ halifax.new-loginattempt.com
  halifax.new-payee-added.com
  halifax.new-verify.link
  halifax.newdevice-deregistration.com
+halifax.newlogin-attempt.com
  halifax.newlogin-detected.com
-halifax.newloginattempt.com
+halifax.newpayee-added.com
  halifax.newpayee-alerts.com
  halifax.newpayee-auth.link
  halifax.newpayments-alert.com
@@ -221983,11 +214587,13 @@ halifax.online-unregister.com
  halifax.online-verify.co.uk
  halifax.online-verifypayee.co.uk
  halifax.onlinerecipient-check.com
+halifax.onlipayee-authenticate-device.com
  halifax.pair-newdevice.com
  halifax.pair-yourdevice.com
  halifax.paired-device.com
  halifax.pairyourdevice.com
  halifax.payee-addition.co.uk
+halifax.payee-authenticate-online-device.com
  halifax.payee-authenticate.link
  halifax.payee-cancelsecurity.co.uk
  halifax.payee-display.co.uk
@@ -222013,11 +214619,11 @@ halifax.payeecancellation.co.uk
  halifax.payeecenter.org
  halifax.payeeguard.com
  halifax.payeelinkc.com
+halifax.payeemanage.com
  halifax.payeemanagement.org
  halifax.payeeprotection.com
  halifax.payeesafeguard.com
  halifax.payeesecure.com
-halifax.payeesecurity-app.com
  halifax.payments-alertschecks.com
  halifax.paymentsalert-securechecks.com
  halifax.paymentview.co.uk
@@ -222092,9 +214698,11 @@ halifax.securemy-device.co.uk
  halifax.securemy-device.com
  halifax.securemy-payees.com
  halifax.secureonline-activity.com
+halifax.secureonline-device.com
  halifax.secureonline-helpcenter.com
  halifax.secureonline-payees.com
  halifax.secureonline-personal.com
+halifax.secureonline-update.com
  halifax.secureonline-verifypayees.com
  halifax.securepayee-authorisation.com
  halifax.securepayee.co.uk
@@ -222141,6 +214749,7 @@ halifaxauthorisation.com
  halifaxauthorise.com
  halifaxauthpayee.com
  halifaxbank-online.com
+halifaxbankalerts.com
  halifaxbanking-security.com
  halifaxbankinggroup.com
  halifaxbanksecurity.com
@@ -222159,6 +214768,7 @@ halifaxdeviceverification.com
  halifaxfraudalert.com
  halifaxfraudalertchecks.com
  halifaxfraudalertschecks.com
+halifaxfraudchecks.com
  halifaxfraudpreventionalert.com
  halifaxfraudpreventionalerts.com
  halifaxfraudpreventioncheck.com
@@ -222174,17 +214784,20 @@ halifaxmanage.com
  halifaxmanagementfixuk.com
  halifaxmanagepayee.com
  halifaxmobileattempt.com
+halifaxnew-payee.com
  halifaxnewlogin.com
  halifaxnewpayee-alert-setup.com
  halifaxnewpayee-alerted-secure.com
  halifaxnewpayee-cancel-devicesetup.com
  halifaxnewpayee-cancelsetup.com
+halifaxnewpayee-setup-alert.com
  halifaxnewpayee.com
  halifaxonline-payee.com
  halifaxonline-secure.com
  halifaxonline-verifysecurity.com
  halifaxonlinehelparea.com
  halifaxpayee-check.com
+halifaxpayee-remove.info
  halifaxpayee-secure.com
  halifaxpayee151988.com
  halifaxpayeecheck.com
@@ -222192,20 +214805,25 @@ halifaxpayeedecline.com
  halifaxpayeesecure.com
  halifaxpayeesecure.net
  halifaxpayeeservices.com
+halifaxpayments-update.co.uk
  halifaxpaymentverifyuk.com
  halifaxregister.com
  halifaxremovepayee.com
+halifaxrestoreaccount.com
  halifaxreviewmyacc.live
  halifaxscamalert.com
  halifaxscamalerts.com
+halifaxscamalertsteam.com
  halifaxscampreventionalert.com
  halifaxscampreventiongroup.com
  halifaxscampreventionteam.com
+halifaxsecinc.link
  halifaxsecure-onlinelogin.com
  halifaxsecure-supportcentre.com
  halifaxsecure.live
  halifaxsecuredevice.com
  halifaxsecuregroup.co.uk
+halifaxsecuregroup.uk
  halifaxsecureonline.com
  halifaxsecurepanel.com
  halifaxsecurepayee.com
@@ -222222,6 +214840,7 @@ halifaxuk.security-onlinegb.com
  halifaxunrecognised-device.com
  halifaxverification-online.com
  halifaxverifypayee.com
+halifx-online.logon17.co.uk
  halifx.logon02.com
  halipayee-auth.com
  halisecure-login.com
@@ -222259,6 +214878,7 @@ halsmku.com
  halvorson.buzz
  halwaja.com
  ham131231.duckdns.org
+ham350.xyz
  hamada4563.com
  hamamelsalam.org
  hamaregharkasaman.000webhostapp.com
@@ -222278,10 +214898,12 @@ hamironatiohplpoonation.com
  hamitim.com
  hamlinfoundation.org
  hammerheadbuilders.net
+hammerheadglittery.top
  hammurabi.com.py
  hamnafasq.com
  hamobik.com
  hamodanapoli.com
+hamokak.xyz
  hamonero.com
  hamouchan.org
  hamrahkar.com
@@ -222556,6 +215178,7 @@ hasandanalioglu.com
  hasanigroup.com
  hasdfewxde.duckdns.org
  hasdownhill.com
+hasduan-amazon93485.awasgdikasihloginanas.com
  hased.duckdns.org
  haseeb.ga
  hasef.duckdns.org
@@ -222596,6 +215219,7 @@ hastanearaclari.com
  hasteemart.com
  hastenestate.com
  hastioned.xyz
+hastydarkkhakilicenses.figueroaads123.repl.co
  hasukovillage.com
  haswr.club
  hasyakyonet.shaxiaadd.top
@@ -223019,7 +215643,6 @@ healvideos.com
  heankan.bio
  heapgozhlbjqdxop-dot-millinium.ey.r.appspot.com
  hearburnnomore.us
-hearinx3protocols.us
  heartburne.cyou
  heartburnsafe.com
  heartchakracheckup.com
@@ -223099,6 +215722,7 @@ heel.ge
  heemaalnews.com
  heeressport.at
  heeroatt.weebly.com
+heetumsbing.com
  heevassify.com
  hefareauasi.com
  heffnertwinturbo.com
@@ -223115,7 +215739,6 @@ hegoshopnet.shuiacause.top
  hehao.host
  hehepress.com
  heidelbergartstudio.gallery
-heidiaufderalm.de
  heidmane.com
  heidzilla.com
  heightnetwork.com
@@ -223139,6 +215762,7 @@ helenaailor.com
  helenaoficial.com
  helene13fr.temp.swtest.ru
  helenekowalsky.com
+helenelizabethandria.ru
  helenitadff.com
  helenltd.com
  heleocanke.servicesrakuten.cyou
@@ -223149,9 +215773,10 @@ helilift.co.uk
  heliomotion.com
  heliosestudio.com
  heliotrope-accessible-meadow.glitch.me
+heliveth1.com
+heliveth3.com
  helixessg.com
  helixhouse.com
-helixity-india.com
  hellboyato.ddns.net
  hellenedney.com
  hellenicelevators.gr
@@ -223226,6 +215851,7 @@ help-about-instagram.ml
  help-about-verifybadges.com
  help-accassistance.info
  help-account-badges.tk
+help-account-pages.my.id
  help-accountcenters.ga
  help-advanced-enable-pages-2020.my.id
  help-alert.digital
@@ -223249,6 +215875,7 @@ help-copyright-formabout.com
  help-copyright-lnstagram.gq
  help-copyright-report.com
  help-copyright-support.com
+help-copyright-team.ml
  help-copyrightcustomerconfig.ml
  help-copyrightsinfo.xyz
  help-covid19-benefit.buzz
@@ -223442,6 +216069,7 @@ helpdeskatt.weebly.com
  helpdeskcenter.net
  helpdeskdept.info
  helpdeskfixer.com
+helpdeskhalifax.com
  helpdeskkuk.creatorlink.net
  helpdestktopfile.000webhostapp.com
  helpdispatchlarson.com
@@ -223553,6 +216181,7 @@ helpteamlnstagram.com
  helptheteeth.com
  helpthreedesk.com
  helpticket-tmobile.com
+helpussecureaccount.support
  helpvan.su
  helpy007.com
  helthdoctor.000webhostapp.com
@@ -224054,6 +216683,7 @@ high-voltage-surfac.000webhostapp.com
  highaltitudes.net
  highbeautifulcompiler.kikisabreu.repl.co
  highbloodpressurefact.com
+highboloodpressure.us
  highbrlght.com
  highbroker.com
  highbrow-associates.com
@@ -224365,6 +216995,7 @@ hjs9dpxzsa.appspot.com
  hjsdbaeqiojvraff-dot-millinium.ey.r.appspot.com
  hjsdbfbvtysfc.pw
  hjsdf.tk
+hjsdfgjjhasdgfkjsadfhgasdf.tk
  hjspom.com
  hjsqvsvkgtpnbgsj-dot-millinium.ey.r.appspot.com
  hjssb7822uij.weebly.com
@@ -224468,6 +217099,7 @@ hldmpro.ru
  hldschool.com
  hleia.com
  hlfax-securedetect.com
+hlfx-securedinfo.com
  hlfxsecuredevice.cc
  hlgfco.xyz
  hlgimrbcghasukkg-dot-millinium.ey.r.appspot.com
@@ -224623,6 +217255,7 @@ hmrc-security-authorise-user9403811.net
  hmrc-service-data-govuk.gogoparadise.net
  hmrc-support.gov.uk.jbhnx9n684hpa8axmmumqw3z.com
  hmrc-tax-assessment.com
+hmrc-tax-guide-govuk.com
  hmrc-tax-portal.com
  hmrc-tax-rebates-govuk.com
  hmrc-tax-rebates.ru
@@ -224790,6 +217423,7 @@ hmrc.ukresolvefix.com
  hmrc.user-id9140.com
  hmrc.validation-panel.com
  hmrc.verifytaxuk.com
+hmrcgov-rebate.com
  hmrcgov-refund.com
  hmrcgov-repayment.com
  hmrcgovuk.secure-validations.com
@@ -224801,6 +217435,7 @@ hmrcrefund-gov-taxreturn.com
  hmrcrefund-ukgov.com
  hmrcrefund.net
  hmrcsupport.com
+hmrctax-refund-gov.com
  hmrctax-refund-uk.services
  hmrctaxclaim.online
  hmrctaxes.me
@@ -224829,6 +217464,7 @@ hmrebatesuk.com
  hmrebateuk.com
  hmrefcgov.com
  hmrefgovd.com
+hmrefrc.com
  hmrefund-secure.com
  hmregovd.com
  hmreturn.xyz
@@ -225075,6 +217711,7 @@ holidayinnboston.com
  holidayrentalgaucin.com
  holidays.hu
  holidaytihicom.shaxiabed.top
+holidygd.cam
  holiganbetgiris.blogspot.com
  holiganbett1.blogspot.com
  holiganguncelgir.blogspot.com
@@ -225256,6 +217893,7 @@ homepage-verify-unauthorizedactivity.webredirect.org
  homepagelog.z13.web.core.windows.net
  homepay.life
  homepcblog.com
+homepogonszczecininfo.pogon.max.pl
  homeporno228.com
  homerelief.tk
  homeremediesandtips.whw1.com
@@ -225382,6 +218020,7 @@ hooklore.fun
  hookmatchs.com
  hookmatchst.com
  hooktronic1.000webhostapp.com
+hoomebtcom.weebly.com
  hoomellhic.com
  hoomokef.com
  hoopearrings.000webhostapp.com
@@ -225441,6 +218080,7 @@ hormonerebalance.com
  hornbachapeldoorncom.licufashion.gdn
  hornbytheplc.com
  hornelink.cn
+hornpagewe.cyou
  hornyhookup.co.in
  horobkjfio.info
  horoscope.serveirc.com
@@ -225483,6 +218123,7 @@ host-applerecords2.servebeer.com
  host-listing-21462.casa
  host-listing-41242.casa
  host-listing-42452.casa
+host-listing-98413.casa
  host-pub1.info
  host-und-updatedomain-b7986330.hotelportlagalere.com
  host-update.web.app
@@ -225518,6 +218159,7 @@ hosteddomainonline.com
  hostedgoodsonline.com
  hostedprimedashboard.com
  hostedsquarenet.com
+hosteriarioescondidos.com
  hosterisb.com
  hostessenjoborg.shaxiabuy.top
  hostexperts.xyz
@@ -225601,6 +218243,7 @@ hostxxxinquiries.creatorlink.net
  hostzaa.com
  hosurbusiness.com
  hot-2020.com
+hot-dewasa2020.tk
  hot-mailitaccedi.com
  hot-maillogginn.se
  hot-mops.com
@@ -225759,6 +218402,7 @@ hott-grupjoinwhatsapp.ikwb.com
  hottabych.ua
  hottco.com
  hotterballroom.monster
+hottest-trending-stories060.000webhostapp.com
  hottest-viral.com
  hottestklusin.ga
  hottestxxxvideo.com
@@ -225792,7 +218436,6 @@ house-design-simon.de
  house-to-house-clam.000webhostapp.com
  house.spicygothic.com
  house18.info
-housebolt.guru
  housecaffe.it
  houseci.com
  housedream.net
@@ -226066,6 +218709,7 @@ hrnpmixy.handipants.com
  hrojehdhezjisnhc-dot-millinium.ey.r.appspot.com
  hroperations.com.mx
  hropp.azurefd.net
+hrotgs.com
  hroudmutaezle.com
  hrp.meerai.eu
  hrpesavzj.rogagot.com
@@ -226090,13 +218734,16 @@ hryspap.cn
  hrz2.xyz
  hrzzhqpointdkbot-dot-millinium.ey.r.appspot.com
  hs-alertnew-payees.com
+hs-authenticate-payments.net
  hs-authpayee.net
  hs-bc-authorise-payment.com
  hs-bc-payment.info
  hs-bc-secure-account.co
  hs-bchk.com
+hs-cancel-auth.net
  hs-cancel-payee.com
  hs-cancel-paym.net
+hs-cancelpayee.net
  hs-denotfisecs.com
  hs-failedpayment.com
  hs-fraudalerts.com
@@ -226156,6 +218803,7 @@ hs-suspicious-activity.co.uk
  hs-tonotifprosec.com
  hs-transaction-support.com
  hs-uk-remove-payee.com
+hs-verify-alertpayee.com
  hs.bc-clientaccess.com
  hs.bc-customersecurity.com
  hs.bc-locked.com
@@ -226259,6 +218907,7 @@ hsbc.fast-payments.uk
  hsbc.fit
  hsbc.fixmy-payee.uk
  hsbc.fraud-management.uk
+hsbc.fraud-preventionteam.co.uk
  hsbc.fraudcheckalert.com
  hsbc.fraudpaymentschecks.com
  hsbc.guide-payee.com
@@ -226834,7 +219483,6 @@ hurricanechain.com.au
  hurried-lubricants.000webhostapp.com
  hurryburry.weebly.com
  hurrycurry.cz
-hurtfulwellofffinance--five-nine.repl.co
  hurtlockerrichmond.com.au
  hurtokien.pl
  husankimalkia.cloudns.asia
@@ -227391,6 +220039,7 @@ iats.com.br
  iatu.ulstu.ru
  iaujdfyomiuaksan-dot-millinium.ey.r.appspot.com
  iausnqwa.com
+iauth-securepayee.com
  iavjuadmipsktqwh-dot-millinium.ey.r.appspot.com
  iawdwenbiowbwdmo-dot-millinium.ey.r.appspot.com
  ib-pontosaresgatar.redirectme.net
@@ -227888,6 +220537,7 @@ icloud.com.vm11.info
  icloud.com.webmailloada.icu
  icloud.com.webonlinemobileu.bar
  icloud.coms.my.id
+icloud.ekahotel.com
  icloud.find-ios.tf
  icloud.find-ip.us
  icloud.find-it.icu
@@ -227941,6 +220591,7 @@ icloud.ydiaz.com.co
  icloud.zatos.cn
  icloudbackup.com.br
  icloudcom.top
+icloudfre.club
  icloudgraphics.com
  icloudid-find.com
  icloudierc.top
@@ -228056,6 +220707,7 @@ id-ee-page.com
  id-ee-payment.link
  id-ee-payments.co.uk
  id-ee-secure.com
+id-ee-uk.user-id33ei.com
  id-eebilling.xyz
  id-eeukauth.ga
  id-et-d.fr
@@ -228192,6 +220844,7 @@ idcase-78069365.shah-tech.com
  idcase-99131255.gentlebrooksports.org
  idcop.id
  idcs-49324163.textovert.com
+idcs-93860913.textovert.com
  idcstar.net
  iddapanpong123.000webhostapp.com
  iddeia.org.br
@@ -228666,6 +221319,7 @@ ig-bluetickcenter.ml
  ig-centersform.com
  ig-client.com
  ig-clientservice.cf
+ig-communitycenter.com
  ig-copyright-feedback.com
  ig-copyright-violation-support.ga
  ig-copyrightform-support.cf
@@ -228693,17 +221347,20 @@ ig-verified-badge.ml
  ig-verified-badges.com
  ig-verifiedform.com
  ig-verifybadge.epizy.com
+ig-verifyticket.com
  ig-violation-appeal.cf
  igadgetpro.com
  igazszabolcs.hu
  igb-central.com
  igbingorg.shaxiacalendar.top
  igblogsecure000.000webhostapp.com
+igbluebadgeform2020.ml
  igbusinesscenter.com
  igbwx.goruli.com
  igcinc.com
  igclienthelpservices.com
  igcnxporuytavihc-dot-millinium.ey.r.appspot.com
+igcopyright-helpscenter.ml
  igcopyrightappeall.com
  igcopyrightcentral.com
  igcopyrightcentre.com
@@ -228920,6 +221577,7 @@ iinstrgam.000webhostapp.com
  iiooilooi.ru.com
  iiovrxqhfieyqirz-dot-millinium.ey.r.appspot.com
  iiphpbgzdbxyvdbvwtvoeufiecpsdjhhvljb-dot-solar-vertex-285913.rj.r.appspot.com
+iips.edu.iq
  iiqiefloqmzeyhjv-dot-millinium.ey.r.appspot.com
  iiranair.com
  iirdgloveipjxxyz-dot-millinium.ey.r.appspot.com
@@ -229137,6 +221795,7 @@ ilrafrica.com
  ilriypuv.dermals.org
  ilrnkaqmtvnjwulb-dot-millinium.ey.r.appspot.com
  ilsakosmetik.com
+ilsamepro.casa
  ilsendcom.batwoqisep.top
  ilsendcom.shuiacause.top
  ilshinctcom.shaxiaput.top
@@ -229150,7 +221809,6 @@ ilustrediadascompras.com
  iluuryeqa.info
  ilvpqunyihtexzhkrtjvlgizzcyxvakniczy-dot-solar-vertex-285913.rj.r.appspot.com
  ilwglgbagrekwaws-dot-millinium.ey.r.appspot.com
-ilxigifsiydqwuoejvgsbjynehagzflhkwgv-dot-offgl8876899977678.uk.r.appspot.com
  ilxsjfaljwznkgiy-dot-millinium.ey.r.appspot.com
  ilytkrktdaiviqbi-dot-millinium.ey.r.appspot.com
  ilzuricdhetrad.ru
@@ -229229,7 +221887,6 @@ imensanatsi.com
  imersaodobem.com.br
  imfasafarmaceutica.com
  imfcograntonlineclaims.000webhostapp.com
-img-4923598.pettibuzz.com
  img-swrpics-ara12.ga
  img.adzmk.com
  img.agsmk.com
@@ -229298,7 +221955,6 @@ immoenselffr.chifanbob.top
  immoplexsaguenay.com
  immowelt.at.wohnungen-mieten-1tf5j3n.xyz
  immowelt.de.wohnung-1udgs5.xyz
-immuneelemnets.us
  immunocyte.kpdnet.com
  imngaizyhqbjcibmtnclmvkgnmrejvwlpwfx-dot-cedar-code-289917.nn.r.appspot.com
  imns-paypalservis5l.servebeer.com
@@ -229358,7 +222014,6 @@ import.test.themerex.net
  import188.com
  importano.top
  important-verifybilling.com
-importantnotificationalertonlineresetcomcastvcxdfg555.000webhostapp.com
  importardechina.info
  imported-beneficial-magnesium.glitch.me
  importerfahemmohamed.000webhostapp.com
@@ -229761,6 +222416,7 @@ indoremakaan.com
  indoservis.000webhostapp.com
  indotechelevators.com
  indotradingonline.com
+indoviral27.otzo.com
  indoxx121.site
  indrahosting.com
  indrashop-eu.ml
@@ -229815,6 +222471,7 @@ inexpensivepets.com
  inf-recoversecsigninid.bentelucilata.com
  inf-reinformation.net
  inf0-sc0t1a83i.com
+infallible-payne-732367.netlify.app
  infamousstrike.com
  infantbaptism.net
  infantjesushighschool.com
@@ -229905,6 +222562,7 @@ info-ee.com
  info-ee.net
  info-facebookservices.cf
  info-fakty24.pl
+info-gd.buzz
  info-https.com
  info-icloud.co
  info-iki.com
@@ -229924,7 +222582,6 @@ info-my3-updatesalert.com
  info-my3billing-support.com
  info-myee.co.uk
  info-myee.com
-info-myo2-updatesalert.com
  info-mythree.co
  info-news24.eu
  info-nl-knab.com
@@ -230046,7 +222703,6 @@ infohost.net.au
  infohub.com.pk
  infohuntbd.com
  infoibadah.com
-infoimpots.com
  infoinfoxm.000webhostapp.com
  infoinppl.serveirc.com
  infointesa.com
@@ -230073,6 +222729,7 @@ infomy-3.com
  infomy-3billingsupport.com
  infomy3.com
  infoneedstobeupdate.theamazonnewer.xyz
+infonemom.live
  infonetworjismung.club
  infonex47.com
  infonext87.com
@@ -230143,6 +222800,7 @@ informations-service.online
  informations-support-account-security-rakuten.info
  informations.paypalobjects.com.freedomuno.com
  informationservice.newamazonjp.buzz
+informationservice.theramazoncardupdate.monster
  informationshop-web.servehttp.com
  informationyouraccountlimitsincmaskoek.unieuiajka.com
  informativa-europea-isp-2020.com
@@ -230315,7 +222973,6 @@ ingrambiosciences.com
  ingredientmedia.nl
  ingresar01.000webhostapp.com
  ingreso-zonasegura1bnvirtual.com
-ingresomx-enlinea.com
  ingresosfaciles.com
  ingresosucursalpersonasbancolombia.com.co
  ingresovirtual2020.com
@@ -230448,6 +223105,7 @@ inmobiliariasmarket247.website
  inmobiliariaweidmann.com.ar
  inmocanje.com.ar
  inmofactory-fotocasa.live
+inmoviliariaatedemoslaformadecomodudadparati.tk
  inmueble-7859452.casa
  inmueble-89406725.casa
  inmueblesvivacasa.com
@@ -230668,6 +223326,7 @@ inspiredideasgroup.com
  inspiredigitalmedia.icu
  inspiredwindows.com.au
  inspirelaw.ca
+inspiring-mcclintock-a45b4f.netlify.app
  inspocoach.com
  inspordflechfm.000webhostapp.com
  inssatgram.000webhostapp.com
@@ -230779,6 +223438,7 @@ instagram-com.redbullad.com
  instagram-community.xyz
  instagram-confirmcenter.com
  instagram-connexion.duckdns.org
+instagram-copyrighformus.gq
  instagram-copyrighformus.ml
  instagram-copyright-breach.com
  instagram-copyright-centers.cf
@@ -230828,6 +223488,7 @@ instagram-helpcopyrights.org
  instagram-helper.tk
  instagram-helpers.com
  instagram-helpmediaform.ml
+instagram-helpp-center.com
  instagram-helps-service.com
  instagram-helpscopyright.com
  instagram-helpservices.com
@@ -230860,7 +223521,6 @@ instagram-photos.ml
  instagram-post1723130.netlify.app
  instagram-premium.herokuapp.com
  instagram-private.xyz
-instagram-prizes.xyz
  instagram-recovery-challenge.dynamic-dns.net
  instagram-removecopyright.com
  instagram-rus.xyz
@@ -230887,6 +223547,7 @@ instagram-supportscenter.ml
  instagram-team1.0fees.us
  instagram-terms.com
  instagram-tick.servehttp.com
+instagram-tk-copyright.tk
  instagram-tr.com
  instagram-user-verify.cf
  instagram-user.0fees.us
@@ -230935,6 +223596,7 @@ instagram.archi
  instagram.authenticate.cyou
  instagram.autopapara.com
  instagram.avgle8.com
+instagram.bejooor.ir
  instagram.bluebadge-verify.com
  instagram.caden.in
  instagram.canews.fun
@@ -230989,6 +223651,7 @@ instagram.oauth.repl.co
  instagram.officials.email.mulyatitety.my.id
  instagram.pestmobile.net
  instagram.quranicweb.com
+instagram.renklimakarnadunyasi.com
  instagram.rulevioiationsupport.com
  instagram.servicecopyright.com
  instagram.shia.com.au
@@ -231816,6 +224479,7 @@ intesawebalert005.000webhostapp.com
  intesawebalert03.000webhostapp.com
  intesawebalert09.000webhostapp.com
  intesawebalert9.000webhostapp.com
+intesazanpalo.spob9.com
  intesco.ru
  inthebeginningconsulting.com
  intheendoftheworld.top
@@ -232031,6 +224695,7 @@ invitewhatsapp-grupdewasa.xxicv.gq
  invitiamo-a-certificare-la-nuova-app.link
  invodi12.com
  invoic3-order872946.serveirc.com
+invoice-services-apple-store.gleeze.com
  invoice.ae
  invoice.apple.com.tr.verifymylogin.com
  invoice.meddelivery.info
@@ -232304,6 +224969,7 @@ iprogressivemed.ru
  iproinfotech.com
  iprointeractive.ca
  ipserversix.com
+ipsolutions.cc
  ipstagram.000webhostapp.com
  ipstdcnssyvezqci-dot-millinium.ey.r.appspot.com
  ipsummit.me
@@ -232622,7 +225288,6 @@ isecure-request.com
  isecure-verify.com
  iseethesky.top
  iseler.net
-iseljeans.com
  iseltd.ru
  iseolakehomes.com
  iservice-account.docx96313.lasjkmvndqjgiw.com
@@ -233086,6 +225751,7 @@ item-79157327245.com
  item-94365432.com
  item-982714.com
  item-cl-20938.com
+item-id09029022-fb.com
  item-marketplace-158478.com
  item-marketplace-215841525.com
  item-marketplace-2215458415.com
@@ -233105,6 +225771,8 @@ item-post-sales-trade-34625120.xyz
  item-rakuten.co.jp.ik3igruewgdkj436kldhglerny5674kjhdsffkdsf.tk
  item-sale-34563485.facebook.com.zennutah.com
  item.business-fb-item3289836425.com
+item.facebook.234o61o78o624o88o5247o.shop
+item.facebook.34o7o3452823o2868o32.host
  item.fb-4725product.xyz
  item2848212.buybookscheaper.com
  item3.shop
@@ -233125,6 +225793,7 @@ itemlisting-70089148.sitesap.gr
  itemlisting-81676026.sitesap.gr
  itemmarketplace.xyz
  itemnewgets11.4dq.com
+itempermanentfree.com
  itemproperties3fde485f3ag3a2vy-realtygrouppage-p2047675l2557.net
  itempubgfree.otzo.com
  itempubgmobile.com
@@ -233874,6 +226543,7 @@ jamssquaremsl.com
  jamupasakbumi.com
  jamurkepalabut-1nc18hbc18obc818oc81oc1.sarapanpag.com
  jamwilzoon.com
+jamwsilasma.com
  jamz47341.uc.r.appspot.com
  jan-van-eijck.nl
  janainademorais.com
@@ -233985,6 +226655,7 @@ jardimboty.com
  jardimpraia.com
  jardine.com.sg
  jardinesycampos.es
+jardinlosalamos.com
  jardinmisamiguitos.cl
  jardinschimiques.fr
  jardy-service.nl
@@ -234323,6 +226994,7 @@ je.abmx.cn
  je1c4.dilshantg.com
  je24.mentriqq.com
  je28oy379.info
+jeancarlie.temp.swtest.ru
  jeanitelliantas.info
  jeanjackn3.temp.swtest.ru
  jeankolbwellbychoice.com
@@ -234334,6 +227006,7 @@ jeansdating-a.com
  jeansvandamclaudee.constantcontactsites.com
  jebgquojbrjlbltf-dot-millinium.ey.r.appspot.com
  jebkhata.com
+jebpterstone.flywheelsites.com
  jebs.net.au
  jebsharidwar.org
  jecherchedieu.fr
@@ -234547,6 +227220,7 @@ jevn.in
  jevoxfcdyozpjuek-dot-millinium.ey.r.appspot.com
  jevqijumtnbmnxnd-dot-millinium.ey.r.appspot.com
  jewelfishesoctagonally.life
+jewellcornela.ru
  jewelleryderosa.com
  jewelone.in
  jewelryboxes.bounceme.net
@@ -235639,6 +228313,7 @@ join-mychat.my.id
  join-mygroup-watsapp18.my-joins47.cf
  join-mygrubwhatsapp.sexy-66.ga
  join-mygrubwhatsapp2020.join-bkeps10.ml
+join-new98.gq
  join-sekarang-grub-bokep-2020-khusus-18.000webhostapp.com
  join-sexchatindo18.91.myz.info
  join-sini-group-18plus-dijamin-croot.000webhostapp.com
@@ -235765,7 +228440,7 @@ join.whatsapp.mabarytff.ga
  join.whatsapp.v-25.com
  join.whatsappyu.boksexy.cf
  join.whattsapps.com
-join00001grup.whatsapp1982-288.cf
+join0101grup.whatsapp-777579.ml
  join010203grup.whatsapp-702.cf
  join0901grup.whatsapp-199201.tk
  join18grubwa.itsaol.com
@@ -235807,6 +228482,7 @@ joinchatgrupwhatsapp31.mrbonus.com
  joinchatgrupwhatsapp91.mrbonus.com
  joinchatgrupwhatsapp92.mrbonus.com
  joinchatgrupwhatsapp99.mrbonus.com
+joinchatsexs.4pu.com
  joinchattwhattsap12.000webhostapp.com
  joinchatwagrup.000webhostapp.com
  joinchatwhatsap.api-whatsapp5.tk
@@ -235988,10 +228664,12 @@ joingrup.sexidude.com
  joingrup.wa-sex.com
  joingrup.whatsapp-6619.ga
  joingrup.whatsapp-bokep.tk
+joingrup.whatsapp-web-271.cf
  joingrup0.hicam.net
  joingrup091.whatsapp-66785.ml
  joingrup1.ddns.net
  joingrup12.whatsapp-702.ml
+joingrup123.api-whatsapp-6.cf
  joingrup16.whatsapp-995.gq
  joingrup18.laen.cf
  joingrup18new.joins5.com
@@ -236131,6 +228809,7 @@ joingrupwa18terbaru2020.000webhostapp.com
  joingrupwa20.4dq.com
  joingrupwa20.ccpay.tk
  joingrupwa2020.h9d.shop
+joingrupwa699.gq
  joingrupwaa.hol50.com
  joingrupwabkp.crotsz.com
  joingrupwabokep012.mysecondarydns.com
@@ -236165,6 +228844,7 @@ joingrupwasex2.hol50.com
  joingrupwattsap129.000webhostapp.com
  joingrupwav2020.000webhostapp.com
  joingrupwaviral.guied7.my.id
+joingrupwaviral5.ml
  joingrupwaviral588.cf
  joingrupwaviral588.gq
  joingrupwayoutuber.gratis33.my.id
@@ -236275,6 +228955,7 @@ joinninggroup18.0xz.org
  joinnmeet.me
  joinnow-whatsapp18.wa-groups.ml
  joinnwdgrupswhatsappdewasa.zyns.com
+joinofficialgroupwhtspp.tk
  joinporngroup.net
  joinporngrup.00.mrbasic.com
  joinremi.com
@@ -236824,6 +229505,7 @@ jpnuploads.com
  jpnyofv.healthygenez.club
  jponline-service.com
  jpospehdcola.com
+jpost-v.top
  jpot-a.top
  jpot-b.top
  jpot-c.top
@@ -237493,6 +230175,7 @@ jurasile.000webhostapp.com
  jurczyk.biz
  jurdhf.com
  jurec.mx
+jurgetop.top
  jurhidrico.com
  juridico.invicas.com
  juridicoqueiroz.com.br
@@ -237631,6 +230314,7 @@ jvnhlhudivfksxcg-dot-millinium.ey.r.appspot.com
  jvpgxukrhcnutttfskjulmulnl-dot-gleowayel400503.uc.r.appspot.com
  jvphdmrfgeiutrow-dot-millinium.ey.r.appspot.com
  jvppfkeneoyskrck-dot-millinium.ey.r.appspot.com
+jvpub.org
  jvqqllllbockddzm-dot-millinium.ey.r.appspot.com
  jvrioclaro.cl
  jvsecurepay.com
@@ -237787,6 +230471,7 @@ jzavsokblwgdhpsx-dot-millinium.ey.r.appspot.com
  jzcdmrqwaatpexko-dot-millinium.ey.r.appspot.com
  jzeledon.000webhostapp.com
  jzfjgrehcydnhpxb-dot-millinium.ey.r.appspot.com
+jzfksopayv.china-busuk.com
  jzhwyjbokiwiuwdrpesga.tk
  jzikniyrzjrwrgnvkmjmxnjlsw-dot-gleowayel400503.uc.r.appspot.com
  jzimjpdlvlhdrqbo-dot-millinium.ey.r.appspot.com
@@ -238042,6 +230727,7 @@ kakarakis.com
  kakatrades.com
  kakawevich.temp.swtest.ru
  kakbollen.se
+kakehashi-manabu.com
  kakiproxy.win
  kaklebi.ge
  kakoon.co.il
@@ -238270,6 +230956,7 @@ karen2401202profile.online
  karen613profile.review-items-store.xyz
  karenburton-profile-099482.com
  karenbuss.com.br
+karenfloydportraiture.com
  karenformeprofile.online
  karennurseprofile.online
  karensgrigsby.com
@@ -238710,6 +231397,7 @@ kedi-russian.ru
  kedin.duckdns.org
  kedkekk.co.cc
  keeblerplain.buzz
+keen-brahmagupta-cec944.netlify.app
  keen-sight-280309.appspot.com
  keen-sight-280309.nw.r.appspot.com
  keenan53124698.xyz
@@ -239118,6 +231806,7 @@ kgshaa.fff315.com
  kgsinsuranceagency.top
  kgsinsuranceagencys.buzz
  kgtgxlmrobbpvciemvcilgmdjcaxtgaulbjf-dot-offgl8876899977678.uk.r.appspot.com
+kgti.co.kr
  kgu.goruli.com
  kgusfufdcfbdycvvjomkqiidknyattbowgfv-dot-glegen303939423233.ue.r.appspot.com
  kgutjgdjdmlthice-dot-millinium.ey.r.appspot.com
@@ -239169,7 +231858,6 @@ kh5dkht9.easy.co
  kh5iotuv.easy.co
  kh64q7ir.easy.co
  kh64xair.easy.co
-kh6da0uo.easy.co
  kh6f8ehs.easy.co
  kh7a44rq.easy.co
  kh7a5b98.easy.co
@@ -239446,6 +232134,7 @@ kiliclarmakina.com
  kill3rr.com
  killabot-u71.gq
  killcup.xyz
+killerbeepen.com
  killersam.beget.tech
  killevo.com
  killingtonchukka.pl
@@ -239467,6 +232156,7 @@ kimajnblod.com
  kimaklahsjwywgwhqas.com
  kimamurphy8342profile.online
  kimani.net
+kimball-bosendorfer.xyz
  kimbellmuseum212.kimbellmuseumpop18.commoscope.com
  kimberly56nobles-item.photos945348-item.com
  kimberly56nobles.photos945348-item.com
@@ -239518,6 +232208,7 @@ kineoscar.cl
  kinepremins.cl
  kinesicintell.com
  kinesiotape.sk
+kinfwinent.ej3fwinenl.parivahansevakendra.com
  king-businesssell.top
  king-oreoo-23.com
  king-oreoo-80.com
@@ -239847,6 +232538,8 @@ klahykuuqpybuniqztiyhovjdngkydkvxznb.cryptic-now-290917.ey.r.appspot.com
  klaim-elitpass-s23-2020.000webhostapp.com
  klaim-event-ff.000webhostapp.com
  klano102.space
+klant-berichtenopenen.com
+klant-berichtopenen.com
  klant-online.noez.me
  klantabncontact.nl
  klantauthenticatie-paypail.nl
@@ -239870,6 +232563,7 @@ klavze28.com
  klawebdesign.com
  klbay.net
  klbehuchhyhpekmi-dot-millinium.ey.r.appspot.com
+klczrmtbcu.duckdns.org
  kldfkdkfdkdf.com
  kldkjfdfjkddhf.com
  kleanjack.com
@@ -240150,6 +232844,7 @@ knwc2.jaysbrand.com
  knwosay-71.ga
  knxhpbrixgjswsmcsubeahpofw-dot-gleowayel400503.uc.r.appspot.com
  knypbxnvakayrbej-dot-millinium.ey.r.appspot.com
+knzdzkrqrf.duckdns.org
  ko4k12baou6avli.e8273.pro
  ko52.com
  koa.movementislife.info
@@ -240349,6 +233044,7 @@ konfirmasi-akun4156.webnode.com
  konfirmasi-akun4319.webnode.com
  konfirmasi-akun445.webnode.com
  konfirmasi-akun5273.webnode.com
+konfirmasi-akun56305.webnode.com
  konfirmasi-akun56981.webnode.com
  konfirmasi-akun6101.webnode.com
  konfirmasi-akun640.webnode.com
@@ -240627,6 +233323,7 @@ kqcaoaxsqncgscditikrlxneoavtsukmycxp-dot-cedar-code-289917.nn.r.appspot.com
  kqdcljpslbkufgme-dot-millinium.ey.r.appspot.com
  kqddskohpjdzzhsjzvqfhsnhwn-dot-gleowayel400503.uc.r.appspot.com
  kqde1.app.link
+kqdxzgwvfzetvvkscs.top
  kqhfljsfdegmwbnd-dot-millinium.ey.r.appspot.com
  kqiwijjwmtwrpcyi-dot-millinium.ey.r.appspot.com
  kqjfqy.rogagot.com
@@ -240957,7 +233654,6 @@ kugekbzxcotawcij-dot-millinium.ey.r.appspot.com
  kugelfigurcom.batwoqiseller.top
  kugrukbabuuuy.skinfree9.com
  kugyvjygt.ml
-kuhberg-echo.bplaced.net
  kuhftzypwpxidmbj-dot-millinium.ey.r.appspot.com
  kuhiccorners.buzz
  kuhmmuvbvsbdztxp-dot-millinium.ey.r.appspot.com
@@ -240995,6 +233691,7 @@ kumjqifaberxlgmu-dot-millinium.ey.r.appspot.com
  kumkmbandung.com
  kumkqlapvvqmhzrj-dot-millinium.ey.r.appspot.com
  kummer.to
+kumobemarche.com
  kumpulan-bokep-viral-indo.000webhostapp.com
  kumpulan-grup-bokep-vcs.000webhostapp.com
  kumpulan-grup-wahtsap.mrbonus.com
@@ -241240,6 +233937,7 @@ kwrealty2015.mobi
  kwsg.awaykart.com
  kwtkkevkybaavjcj-dot-millinium.ey.r.appspot.com
  kwtr.svcoding.com
+kwugllmocu.duckdns.org
  kwvasjlzgkfbbfbg-dot-millinium.ey.r.appspot.com
  kwveqjuzamgbwjyr-dot-millinium.ey.r.appspot.com
  kwxcgqfouabqqzom-dot-millinium.ey.r.appspot.com
@@ -241327,6 +234025,7 @@ kytjkgcjrklsrqbq-dot-millinium.ey.r.appspot.com
  kyufukin-soumu-go.eefnnrl.cn
  kyufukin-soumu-go.emtgdtc.cn
  kyufukin-soumu-jp.eefnnrl.cn
+kyufukin.soumu.online
  kyui.psdzy.com
  kyunt.tk
  kyvnrontossgjale-dot-millinium.ey.r.appspot.com
@@ -241367,6 +234066,7 @@ kzwscywhjytyhjie-dot-millinium.ey.r.appspot.com
  kzyenpjxsaizfplg-dot-millinium.ey.r.appspot.com
  l-banorte.com
  l-ink.me
+l-plc-helpremove-device.co
  l-plc-remove-device.com
  l-plc-securedevice.com
  l-runescape.com.ua
@@ -241452,6 +234152,7 @@ labastilleandpartners.com
  labboardcom.shaxiabuy.top
  labdhibs.in
  label-control-yh-us.000webhostapp.com
+labelcs.com
  labeldar.com
  labeldom.com
  labella.eu
@@ -241624,7 +234325,6 @@ lakelanierseptic.com
  lakesidebankplc.com
  lakeviewinnvermont.com
  lakeviewmarket.xyz
-lakincliffapt.xyz
  lakinmountain.xyz
  lakinshore.buzz
  lakp.pl
@@ -241779,7 +234479,6 @@ lanjunhome.com
  lankaexplorer.net
  lankanewsroom.com
  lankasugar.lk
-lankatrust.org
  lankeshpatrike.com
  lankspecos.net
  lankytartorganization.gdgdggdgdg.repl.co
@@ -242111,6 +234810,7 @@ lavoixdesmots.free.fr
  lavorosubordinatosmartw.org
  lavrin.pl
  lawang88view01.my.id
+lawerencesfranklin.com
  lawetasandomierz.pl
  lawfirm-int.online
  lawful-pokes.000webhostapp.com
@@ -242309,6 +235009,7 @@ ld.wuenci.wang
  ld.zzz.com.ua
  ld3bs.com
  lda-tripoli.com
+ldamglas.nl
  ldba.cc
  ldbrowserhonehandhe.com
  ldcwatch.org
@@ -242343,6 +235044,7 @@ ldpzshdtecjhskma-dot-millinium.ey.r.appspot.com
  ldrautovation.co.za
  ldrcreep.net
  ldrflippo.co
+ldrglass.casa
  ldrglobal.casa
  ldrldr.icu
  ldrmercury.casa
@@ -242874,6 +235576,7 @@ lethatch.se
  lethatrace.buzz
  letholedriving.co.za
  letiansichang.com
+leticiagale.ru
  letmeshowww.000webhostapp.com
  letrikacom.nckiaccounting.gdn
  lets-go-to-russia.com
@@ -242894,7 +235597,6 @@ letsspeakenglishonline.com
  letsstarthere.000webhostapp.com
  letstech.com.br
  letterboxdistributionmelbourne.com.au
-letterhsg.cam
  letterlandlady.com
  lettersonapaige.com
  letthechampionrise.com
@@ -243133,7 +235835,6 @@ li.trippoholic.com
  li624-4.members.linode.com
  lia2560.000webhostapp.com
  liainlyegiujjgrkqgzaibxmqodcpsczwcng-dot-solar-vertex-285913.rj.r.appspot.com
-liam-63c2a.firebaseapp.com
  liambeckford89.000webhostapp.com
  liamdialysis.com
  liamnissonsd.agency
@@ -243224,6 +235925,7 @@ lidaxianren.com
  liddlaymai.xyz
  lidefe.com
  lider-k.com
+lider.md
  liderautocom.com.br
  liderfmtocos.website.radio.br
  liderkuota.com
@@ -243257,6 +235959,7 @@ life.topbulletin.today
  lifeadvicer.com
  lifeandworkinjapan.info
  lifeapt.biz
+lifebackagainghs.us
  lifebackagainlifess.us
  lifeblnc.ru
  lifeboat.media
@@ -243607,6 +236310,11 @@ limpiaredes.com
  limpiezaslucel.com
  limraitech.com
  limrasindia.com
+limts-17716448.agrosierra.com
+limts-18317576.agrosierra.com
+limts-34932981.agrosierra.com
+limts-56982431.agrosierra.com
+limts-68686873.agrosierra.com
  lin0207.theworkpc.com
  lin1.byte90.com
  linaagp.cam
@@ -243656,7 +236364,6 @@ lineconty.cool
  linecorporationn.com
  linecould.top
  lineindorian.com
-linekd.duckdns.org
  linekwdemo2.com
  linelineline.cf
  linepay.tech
@@ -243787,6 +236494,7 @@ linksysdatakeys.se
  linktampcraez.com
  linktoico.000webhostapp.com
  linkverified.uk
+linkviral.whatsapp-19929.ga
  linkviral.whatsapp-779.ml
  linkwabokep.wa-21.com
  linkwhatsapp1.top0.shop
@@ -243926,6 +236634,7 @@ listadeactividades.com
  listaimperatriz.com
  listedinvancouver.com
  listen-71.gq
+listencare.buzz
  listener.chickenkiller.com
  listenkryz.com
  listfash.com
@@ -244164,7 +236873,6 @@ lix-1.info
  lix.gucac.com
  lixiaolongpo.tk
  lixitntdwpijxtwk-dot-millinium.ey.r.appspot.com
-lixko.com
  lixmgszvibdwelrt-dot-millinium.ey.r.appspot.com
  lixzmaz.gq
  liya2002.com
@@ -244317,6 +237025,7 @@ llohumas.today
  llojas-americanas.ezyro.com
  llongtime.com
  llovtstlhtgjoagr-dot-millinium.ey.r.appspot.com
+lloyd-newpayments.net
  lloyd-personal.onlinebankinguk.net
  lloyd-verify.com
  lloydbank.com.compliance-user.services
@@ -244325,12 +237034,16 @@ lloydolb.com
  lloydonline-eservices.com
  lloyds-alerts.com
  lloyds-area.com
+lloyds-auth.club
  lloyds-authenticate-device.com
+lloyds-authenticate-device.link
  lloyds-authorise-payment.com
  lloyds-authorisepayee.com
  lloyds-bank-authentication.com
+lloyds-bank-authorise.com
  lloyds-cancelpayee.com
  lloyds-confirmdetails.com
+lloyds-confirmdevice.com
  lloyds-confirmlogin.com
  lloyds-dataprotect.com
  lloyds-dataprotect.live
@@ -244338,10 +237051,12 @@ lloyds-decline-payee.com
  lloyds-deregisterdevice.co.uk
  lloyds-device-authenticate.com
  lloyds-device.com
+lloyds-device.management
  lloyds-deviceconfirmation.com
  lloyds-devicedata.co.uk
  lloyds-devicemanage.co.uk
  lloyds-devicesecurity.com
+lloyds-fraudalertsaction.com
  lloyds-group.live
  lloyds-help.com
  lloyds-loginconfirmation.com
@@ -244356,11 +237071,14 @@ lloyds-online.com
  lloyds-onlinedevices.com
  lloyds-payee-authorization.com
  lloyds-payee.live
+lloyds-payeealert.com
  lloyds-payeesecurity.com
  lloyds-protectdata.net
  lloyds-scheduled-payment.com
  lloyds-secure-login.com
+lloyds-secure-yt.com
  lloyds-secure.net
+lloyds-secureinformation.com
  lloyds-securepayee.com
  lloyds-securepayees.com
  lloyds-support-account.com
@@ -244368,6 +237086,7 @@ lloyds-support-app.com
  lloyds-unknown-payee.com
  lloyds-validatedevice.com
  lloyds-verification.com
+lloyds-verify-device.com
  lloyds-verifymydevice.com
  lloyds-verifynewdevice.com
  lloyds-verifypayee.com
@@ -244393,6 +237112,7 @@ lloyds.fraud-paymentalert.com
  lloyds.fraudalert-action.com
  lloyds.fraudpaymentalert.com
  lloyds.infoverify-auth.com
+lloyds.manage-security.co.uk
  lloyds.management-payee.com
  lloyds.managemy-payee.com
  lloyds.managemy-payee.uk
@@ -244415,17 +237135,21 @@ lloyds.safemy-payee.uk
  lloyds.securepayeenotice.com
  lloyds.settle-mypayee.uk
  lloyds.settlemypayee.uk
+lloyds.uk-secure-authenticate.com
  lloyds.uk-tax-it-or-lose-it.com
  lloyds.uk-unusual-device.com
+lloyds.unusual-login-secure.com
  lloyds.verify-my-payee.uk
  lloyds.verify-mypayee.uk
  lloydsaccountsecurity.com
+lloydsalerts.co.uk
  lloydsalerts.com
  lloydsbank-authenticate.co.uk
  lloydsbank.appukplc.co.uk
  lloydsbank.auth-device-login-verify.com
  lloydsbank.auth-login-online-device.com
  lloydsbank.auth-new-device-verify.com
+lloydsbank.authlogin-dev33.com
  lloydsbank.com.app-review-1421.info
  lloydsbank.com.login-review-0468.info
  lloydsbank.com.login-review-3748.info
@@ -244439,6 +237163,7 @@ lloydsbank.lb-alerts.com
  lloydsbank.login-auth-device-verify.com
  lloydsbank.login-auth-secure-device.com
  lloydsbank.login-device-auth-verify.com
+lloydsbank.login-device-verify-auth.com
  lloydsbank.login-online-authorise-device.com
  lloydsbank.login-online-device-auth.com
  lloydsbank.login-online-device-valid.com
@@ -244479,19 +237204,25 @@ lloydsbank.verify-device-online.com
  lloydsbanking.secured-devices-new-login.com
  lloydsbankonline.co.uk
  lloydsbankplc.login-device-verify.com
+lloydsbankplc.new-dev-auth.com
  lloydsbankplc.secure-new-dev-login.com
+lloydsbankplc.verify-new-dev-auth.com
  lloydsbankplcc.online-validate-login.com
+lloydsbanksecure.net
  lloydsbnk-authenticate.com
  lloydsdataprotect.net
+lloydsdevicemanagement.com
  lloydsdevicemanagment.co.uk
  lloydsecure.com
  lloydsfraudalert.com
  lloydsgroup.el-tl.com
  lloydsgroup.live
  lloydsgroupsecurity.com
+lloydsinsecure.link
  lloydsonline-info.com
  lloydsonline.uto09.com
  lloydspayee-support.com
+lloydspayeeremoval.com
  lloydspayeeuk.com
  lloydsplc.auth-secure-verify-dev.com
  lloydsprotectdata.co.uk
@@ -244506,6 +237237,7 @@ lloydstsb.auth-device-new-verify.com
  lloydsukreview.com
  lloydsverifydevice.com
  lloydsverifydevice.net
+lloydsverifypayee.com
  llppctymvkebapvb-dot-millinium.ey.r.appspot.com
  llqjy.com
  llqqimwqfdfdmfwjvoorlefzvnapragygshi-dot-solar-vertex-285913.rj.r.appspot.com
@@ -244547,6 +237279,7 @@ lmgxobwjhbznzkbagcylojjhot-dot-gleowayel400503.uc.r.appspot.com
  lmheritage.com
  lmhqdaublxizikaa-dot-millinium.ey.r.appspot.com
  lmiqxuqtxwplnpse-dot-millinium.ey.r.appspot.com
+lmiybvetud.duckdns.org
  lmjdwdbxqjvkhvax-dot-millinium.ey.r.appspot.com
  lmjfvykiynjkjevrjjhviybmtc-dot-gloff849483.uk.r.appspot.com
  lmjsvyylykaebyqe-dot-millinium.ey.r.appspot.com
@@ -244788,6 +237521,7 @@ lnstagramcommunityrules.cf
  lnstagramcommunitysupport.tk
  lnstagramcontactcopyright.com
  lnstagramcoprightsupport.ml
+lnstagramcopyright-rules.com
  lnstagramcopyright-servicie.com
  lnstagramcopyright.net
  lnstagramcopyright0.somee.com
@@ -244914,7 +237648,9 @@ lnstagramverificationbadgeform.com
  lnstagramverificationbadges.com
  lnstagramverificationbadgeservice.cf
  lnstagramverified-badge.tk
+lnstagramverified-basges.ml
  lnstagramverified-notice.com
+lnstagramverified.me
  lnstagramverifiedbadge-com.cf
  lnstagramverifiedbadges-notice.com
  lnstagramverifiedbadgesform.ml
@@ -245197,7 +237933,6 @@ log-inmfacebook.get2020.my.id
  log-inpemblokiran-fb.ga
  log-interaction.000webhostapp.com
  log-localbltcoins.com
-log-pa.danskebank.privat.form.jsp.vulteksystems.com
  log-pas-veri.com
  log-protecs.xyz
  log-service.bibifashions.com
@@ -245255,6 +237990,7 @@ login-account.aba.vg
  login-account.amazon.accountinfo-renew.com
  login-account.amazon.manage-accounttid.com
  login-account.bangondivorce.com
+login-account.customerservicesamzon.com
  login-account.customersupportamazon.com
  login-account.my-links.id
  login-account.servebeer.com
@@ -245298,11 +238034,11 @@ login-citizensbank.com
  login-desjardins.website
  login-device-authenticate-online.com
  login-dvla.com
-login-ee.validate-sec-details.com
  login-eeuk.com
  login-eeweb.com
  login-en.live
  login-engb.com
+login-facebook-app.cf
  login-facebook-app.ga
  login-facebook-app.ml
  login-facebook-app.tk
@@ -245347,6 +238083,7 @@ login-labanquepostale.net
  login-live-auth.herokuapp.com
  login-live.com-s02.info
  login-log.secure-insurance-limiteds-paypal.idw877g4r51.business
+login-made-in-china-com-c39babp0gud5bpg9abid-securelogin.pantheonsite.io
  login-mailbox.cloud
  login-micro92ix5mcd42tcdmp1uff56e3fhf9h5n.s3.us-east-2.amazonaws.com
  login-microgkooffice365.tk
@@ -245869,6 +238606,10 @@ loginemailatt.weebly.com
  loginfacebook-movil.com
  loginfacebook-tinjau-blokir.ga
  loginfacebook-tinjau-blokir.ml
+loginfb2020.cf
+loginfb2020.ga
+loginfb2020.ml
+loginfb2020.tk
  loginfbonline.loginfacebookonline.com
  loginfo-tkconf.web.app
  loginfreemembergroups.tk
@@ -246085,6 +238826,7 @@ lokalnie-248719.in.net
  lokalny-informator.pl
  lokbharti.com
  lokcgrhcnrectradwce.weebly.com
+lokdj-jk.buzz
  lokdonaefb.com
  lokein.com
  lokentpaypal.com
@@ -246244,6 +238986,7 @@ loolmarathon207.com
  loooijtrcmxrccbt-dot-millinium.ey.r.appspot.com
  loop.mainimagephotographics.com
  loopagcom.nckifrance.gdn
+loopncode.com
  loopsol.com
  loopsuite.buzz
  looptraffic.com.au
@@ -246275,6 +239018,7 @@ lopkyt.brucebil.repl.co
  loplopuseres.blogspot.com
  loporkfird.com
  lopperment.com
+loprifkd.com
  loprus.pl
  lopsakitiu.com
  loptuscsgogif.work
@@ -246340,7 +239084,6 @@ lostshaman.com
  losvasosdelvecino.com
  losvpgjwgkgxohfa-dot-millinium.ey.r.appspot.com
  lot1.ml
-lotbase.guru
  lotecruz.org.co
  lotekkurier.com
  lotekurier.org
@@ -246415,6 +239158,7 @@ lovebig2.ml
  lovebugflorist.com
  lovecrushweddings.com
  lovedone3ww.weebly.com
+lovedream.cyou
  loveforevermea.com
  loveforriches.com
  lovefunpage.pw
@@ -246637,6 +239381,7 @@ lsgskychefs.000webhostapp.com
  lsh.cactusss.cn
  lshcvpiuynscjsmhjddnyfpdsajeaohyfyyx-dot-cedar-code-289917.nn.r.appspot.com
  lshjzulzdas.top
+lsiting-realty-fb-realestate-id4555.000webhostapp.com
  lsiuscanyo.xyz
  lsjackets.com
  lsjdh1.xyz
@@ -246730,6 +239475,7 @@ ltkgnabefqrjjtmi-dot-millinium.ey.r.appspot.com
  ltkocurzitn.com
  ltkvzpnkcrieamfs-dot-millinium.ey.r.appspot.com
  ltlcr.com
+ltmhomes.org
  ltmxibwkqywyxljlhqtqzcjtgt-dot-gleowayel400503.uc.r.appspot.com
  ltnoxnicxpsqqemz-dot-millinium.ey.r.appspot.com
  ltoken-app-ativacao.tk
@@ -246834,8 +239580,9 @@ luckys.onpubg.com
  luckys13spin.dpubgx.com
  luckys14.com
  luckys15spin.my.id
-luckyskin15wipon.otzo.com
+luckyskinfree.giize.com
  luckyskinpubx.ddnsgeek.com
+luckyskinspin.giize.com
  luckyskinz.xyz
  luckyspin-halloweens15.dns05.com
  luckyspin-pubgm.xxuz.com
@@ -246844,6 +239591,7 @@ luckyspin.rulepubg.com
  luckyspin.vyxz09.com
  luckyspin13s.com
  luckyspin2020.jetos.com
+luckyspinews.dnset.com
  luckyspinfrees13.myvnc.com
  luckyspinn13.com
  luckyspinner.25u.com
@@ -246864,6 +239612,7 @@ luckyspinsclaimitem.4dq.com
  luckyspinsfree.com
  luckyspinspubg12.com
  luckyspinss.com
+luckyspinss.ooguy.com
  luckyspinsss13.com
  luckyspintencents.com
  luckyspinxpubg.giize.com
@@ -247004,6 +239753,7 @@ luraymo.xyz
  lurbaujcmacmkmyq-dot-millinium.ey.r.appspot.com
  lurdsolpadnsnphyhpzmlakauz-dot-gleowayel400503.uc.r.appspot.com
  lurenzhuang.cn
+luringen.today
  lurmhnoyzfoctwnhzuitmtjiwx-dot-gloff849483.uk.r.appspot.com
  luroi.com
  luroousa.org
@@ -247446,6 +240196,7 @@ m.emailnewchils.com
  m.emb8799.com
  m.emd1275.com
  m.emd2523.com
+m.emd9856.com
  m.emh2880.com
  m.emj6977.com
  m.emk2229.com
@@ -247478,6 +240229,7 @@ m.facebok-marketplace-item-512422.remindway.com
  m.facebok.com-maketplace-itm-68.6457797544234.com
  m.facebook-acc.verify-sistem.app
  m.facebook-check.page-new.com
+m.facebook-check.page.piobird.com
  m.facebook-market-item-7523412.rosesjewelrybox.com
  m.facebook-market-place-item-15122.myflexapp.com
  m.facebook-market-place-item-547645643.johnlathamknapp.com
@@ -247666,9 +240418,9 @@ m.faceebok.com-id952753.item8723953273474253.com
  m.faceebok.id57923583752956248753421.item445237862363267.com
  m.faceebok.listing-ad671298654-item5902367532892.com
  m.faceebok.listing518892573-id581932-item15672952535823325.com
+m.faceebook.com-id-69846973.item4103678329627.com
  m.faceebook.com-id091525762389.item72736194257923972256.com
  m.faceebook.com-id1-1787256928.item6792032276486.com
-m.faceebook.com-id1-19283877.item76829368236937.com
  m.faceebook.com-id1-23976823.item5126582996743.com
  m.faceebook.com-id1-276457.item22132548979119575.com
  m.faceebook.com-id1-290439.item8859157952659783.com
@@ -248016,6 +240768,7 @@ mabanque-fortuneo-fr.net
  mabanque.bnpparibas.fr.asuransiallianz-indonesia.com
  mabanquecrypto.com
  mabar-freefire9.freakk27.my.id
+mabar-grupbudi01gaming30.zzux.com
  mabar-members.000webhostapp.com
  mabar-youtuber.infofree443.cf
  mabarbangbudi01ayo.000webhostapp.com
@@ -248158,6 +240911,7 @@ madhevmedglobal.com
  madhousedancefit.com
  madhusmitatravels.com
  madibalohilalamb.duckdns.org
+madiffusion.digital
  madinahdrycleaner.co.uk
  madinarutimaker.com
  madinblack.com
@@ -248619,6 +241373,7 @@ mail-appswebsterhelp0855.larilarikemanaajanyuak.com
  mail-auth-5bae3.web.app
  mail-authenticate-sever-check.000webhostapp.com
  mail-b7f0c.firebaseapp.com
+mail-checkseo.pl
  mail-detail.tk
  mail-expired-office.dnsup.net
  mail-generali.com
@@ -248748,6 +241503,7 @@ mail.chat.whatsapp.event-indo.com
  mail.chatingonline2whatsapwrkngspammers2020.ydns.whatssap.top
  mail.chatt-whattsahp18.20.itsaol.com
  mail.chattwhatps.my.id
+mail.chatwhatsapp.comgwksndm9upyhxr8u3akjaw.jointo-23.tk
  mail.chatwhatsapp.vipez.tk
  mail.chatwhatsapp423.ooguy.com
  mail.chatwhatsappgroupbkp.joinskuy.cf
@@ -248824,6 +241580,7 @@ mail.fb-vidio.xyz
  mail.fb23674-page76219-real-estate-item52659.house
  mail.fb29674-page47659-real-estate-item75642.house
  mail.fb47856-page27934-real-estate-item47857.house
+mail.fb67835-page48924-real-estate-item57863.house
  mail.fb89364-page67824-real-estate-item67812.house
  mail.feesthut.be
  mail.ffacebook.online
@@ -248853,10 +241610,12 @@ mail.goyak.com
  mail.grantedwriters.com
  mail.gratisincubator.item1.shop
  mail.group-whastapp55.claim99.com
+mail.group.whatsapp.terbaru.viral.link-web.tk
  mail.groupbokepp.20.itsaol.com
  mail.groupbokepx.20.itsaol.com
  mail.groupbpswhatsapp.xxxjoin.cf
  mail.groupwanew.bkp21.com
+mail.groupwhaatsppmomjoin.tk
  mail.groupwhatsappvirale26312.vvipzz3.com
  mail.groupwhatshapbokep.opendm.net
  mail.groupzwhatsapp.giize.com
@@ -248899,6 +241658,7 @@ mail.hooverclaimsolutions.com
  mail.hotgirlsgames.xyz
  mail.hs-notifiesinfo.com
  mail.hs-payeesecurity.co.uk
+mail.hsbc-secure.info
  mail.hspayee-alert.com
  mail.huahaotex.com
  mail.humanlypossibletv.com
@@ -248979,6 +241739,7 @@ mail.lovesolutionsastro.com
  mail.lpgtrading.ru
  mail.luckyskinn.accesscam.org
  mail.luckyspinpubg.theworkpc.com
+mail.luckyxskinfree.giize.com
  mail.lwpr.com.cn
  mail.m2-sac.com
  mail.mabar.budi.netlow.gq
@@ -249003,7 +241764,6 @@ mail.mobielupdate-mijning.top
  mail.mrdizi.com.au
  mail.mxonline23.com
  mail.my-appleid.in
-mail.my3-billingsupport.com
  mail.mypayee-login.com
  mail.nathaliadill.com.br
  mail.neftlixaggiornare.com
@@ -249073,7 +241833,6 @@ mail.pubgreward.myddns.rocks
  mail.pubgrp13.com
  mail.pubgsreward.casacam.net
  mail.pubgtournament.giize.com
-mail.pubgxmobile.giize.com
  mail.pubgxreward.casacam.net
  mail.pulsafreenew2020.telkomberbagi.com
  mail.pvewildlife.com
@@ -249112,6 +241871,7 @@ mail.secure-verified-check.webredirect.org
  mail.secure.home-cancelpurchasemyitem428943.theworkpc.com
  mail.secure.info.home-dashboard-ridireecttoamazonverif.kozow.com
  mail.secure0-amazon-account.gleeze.com
+mail.secure08chase.com
  mail.secure1login.com
  mail.secureamazonupdateinformation.ddnsgeek.com
  mail.secureintl-amzonsecurersca.accesscam.org
@@ -249203,6 +241963,7 @@ mail.valetparkingschiphol.com
  mail.verification-auth-update.com
  mail.verification-netflix-accounts-com.giize.com
  mail.verify.myaccount.paypal.com-webscridauth23678129.me
+mail.verifycation-fb.cf
  mail.verifylogin.cf
  mail.verifymythree-update.com
  mail.verifypaypal-id2671.serveirc.com
@@ -249232,6 +241993,7 @@ mail.whatsapp.grup-berbagi.video.bok3p.gruopwa.com
  mail.whatsapp.invitewa.chat
  mail.whatsapp18.grup-bkp.cf
  mail.whatsapp2020.my.id
+mail.whatsappbkp.sangenih-crot.cf
  mail.whatsappbudigaminggrup.joins911.gq
  mail.whatsappgroub.viraljoin.com
  mail.whatsappgroup.claimzz9.ml
@@ -249478,6 +242240,7 @@ mailver83900.xyz
  mailver90565.xyz
  mailveri.us
  mailverify2020.upappscryexpireto24hour.gjdaegs.com
+mailvertigiedsc.weebly.com
  mailview115643.xyz
  mailview11982.xyz
  mailview1907.xyz
@@ -249516,9 +242279,11 @@ mainenewsdaily.com
  mainfesttaionstopsgp.us
  maingelap2122.000webhostapp.com
  mainguardmatrimony.com
+mainink.ddns.net
  mainlineduluth.com
  mainlis.pt
  mainoaccountverification.weebly.com
+mainposteddcaree.com
  mainpubgm.com
  mainsource-dot-phpapp-shshh.df.r.appspot.com
  mainstreetsci.com
@@ -249719,10 +242484,10 @@ maleficentslovely.000webhostapp.com
  malejaduff.com
  malencacom.baerseventake.top
  malepenet.xyz
+maleplus.cyou
  maleposer.com
  malerbetriebbandcom.shaxiaact.top
  malereieninfo.batwoqisellers.top
-maleselongator.buzz
  maleselongatorsplus.buzz
  malesherbiaceous.xyz
  malevolent-ornament.000webhostapp.com
@@ -250013,6 +242778,7 @@ manage04e-chas-e.serveusers.com
  manage05c-app-le-id.cusmoreservice.com
  manage24-paypal.com
  manage2accountid.servehttp.com
+manageaccount-webverifynginformations.asdaedft.com
  manageaccount-webverifynginformations.daefdstvzx.com
  manageaccount-webverifynginformations.dakkownh.com
  manageaccount-webverifynginformations.dakomjs.com
@@ -250080,6 +242846,7 @@ managepayees.com
  managepaypalaccount.serveirc.com
  managepaypql.serveirc.com
  managephoenix.com
+managepubg.com
  managepurchaseidpayment.com
  managepurchaseuit.ddnsking.com
  manager-complete-individu-account-data-setup-amazon.com
@@ -250367,7 +243134,6 @@ mapnarailbuscom.shaxiareason.top
  mapone.co.za
  mapp.ufc.br
  mapper.terra-drone.net
-mapport.com
  mappouldyr.com
  maprotec.com.co
  maps.apple-manager.com
@@ -250811,6 +243577,7 @@ marketplace-84hf73gf46sa93.com
  marketplace-851852.com
  marketplace-856453318.com
  marketplace-8575357832.com
+marketplace-85768171.com
  marketplace-86837173.ballscrew-z.com
  marketplace-8762353.us
  marketplace-876325323.com
@@ -250824,6 +243591,7 @@ marketplace-business.000webhostapp.com
  marketplace-cdfbw2t0he74ke.com
  marketplace-fac3b00k051540-itempageproperties6457.com
  marketplace-facebook.id302817226124378777-listing.com
+marketplace-fb-387263.com
  marketplace-fb-9037628.com
  marketplace-fb-com.000webhostapp.com
  marketplace-g0rjluktthkp6e.com
@@ -251280,6 +244048,8 @@ marketstreetinternational.com
  marketvit.by
  markfb-22390013.englishtest.biz
  markfb-22823183.englishtest.biz
+markfb-41348387.englishtest.biz
+markfb-66898747.englishtest.biz
  markforinsurance.com
  markfranphotography.com
  markgmyrek.com
@@ -252070,6 +244840,7 @@ mcglynnflats.buzz
  mcgoughc.com
  mcgrafica.it
  mcgrath185620.xyz
+mcguirkss.com
  mchase04c.com
  mchub.org.uk
  mcia.mu
@@ -252398,7 +245169,6 @@ mediumangelcom.batwoqisent.top
  mediumangelcom.shaxiaaustralia.top
  mediumangelorg.shaxiaaverage.top
  mediumangelorg.shaxiacenter.top
-mediumlustrousconsulting.olivercaba.repl.co
  mediumorgan.com
  medixeg.com
  medkris.com
@@ -252524,6 +245294,7 @@ megaofertaslu.com
  megaoffs7.com
  megapak.co.zw
  megapak24h.pl
+megapost.tech
  megapromo-faturapremiada.cloudaccess.host
  megapromocaoeofertas.com
  megapromooocaoo.com
@@ -253205,8 +245976,6 @@ meuspontos.v6.rocks
  meuspontosclientes.com
  mevaconyeu.vn
  mevaembalagens.com
-mevestige.com
-mevicompk.com
  mewahgroup.pw
  mewduei.com
  mewijtaku.brandstorez.su
@@ -253257,6 +246026,7 @@ mfacebookmarketing.com
  mfaceebook.0fees.us
  mfapi.cn
  mfb-marketplace-95297361.com
+mfb-marketplace.com
  mfbhelp-213481848684090.000webhostapp.com
  mfbmlbbautumndrawevent.000webhostapp.com
  mfbnew.000webhostapp.com
@@ -253331,6 +246101,7 @@ mgdframing.com
  mgdglass.com
  mger.co
  mgerencieatualizacaostar.com
+mgetallfixcenter.com
  mgeternelle.com
  mgfrw.xyz
  mgfvsij.prodivorce.org
@@ -253873,6 +246644,7 @@ mijnpasherstel.xyz
  mijnpersoonlijkemeningcom.shaxiaput.top
  mijnpersoonlijkemeningcom.unitravel.top
  mijnpostverzending.com
+mijnpostverzending.info
  mijnprivekaart.com
  mijnrabo.info
  mijnrabobetaalpas-vervangen.xyz
@@ -253896,6 +246668,7 @@ mikelyfacecream.com
  mikemarketing.chifanassume.top
  mikemuder.com
  mikemundytyyhh.com
+mikenors3.com
  mikepitcherspeaks.com
  mikeramirezcpa.com
  mikesar.com
@@ -253983,6 +246756,7 @@ milhasdigitalatualize.com
  milhasnatal.com
  milhaspresentesseguras.club
  milhassemprepresente.club
+milhassemprepresenteresgate.link
  milindtech.com
  milindtechprojects.com
  milinotv.fatal.ru
@@ -254633,6 +247407,7 @@ ml7b.com
  mla3-d4-12s-23.com
  mlacademy.net
  mlakshfee.ml
+mlbb-big-events.mrbonus.com
  mlbb-event1.2waky.com
  mlbb-free-skins-halloween.mypop3.net
  mlbb-giveskins.jkub.com
@@ -254648,6 +247423,7 @@ mlbb-skineventpromo233.serveuser.com
  mlbbevent.xyz
  mlbbfreediamonds36.000webhostapp.com
  mlbbfreeskinnewupdate.zyns.com
+mlbbkof.pocketmc.net
  mlbbnewupdatefreeskin.zyns.com
  mlbbskineventpromo37.myz.info
  mlbbskineventpromo39.myz.info
@@ -255020,6 +247796,7 @@ mobile-bank.work
  mobile-banking-check-uk.com
  mobile-banking-issue.com
  mobile-banking.work
+mobile-bankinghelp.com
  mobile-bill.virgn.caem.mw
  mobile-billing.services
  mobile-browser.aba.vg
@@ -255039,6 +247816,7 @@ mobile-info-wells-fargo.com
  mobile-instagramaid.com
  mobile-kleinanzeigen.de.m-elnioggen.de
  mobile-legends-bagi2-hadiah.my.id
+mobile-legendsnovember13.mrbonus.com
  mobile-login-bofa.com
  mobile-ltau.serveirc.com
  mobile-my3.com
@@ -255052,6 +247830,7 @@ mobile-personallite30hrs.com
  mobile-portail.live
  mobile-privacy-fargo.com
  mobile-profile-fargo.com
+mobile-protection-page.my.id
  mobile-provider.info
  mobile-redirect-wells.services
  mobile-refund.ca
@@ -255160,6 +247939,7 @@ mobileatualizacao.com
  mobileauth.co
  mobileauto-services.co.uk
  mobilebanking-account.com
+mobilebanking-auth.com
  mobilebanking-check.com
  mobilebanking-disable.com
  mobilebanking-protection.com
@@ -255363,6 +248143,7 @@ moderninvestments.icu
  modernmarketingsystems.ru
  modernrattan.com
  modernsfoodproducts.com
+modernshop.xyz
  modeschmuckankaufcom.chifanassume.top
  modest-murdock-a959b2.netlify.app
  modest-yonath-531225.netlify.app
@@ -255380,6 +248161,7 @@ modhbrahmansthapakconviner.com
  modhbrahmasamaj.org
  modhi.no
  modified-argon-286212.ey.r.appspot.com
+modified-legacy-295008.uc.r.appspot.com
  modignite.com
  modimedia.in
  modinatululoomislamia.com
@@ -255459,7 +248241,6 @@ mohinhgohandmadedtoys.com
  mohitranpura.com
  mohrcircle.icu
  mohrislands.buzz
-mohrrowapt.xyz
  mohseniyeh.com
  mohsinsaeedulhaq.com
  mohzaenisahrudin.my.id
@@ -255535,7 +248316,6 @@ molie.chat
  molinier.etienne.free.fr
  molinoalbor.com.ar
  molkereihuettenthalde.nckirent.gdn
-mollienadiya.ru
  molllaoukhcbtfbrehzrvwhoaqvmtyryiqdw-dot-cryptic-now-290917.ey.r.appspot.com
  molllaoukhcbtfbrehzrvwhoaqvmtyryiqdw.cryptic-now-290917.ey.r.appspot.com
  molloconsulting.co.za
@@ -255663,6 +248443,7 @@ moneyback3.com
  moneybanda.info
  moneyclap.com
  moneycoach.systems
+moneycretor.work
  moneyhairparty.com
  moneylinks.page.link
  moneylt.info
@@ -255695,6 +248476,7 @@ monidopo.bee.pl
  moniekkuijpers.com
  monikaagnani.000webhostapp.com
  monikareplin.pl
+monikawein.de
  monikazzkitchen.com
  moninedwards.com.au
  monio.fr
@@ -255774,6 +248556,7 @@ montepaschidislena.com
  montepaschidlsiena.com
  montepaschisiena.com
  montepaschispa.eu
+montepaschldisiena.com
  montepio.info
  monterreyaldia.000webhostapp.com
  monterreysalsacongress.com
@@ -255945,7 +248728,6 @@ mortgagehut.ca
  mortgageks.com
  mortgageratesinfo.shaxiapurpose.top
  mortifiedfeety.net
-mortifiedneglectedattribute--five-nine.repl.co
  morton08.com
  mortonbahamascom.nckiparis.gdn
  mortonforks.xyz
@@ -255996,7 +248778,7 @@ mosuleznybard.ru
  moszipper.ru
  mota.creativemediaenterprisesinc.com
  motarnp.com
-moteefeblog.com
+moteefeonline.com
  motelesapolo.motelnow.cl
  motelfortpierce.com
  motelgachsar.com
@@ -256257,6 +249039,7 @@ mqsjlhluesourdni-dot-millinium.ey.r.appspot.com
  mqvccrr.kempongkenyot.info
  mqvcwfkuknxamymr.top
  mqxumfbgqevbbmld-dot-millinium.ey.r.appspot.com
+mqyrbdzzxx.duckdns.org
  mr-ads.ir
  mr-concept.pl
  mr-digitalmarketing.com
@@ -256312,6 +249095,7 @@ mrho.net
  mrhunter3x.hopto.org
  mrhydra.com
  mridubykirti.com
+mrieoaofice.link
  mrikzoacuisqbncq-dot-millinium.ey.r.appspot.com
  mrileds.com
  mrindiaumbrellas.com
@@ -256671,6 +249455,7 @@ mufg.jp-bankq.com
  mufg.kay56.com
  mufg.wxhbdb.com
  mufg.zb-ipr.com
+mufgcard.icu
  mufgcard.xyz
  mufgfirm.com
  mufgunionbank.ca
@@ -256859,7 +249644,6 @@ musesmilos.gr
  museumszambia.org
  museumtheoriginal.com
  mushafiqsultan.com
-mushroomfarmhouse.com
  music-appstore.i7cgiv01.info
  music-for-events.com
  music-hnmgfy5ei2-7fjq4c5vz.vercel.app
@@ -257143,13 +249927,13 @@ my-ee-mobile-view-visit-store-helpdesk.000webhostapp.com
  my-ee-online.org
  my-ee-pay.com
  my-ee-payments.co.uk
+my-ee-portal.com
  my-ee-uk.com
  my-ee-webhelp.000webhostapp.com
  my-ee.com
  my-ee.org
  my-eeaccount.com
  my-emsdeliver.ownip.net
-my-faccbook-page-24.000webhostapp.com
  my-faccbook-page-26.000webhostapp.com
  my-faccbook-page-27.000webhostapp.com
  my-faccbook-page-31.000webhostapp.com
@@ -257164,6 +249948,7 @@ my-giffgaff.network
  my-giga.ru
  my-halifax-account-security.com
  my-halifax-account.com
+my-halifax-online.com
  my-halifax-security.com
  my-icloud.in
  my-ing-nl.com
@@ -257243,6 +250028,7 @@ my-virgin-media-account.com
  my-virgin-media-billing-help.com
  my-virgin-media-billing.com
  my-virginmedia-billing.com
+my-virginmedia-billinghelp.com
  my-virginmedia-help.com
  my-wallet-platinum.info
  my-wallet-platinum.su
@@ -257273,9 +250059,11 @@ my.instagram.com.login.page.jmz.ir
  my.jcb.co.jp.365huyu.com
  my.jcb.co.jp.aogo.vip
  my.jcb.co.jp.cjtaqo.top
+my.jcb.co.jp.daeesycy.top
  my.jcb.co.jp.dbplb.top
  my.jcb.co.jp.ddzhy.com
  my.jcb.co.jp.drdjb.top
+my.jcb.co.jp.fetb.vip
  my.jcb.co.jp.gzjct.com
  my.jcb.co.jp.hjhslm.top
  my.jcb.co.jp.hzsfh.com
@@ -257284,6 +250072,7 @@ my.jcb.co.jp.igjxpg.top
  my.jcb.co.jp.jnnxiw.top
  my.jcb.co.jp.jptnwz.com
  my.jcb.co.jp.lhnpj.top
+my.jcb.co.jp.quanmama.org
  my.jcb.co.jp.yulion.vip
  my.jcb.co.jp.yxjcd.com
  my.mzhrbs.work
@@ -257784,6 +250573,7 @@ myee-support.000webhostapp.com
  myee-support.co.uk
  myee-supports.000webhostapp.com
  myee-uk-billing.com
+myee-uk.user-id0120.com
  myee-uksupport.com
  myee-verifybill.com
  myee-verifypayment.com
@@ -257931,6 +250721,7 @@ mygwyl.shop
  myh-la.com
  myh3g-portal.com
  myhair4her.com
+myhalifaxlive.com
  myhealth.net.au
  myhealthinsquotes.com
  myhealthreview.ml
@@ -258025,7 +250816,6 @@ mylogicbd.ml
  mylogin-apple.com
  mylogin-config.web.app
  mylogin.navirakuten-card.buzz
-mylogin3.com
  mylolis.com
  mylovejar.com
  mylovelybluesky.com
@@ -258113,6 +250903,7 @@ myonline-ee.co.uk
  myonlineauctionbiz.com
  myonlinebusiness.agency
  myonlinepokiesblog.com
+myonlineusajobs.com
  myoplata.rest
  myownsqure.com
  myozhost.com
@@ -258171,6 +250962,7 @@ mypoosidjfjr.com
  myportal-eepay.com
  myportalsupport.ml
  myposteprivati.giize.com
+mypostmastermicrosoftonliapportal.giize.com
  myppaccountlogin.com
  myppaccountverificationlogin.com
  myppactivate.com
@@ -258276,6 +251068,7 @@ mystifying-wozniak-81b9b6.netlify.app
  mystifying-wozniak-81b9b6.netlify.com
  mystoryis.me
  mystreamstuff.com
+mystripe.net
  mystuffinc.com
  mysuaaservices.com
  mysupport.apple.com-conect.us
@@ -258310,6 +251103,7 @@ mythical-rule.000webhostapp.com
  mythikall.com
  mythpolitics.com
  mythree-account-restrictions.com
+mythree-accounts-billing.com
  mythree-alerts-billing.com
  mythree-alerts-billling.com
  mythree-alerts.com
@@ -258414,6 +251208,7 @@ myvichyfriend.000webhostapp.com
  myvidio.site
  myvieswgratifies.com
  myvirginmedia-bill.com
+myvirginmedia-billing.com
  myvisualeyes.info
  myvodafone.login.verify-billing-secure.com
  myvodafone.net
@@ -258422,7 +251217,6 @@ myvoicelinkedinapp.com
  mywasta.com
  mywayeg.info
  myweb-update.dynamic-dns.net
-myweb.westnet.com.au
  mywebarticle.com
  mywebcoupon.com
  mywebnerd.com
@@ -258456,6 +251250,7 @@ mzalldat.com
  mzax.info
  mzbsabubfmgyepll-dot-millinium.ey.r.appspot.com
  mzcmvmdhvizsfouqxbpmkejkzb-dot-gloff849483.uk.r.appspot.com
+mzcnet.net
  mzcynaih.shoesmogul.com
  mzd.dermals.org
  mzdb.gulfhirings.com
@@ -258752,6 +251547,7 @@ nacoaudit.it
  nacoppuqzevyczujuofzwtfwrm-dot-gleowayel400503.uc.r.appspot.com
  nacorafr.nckifitness.gdn
  nactualizaciones.com
+nadaisatahba.blogspot.com
  nadegrees100.com
  naderuser.ddns.net
  nadez.ddns.net
@@ -259231,6 +252027,7 @@ natwest.internetbanking-logs.com
  natwest.internetbanking-sec.com
  natwest.internetbanking-specs.com
  natwest.internetbanking-users.com
+natwest.mypayee-cancel.co.uk
  natwest.newpayeesalert.com
  natwest.newpaymentalert.com
  natwest.newpaymentcheck.com
@@ -259242,6 +252039,7 @@ natwest.paymentcheck-secureportal.com
  natwest.paymentscheck.com
  natwest.paymentscheckalert.com
  natwest.personal-inc.com
+natwest.personal-online-valid-login.com
  natwest.personal-opts.com
  natwest.personal-sec.com
  natwest.personals-account.com
@@ -259415,7 +252213,6 @@ nbjpkvahywptacry-dot-millinium.ey.r.appspot.com
  nbjrir.cf
  nbjrnnuafugnifjk-dot-millinium.ey.r.appspot.com
  nbkany.com
-nbkdjfhghg.xyz
  nbkikoolfpygskur-dot-millinium.ey.r.appspot.com
  nblomegadunyasi.com
  nbm982.com
@@ -260202,6 +252999,7 @@ netflix.ukvalidate.com
  netflix.unpaid.suspcription.update.uk-gov.help
  netflix.update.informations.clientlogin.quickpharma.ro
  netflix.updatebilling-info.com
+netflix.updateinfo-bill.com
  netflix.validate.online-overviev-department.info
  netflix.verifymy-account.com
  netflix.view-mybilling.com
@@ -260499,6 +253297,7 @@ new-grupwa.xxuz.com
  new-indycb-dot-phpapp-shshh.df.r.appspot.com
  new-log-fb.cf
  new-login-deregister.com
+new-login-fb.cf
  new-login-fb.gq
  new-login-o2.com
  new-login-surrel.ml
@@ -260510,7 +253309,7 @@ new-my3-helpdesk.ga
  new-my3-updateform.com
  new-my3.com
  new-my3.uk
-new-my3bill.com
+new-my3update.com
  new-mythree.com
  new-onlinepayee.com
  new-opt.com
@@ -260677,7 +253476,6 @@ newevent-freefire27.login-772.cf
  newevents12.qqpubgmevents.com
  neweventsdarigarenakulgar.claims2.com
  neweventsmobilelegends.com
-neweventspubgmobile.com
  newexchangefileservicepromotion.duckdns.org
  newfaceinteriors.com.ng
  newfaceproject.com
@@ -260790,6 +253588,7 @@ newpayeeadd-secure.com
  newpayeecancel.net
  newpayeecancellogin.com
  newpayeehalifax.com
+newpayeemanage-help.com
  newpayeemanage-online.com
  newpillelement.com
  newplastic.es
@@ -260854,7 +253653,6 @@ news.dealer-security-4679451287.xyz
  news.denekasd.com
  news.dichvugiarenhatban.com
  news.dm
-news.doitnow20.online
  news.exoret.com
  news.find-itemtrade-925002348235.xyz
  news.floridalottery.us
@@ -260878,7 +253676,6 @@ news.sell-fast-trade-693476473240.xyz
  news.sell-fast-trades-9942396003240.xyz
  news.sqllitlever.info
  news.trade-other-cars32564285.xyz
-news.whereareu24.online
  news247naija.premiumprologistics.online
  news4uni.com
  news620.com
@@ -261425,6 +254222,7 @@ nifgvqnbtjsuqfvc-dot-millinium.ey.r.appspot.com
  niftygifting.com
  nifudrqot.vipsnapchatsexting.com
  nigarsas.com
+nigashg87566.com
  nigat-plc.com
  nigelbagley.com
  nigeriacleaningservice.com
@@ -261902,7 +254700,6 @@ nncgcnuwxqlnkkemzimcaqodwv.triple-upgrade-293822.rj.r.appspot.com
  nncn.cloudaccess.host
  nnd2020.com
  nndelang.com
-nndtechlabs.com
  nnedvegetables-seller148.com
  nneitlox.com
  nnexjffcrquaggkf-dot-millinium.ey.r.appspot.com
@@ -262423,13 +255220,13 @@ notice-wells-fargo.com
  notice-wells-fargo.services
  notice.amazon.sign-47c6509f7d6e09fa706721d8a108c1be.satulima.com
  notice.update.service.nvbs93zwjzd.com
-notice2019.tokyo
  noticealertwf.com
  noticecapitalalert.com
  noticecustomermail.weebly.com
  noticehelp-xnxxappleverify.toloanjgrf.com
  noticese.duckdns.org
  noticestat.com
+noticevertical.com
  noticiando.live
  noticianews.xyz
  noticias.canal22.org.mx
@@ -262592,7 +255389,6 @@ novito.com.ua
  novo-acesso.segurowebmail.ml
  novo.aplicativobr.ml
  novo.jcdigital.com.br
-novo.skelt.com.br
  novoaplicativo.com
  novobancoprotecaosegurancadia.site
  novocicloconsultoria.com.br
@@ -262626,6 +255422,7 @@ nowemiasteczko.pl
  nowfree-skinkof.wikaba.com
  nowgifts.net
  nowinki.blog-online.eu
+nowjoingrupwainvited.gq
  nowley-rus.ru
  nowmyhometrust.org
  nowmysupp0rt61712123456789.tk
@@ -262651,6 +255448,7 @@ npagon.com
  npakbsgolrkvbcsi-dot-millinium.ey.r.appspot.com
  npay.store
  npdgtdaelayxiwbq-dot-millinium.ey.r.appspot.com
+npekgapplnch-164061821.sangekasra.ir
  npgxipdscjhyzuec-dot-millinium.ey.r.appspot.com
  nph1.jaysbrand.com
  nphdltd.com
@@ -263384,6 +256182,7 @@ nyzjzbzgrwswfsggjthkgxsyztsmpogfmtsh-dot-cryptic-now-290917.ey.r.appspot.com
  nyzkmcotbcpzfehsgpihquganm-dot-gloff849483.uk.r.appspot.com
  nyzmftrsjdrxcprxjquwhjwlro-dot-gleowayel400503.uc.r.appspot.com
  nyzyysgogpbmnpao-dot-millinium.ey.r.appspot.com
+nz-bk01.gq
  nz-c0bk.cf
  nz-c0bk.gq
  nz-c0bk.ml
@@ -263476,12 +256275,15 @@ o2-billing-support.com
  o2-billing-uk.com
  o2-billing.support
  o2-billing129.co.uk
+o2-billingalerts.com
+o2-billingerror.com
  o2-billinginfo-update.com
  o2-billingpage.com
  o2-billingsecure.com
  o2-billinguk.com
  o2-billsupport.co
  o2-billupdate.com
+o2-confirm.net
  o2-failed-payment.com
  o2-login.com
  o2-manage.com
@@ -263543,7 +256345,6 @@ o2alerts-secureinfo-billing.com
  o2alerts-support.com
  o2billing-account.com
  o2billing-error.com
-o2billing-info-auth.com
  o2billing-page.com
  o2billing-secured.com
  o2billing-uk.com
@@ -263556,7 +256357,6 @@ o2billingsupport.com
  o2cab.com
  o2central.com
  o2info-billing-support.com
-o2infobilling.com
  o2j01.weblium.site
  o2myaccount-info.com
  o2securebilling.com
@@ -263657,7 +256457,6 @@ oasys-tec.com.ar
  oaszhmayrhnwqrki-dot-millinium.ey.r.appspot.com
  oatmsdch.buzz
  oatmxvllrjbjlmrj-dot-millinium.ey.r.appspot.com
-oatodecomer.com
  oauth-vk-com-authorize-client-id-4083558scope-107374redirecturi.design
  oauth.vk.com-authorize-client-id-41083558scope-145704redirecturi.dbtwalks.ru
  oauth.vk.com.authorize-client-id-4083558scope-107374redirecturi.aroma-kleaning.ru
@@ -263784,6 +256583,7 @@ obvtechnologies.com
  obxebike.com
  obyavlenuya.online
  obzjykaadimfbxjm-dot-millinium.ey.r.appspot.com
+oc-31493543.iptvhdcenter.com
  oc-37077148.iptvhdcenter.com
  oc-44638740.iptvhdcenter.com
  oc-55831825.iptvhdcenter.com
@@ -264022,7 +256822,6 @@ ofacepraelasok.xyz
  ofam.com.ru
  ofcaidqnvyfutdrhncdgejaovuvxcrvknnxs-dot-glenxpecial3009493.ey.r.appspot.com
  ofcatalin.it
-ofcomesr.com
  ofdpsogtdpaljfus-dot-millinium.ey.r.appspot.com
  ofdugudqpksgzlsavfmyxkzefp-dot-gleowayel400503.uc.r.appspot.com
  ofelafoods.com
@@ -264048,6 +256847,7 @@ ofertadalu.black
  ofertadasemanaquerentena.online
  ofertadconsumidor.com
  ofertadehojelimitado.com
+ofertadenovembro2020.com
  ofertadestaquehoje.com
  ofertadisponivelsomenteaqui.com
  ofertaespecial2020.online
@@ -264129,6 +256929,7 @@ off-23211760.eaglerock-is.com
  off-28408442.emergencychemstore.com
  off-38307377.eaglerock-is.com
  off-44659919.emergencychemstore.com
+off-45316458.newsmedia77.com
  off-45877091.deployflow.co
  off-48358601.emergencychemstore.com
  off-51037525.eaglerock-is.com
@@ -264137,6 +256938,7 @@ off-63603526.eaglerock-is.com
  off-65378138.eaglerock-is.com
  off-66314123.eaglerock-is.com
  off-70569923.newsmedia77.com
+off-744722556.danskiptv.shop
  off-76662170.newsmedia77.com
  off-85607385.emergencychemstore.com
  off-87101825.eaglerock-is.com
@@ -264372,6 +257174,7 @@ office-updates-indexes.com
  office-verify.ml
  office-web.surge.sh
  office-webmail-login-f0e3c.web.app
+office-wff-administration.com
  office.cetino.com
  office.com.office.ha-poc-mcafee-o365.homeaffairsstage2ucepoc.myshn.net
  office.com.office.jconew.mcafeeoct25201814800.myshn.net
@@ -264445,6 +257248,7 @@ office365onpvd0vvxl7hjrpnqlenb2pmj3g77t.s3-us-west-2.amazonaws.com
  office365ooc.com
  office365outlookmailboxuser.wn.r.appspot.com
  office365outlookuser758693.wn.r.appspot.com
+office365portal.ga
  office365recover.com
  office365s.ddns.net
  office365update.duckdns.org
@@ -264587,14 +257391,12 @@ offroadeventsca.com
  offroadeventsusa.com
  offs-35320638.rochesternutritionist.com
  offs-71620581.rochesternutritionist.com
-offs-82603721.rochesternutritionist.com
  offshore-bankingpro.com
  offshorecitizen.bk-groups.com
  offside2.000webhostapp.com
  offsolo-gbb.tech
  offteaminvitsppdpddpid0c.an.r.appspot.com
  offthewall.top
-offwhitehoodie.us.com
  offwhiteoallrightou.today
  ofghxvbonrkpyalkakmgqvytiq-dot-gleowayel400503.uc.r.appspot.com
  ofgvjanqujyubztc-dot-millinium.ey.r.appspot.com
@@ -264895,7 +257697,6 @@ okbuilding.ge
  okclick2.ac.ug
  okdipyzgyinzcqohdnndwvftwlunetchcyfi-dot-cryptic-now-290917.ey.r.appspot.com
  okdvcqz.shoesmogul.com
-okeefeisle.buzz
  okehieugochukwucassperkroosdavid.duckdns.org
  okeyciyiz.com
  okfdjsdlfjdlsjfds.duckdns.org
@@ -265601,12 +258402,14 @@ online-bank-login5.xyz
  online-bank-logon.xyz
  online-bank-logono.xyz
  online-bankaustria-at-wps-portal-login.garryhagger.be
+online-banking-auth.com
  online-banking-halifax.com
  online-banking-login0.xyz
  online-banking-login1.xyz
  online-banking-login2.xyz
  online-banking-login3.xyz
  online-betaalplatform.club
+online-billing-details.com
  online-billingsupport.com
  online-bofa.net
  online-bpiupdate.servepics.com
@@ -265661,6 +258464,7 @@ online-lifestyle.at
  online-lloyd.com
  online-lloyds-confirm.com
  online-login-halifax.reauth-sessionid.ae937885293.secure-login-auth.com
+online-login-payee.com
  online-login-verify-auth-device.com
  online-login-wells-fargo.com
  online-login.services
@@ -265689,6 +258493,7 @@ online-postmaster.message.wptech.net
  online-postnlstatus.info
  online-private-bk.com
  online-protection.cc
+online-protection.live
  online-pusat-pusat.webnode.com
  online-renew-secure.com
  online-restore.com
@@ -265797,6 +258602,7 @@ online.ezidrive.net
  online.facebook.com.wesrd.top
  online.hmrc.gov.uk.alaventa.cl
  online.hsbc.securityinterface.name
+online.lloyds-payee.co.uk
  online.lloyds-personal.co.uk
  online.particulares-santander.club
  online.scotiabank-com.scotiweb.mx.scotlastore.com
@@ -265846,7 +258652,7 @@ onlineautualisatie.info
  onlinebankieren.mijntriodos.nl.onlinemailing.xyz
  onlinebankin.co
  onlinebanking-bankofamerica-com.cleverapps.io
-onlinebanking-huntington.serveuser.com
+onlinebanking-mobile.com
  onlinebanking-mtb.com.virtualbranch.online
  onlinebanking-payeecancel.com
  onlinebanking-support.com
@@ -265898,6 +258704,7 @@ onlinechasebk.com
  onlinechaseusa.servepics.com
  onlinechatapelsinka.000webhostapp.com
  onlinecheck-device.com
+onlinecheck-help.com
  onlinecheck-security.com
  onlinecheck.hussanways.com
  onlineclouds.cloud
@@ -265943,6 +258750,7 @@ onlinekinakatabd.com
  onlinekushshop.com
  onlinellc.stream
  onlinelloyds-info.com
+onlinelog06-huntin-san.misecure.com
  onlinelogins.ddns.net
  onlinelotobd.000webhostapp.com
  onlinemarketingwire.com
@@ -265987,6 +258795,7 @@ onlinesecure.nationwidebl.com
  onlinesecureadcbpre.000webhostapp.com
  onlinesecureadd.link
  onlinesecureverifiedaccess.com
+onlinesecurity-safety.link
  onlinesecuritycenter.xyz
  onlinesecuritylloydsuk.com
  onlineserve.duckdns.org
@@ -266047,6 +258856,7 @@ onlinlloydsec.link
  onllineemp.com
  onllineserviceuw.com
  onllygoodam.com
+onlneservices.cc
  onlnework.000webhostapp.com
  onlocase.com.br
  onlrjyyqxkwcffrw-dot-millinium.ey.r.appspot.com
@@ -266246,6 +259056,7 @@ open.emcar.com.cn
  open.updateid-8982844.com
  open.warehousesaas.co.uk
  open0.gq
+open24support.com
  openappleinc.com
  openbookingapp.com
  opencallcommunicationcentercom.shaxiaaccommodation.top
@@ -266255,6 +259066,7 @@ opendnaccvideira.com.br
  opendoc1.homelinux.com
  opendrop.fun
  openemr.supkismd.com
+openenrollments.buzz
  openforex.club
  openginerfile.podzone.org
  opengltummy.com
@@ -266342,6 +259154,7 @@ oplaty24-kurier.com
  opldjcewvregghameyxytxtywmjaxjjzgxui-dot-cryptic-now-290917.ey.r.appspot.com
  oplkij.creatorlink.net
  oplmewqr.com
+oplmuj.top
  oplohazmqggfwwbm-dot-millinium.ey.r.appspot.com
  oplus.acorn.studio
  opn-00164196.9janote.com
@@ -266360,6 +259173,7 @@ oppoedu.com.cn
  oppofile.duckdns.org
  opporingtones.com
  opportainly.xyz
+opportunitytime.club
  oppositive-raise.000webhostapp.com
  oppsite.com
  opqpygcyjnyvlddmurysztuuoe-dot-glowablu03049033.du.r.appspot.com
@@ -267313,6 +260127,7 @@ outlukupd.netlify.com
  outlukupdated.netlify.app
  outlulk.neards.xyz
  outlupdateinv.netlify.app
+outlyingcalmoctagon.figueroaads123.repl.co
  outmailingoutlook.netlify.com
  outmazx.ml
  outmost-disks.000webhostapp.com
@@ -267338,6 +260153,7 @@ outsidernyc.com
  outspokenvisions.com
  outspotgenti.com
  outspread-pails.000webhostapp.com
+outstanding-my3bill.com
  outstandingessay.com
  outthere.net.nz
  outubrochegoucomasmelhoresofertasdasemana.club
@@ -267881,6 +260697,7 @@ pacelfmetracettech.info
  pacemakerltd.com
  paceoli.com
  pacepowerglobal.com
+pacepri32.com
  pachlina.at
  pacific-formula-278007.du.r.appspot.com
  pacific-traders.com
@@ -267925,6 +260742,7 @@ pacqjijjtmxsstdkesbsxsrvbo-dot-gleowayel400503.uc.r.appspot.com
  pacradelectronics.com
  pacshorecorp.com
  pactional-docks.000webhostapp.com
+pactivatelog.xyz
  pacusdy.almostmy.com
  pacuskurier.org
  pacwebdesigns.com
@@ -268002,6 +260820,7 @@ pafindo.me
  pafnhsupgwuhctlydzbmftrjbk-dot-triple-upgrade-293822.rj.r.appspot.com
  pafnhsupgwuhctlydzbmftrjbk.triple-upgrade-293822.rj.r.appspot.com
  pag3.cf
+pagaccoveflints.buzz
  pagamenti-aruba-it.marionegromontejrd.com
  pagamenti-sella-aruba-ar63dc742e.fotoparitani.it
  pagamenti-sella-aruba-arb4f22103.noleggiobicimilano.it
@@ -268107,6 +260926,7 @@ page.cancellation.appstore.payment-detaill.info
  page.co.uk.iratrade.ml
  page.confrlmatlonyourpages7.tk
  page.icloud.account.activity-review.info
+page.login-resolutioncenterupdateinfoscrty2020.vhaygs.com
  page.manage-accountverifinginfoappsmalasa.alejandrropaldini.com
  page.manage.account-amazon.verify.server.auth.normkcxv.com
  page.notify-uscourts.online
@@ -268259,6 +261079,7 @@ painmanage.ru
  painmanagement-atlanta.com
  painpage.org
  paintable-piles.000webhostapp.com
+paintballrentals.gq
  paintbeer.nl
  painterbl.com
  painteromar.loan
@@ -268464,6 +261285,7 @@ pandou.top
  pandrol.gq
  panel-1124738.xyz
  panel-follow.ml
+panel-validate.account.access-form87213.razer15blade.com
  panel.clincofsrgry.info
  panel.gajarweb.eu
  panel.miniuser.ru
@@ -268504,6 +261326,7 @@ panouluers.com
  panpanma.top
  panpos.ae
  panproduksiyon.com
+panright.digital
  pansionat-line.ru
  pansphygmograph.xyz
  pansybird.com
@@ -268756,6 +261579,7 @@ parsroman.ir
  part.eyrehead.com
  partage.rc2c.fr
  partalamericahelado.com
+partdayday.cyou
  partelier.com
  partersolred.com
  partetyryryryepaaal.xyz
@@ -268964,6 +261788,7 @@ patricia92802.xyz
  patriciaanderson.000webhostapp.com
  patriciacarver-profile-77532.online
  patriciacrosbytawfik.com
+patriciadale.buzz
  patricialeger.ca
  patricialjackson65.com
  patriciammartinez.com
@@ -269158,6 +261983,7 @@ pay-info.net
  pay-mobile-ee.com
  pay-netflx-monthly-com.blogdns.com
  pay-nujilppuern.com
+pay-p-al.com
  pay-pae.com
  pay-pai-verify-chks-acc.com
  pay-pal-account-mangement.azgroupksa.com
@@ -269314,6 +262140,7 @@ payeesecure-hlep.com
  payeesecure-new.com
  payeesecurelogin.net
  payeesecureuk.com
+payeesecurity-app.com
  payeesecurity-info.com
  payeesuspension.com
  payeeupdate-boi.com
@@ -269340,6 +262167,7 @@ payinfosicurezzapal.it
  payinur.com
  payipal.serveirc.com
  payipalrecoveryacr.servebeer.com
+payipalrecoveryill.servehttp.com
  payitaltpaynepal.com
  payjayjojo4.000webhostapp.com
  payjoybaja.com
@@ -269377,6 +262205,7 @@ payment-report.net
  payment-request-4467.000webhostapp.com
  payment-secure82.com
  payment-servicesgateway.com
+payment-uk-completed.com
  payment-update.sceruserviceamazon.japan.kampangkau.com
  payment-verfication4446.000webhostapp.com
  payment.ajanial.com
@@ -269400,12 +262229,14 @@ paymentmethodbygroup.colouredmonkeys.io
  paymentofficialin.000webhostapp.com
  paymentpal.cf
  paymentprotectionlog.000webhostapp.com
+paymentprotectiontab.000webhostapp.com
  paymentprotectionuser.000webhostapp.com
  payments-billmanage.serveftp.com
  payments-ebay.com
  payments-instant.club
  payments-my3.com
  payments-myee.com
+payments-resolve.info
  payments-reverify.cc
  payments-update-netflix.giize.com
  payments-verified.cc
@@ -269663,6 +262494,7 @@ paypal-iltll.serveirc.com
  paypal-important-security.com
  paypal-inc-help-redirection.blogspot.be
  paypal-inc-help-redirection.blogspot.com
+paypal-incsecure.ddns.net
  paypal-informationuk.com
  paypal-intl.serveirc.com
  paypal-intl845.serveirc.com
@@ -269790,6 +262622,7 @@ paypal-secure-limited.com
  paypal-secure-verification.live
  paypal-secure-window.gb.net
  paypal-secure.com.statementupdate180.com
+paypal-secure.hendaicity.com
  paypal-secure.redirectme.net
  paypal-secure01.serveirc.com
  paypal-secure0211.serveirc.com
@@ -269917,6 +262750,7 @@ paypal-us-cdn.cloudiq.com
  paypal-us.serveirc.com
  paypal-user-187.com
  paypal-user-id197.com
+paypal-user-id204.com
  paypal-user.serveirc.com
  paypal-usersupport.serveftp.com
  paypal-uservice1b.serveirc.com
@@ -269994,6 +262828,7 @@ paypal.atozconceptinc.com
  paypal.attends.icu
  paypal.auth-login.verif-021620.com
  paypal.auth-login.verif-111320.com
+paypal.authentic-login-info.com
  paypal.authentic-registration.com
  paypal.authentic-security-login.com
  paypal.authenticate-login.com
@@ -270044,6 +262879,7 @@ paypal.caseid4359.com
  paypal.centerhelpuk-online.com
  paypal.centre-support.co
  paypal.checkout.lewdgh.com
+paypal.co.com.kqhrkt.ph
  paypal.co.uk.1jz8.in
  paypal.co.uk.1mbe.icu
  paypal.co.uk.1uea.icu
@@ -270204,6 +263040,7 @@ paypal.com.confirmation.account-security.eb5a3258a49616f5c9066d85249270eeeb5a325
  paypal.com.confirmation.account-security.f8b8019d180af4fef511919b7088f28bf8b8019d180af4fef511919b7088f.wsedw.hyd.me
  paypal.com.cpimtelangana.com
  paypal.com.cutestatvalue.com
+paypal.com.cyrr999.top
  paypal.com.deposite.info
  paypal.com.dripays.com
  paypal.com.eg.vst.id.4ko98eeb9a98fg.opensll.id53535223.cf
@@ -270327,6 +263164,7 @@ paypal.failed-attempt.com
  paypal.fr.signin.iecinc.net
  paypal.france-id.net
  paypal.freejoins.net
+paypal.gb-securityform.com
  paypal.gbhelp-secure.com
  paypal.gbhelpcenter.com
  paypal.gbhelpform.com
@@ -270684,7 +263522,6 @@ paypallimit.info
  paypalllimited.serveirc.com
  paypallllf.ddns.net
  paypallooking.info
-paypalls-logins.webhop.me
  paypallsupport.serveirc.com
  paypalnotifications.bucharestinfo.com
  paypalnotifications.miguelangeltrujillo.com
@@ -270708,6 +263545,7 @@ paypals-ticket.com
  paypals.serveirc.com
  paypals.us
  paypalsecuirty.serveirc.com
+paypalsecure-id-1e4481.com
  paypalsecure-service08.com
  paypalsecure.emmyjanielimited.com.ng
  paypalsecure.gleeze.com
@@ -270737,6 +263575,8 @@ paypalsir.com
  paypalssdfmwemfmsdfz.buzz
  paypalstatus2407.info
  paypalstroe.com
+paypalsupport-id-2e3d665.com
+paypalsupport-id-2e3d670.com
  paypalsupportcenter.digital
  paypalsupported.info
  paypalsupportonline.redirectme.net
@@ -270748,6 +263588,7 @@ paypalticket-id-2e38209.com
  paypalticket-id-2e382112.com
  paypalticket-id-2e382123.com
  paypalticket-id-2e38298.com
+paypalticket-id-6e38273.com
  paypalticket161130.info
  paypalticket161133.info
  paypalticket1658814.info
@@ -270890,12 +263731,12 @@ paypll-authenticate.000webhostapp.com
  payploginaccount.com
  payplrefundtk0160190.info
  payplticket052719.info
-payplticket053697.info
  payplticket20964790.info
  payplticket3161496.info
  payplticket51654sg.info
  payplticket57970511.info
  payplticket6350815.info
+payplticket7103795.info
  payplticket79013590.info
  payplticket9472492.info
  payplticketcz933710.info
@@ -271009,6 +263850,7 @@ pbujfeqbyoeeyewnjptemmdkuyiamwimqaxk-dot-solar-vertex-285913.rj.r.appspot.com
  pbvwwohtgsmlrkpazrcfqlktaavpfitxwxtq-dot-solar-vertex-285913.rj.r.appspot.com
  pbwf.addroits.com
  pbxtybkokzkywoufmegxghuslo-dot-gleowayel400503.uc.r.appspot.com
+pc-assembly.com
  pc-care365.net
  pc-hardware.xyz
  pc-today.site
@@ -271324,6 +264166,7 @@ pelagic-extension.000webhostapp.com
  pelaiswealthsonline.com
  pelakupenyiramadinona.000webhostapp.com
  pelakupenyiramanairkerasende.000webhostapp.com
+pelanggaranakunanda.pembatalan-blokir1.ga
  pelanggarankomunitas.000webhostapp.com
  pelangifurniture.com
  pelangihitam.com
@@ -271351,6 +264194,8 @@ peluqueriaybellezaevas.com
  pemarules.in
  pembaislandhotel.co.tz
  pembangunankepri.com
+pembatalaan-blokir-fb.otzo.com
+pembatalan-blokir-facebook.zyanapro.com
  pembatalanblokir-fb.3-a.net
  pembatalanblokir-fb.jetos.com
  pembatalanblokir-fb.misecure.com
@@ -271378,6 +264223,7 @@ pemblokiran566.webnode.com
  pemblokiran64.biz.id
  pemblokiran94.webnode.com
  pemblokiranakunfacebook.gffi18.tk
+pemblokiranfacebookterbaru.rcodest.my.id
  pembrokega.buzz
  pemersatu-bangsa-17.000webhostapp.com
  pemersatu-bangsa-berbagi12345.000webhostapp.com
@@ -271597,6 +264443,7 @@ periodistasdeportivosmalaga.es
  periohealthidahoreviews.com
  periotexas.com
  peripheroneural.info
+periskopi.com
  perisplenic.xyz
  peristomial-routine.000webhostapp.com
  perithecium.xyz
@@ -271667,7 +264514,6 @@ personalbravery.com
  personalenhancementcenter.com
  personalfsbocoach.com
  personalinformation.center
-personalisemalles.us
  personalit3grup.sytes.net
  personaliteservicos.com
  personalitycannabis.com
@@ -271690,6 +264536,7 @@ personas-sucursalco.com
  personas.banistmo-app.com
  personas.banistmolabs.com
  personasbcolm.com
+personasbn-zonasegvra39activaciones1.xyz
  personasestao.cl
  personasingresobancolombia.personasnewingresnuevo.com
  personasnegativas.combustiblecorrecto.com
@@ -271707,7 +264554,9 @@ personnels.bdm-sa.fr
  persons.com.ro
  personvirrtusupurrt.atwebpages.com
  persoonlijk-3283-fm.icu
+persoonlijk-3283-wca.icu
  persoonlijk.knab.m5bh7zizk7wyxbs.cf
+persoonlijk.knab.nl.blqcpodud5.ml
  persoonlijk.knab.nl.v8005furwx.ml
  perspectivachiapas.com
  pertalep.org
@@ -271856,6 +264705,7 @@ pezace.com
  pezinok.cf
  pezinok.gq
  pezinok.tk
+pezwalzwlrdppfxpqzvnxpacioecvwisojni-dot-offglen.uk.r.appspot.com
  pf-d0.addroits.com
  pf0558741122c19-com.preview-domain.com
  pf0j7.svcoding.com
@@ -271973,6 +264823,7 @@ ph0en1x.tk
  ph25.jaysbrand.com
  ph4s.ru
  phadda.com
+phaeremnhes.ddns.net
  phaetus.com
  phaimanhdanong.com
  phaltemnuoontzii-dot-millinium.ey.r.appspot.com
@@ -271995,6 +264846,7 @@ phantom-guide-96m0qrndaf.glitch.me
  phantom511.duckdns.org
  phaozfuft.xtechspro.com
  phaplysaigonland.com
+pharaohxpmco.com
  pharaohxsuit.duckdns.org
  pharma-israel.org.il
  pharmachemsales.com
@@ -272253,6 +265105,7 @@ piacniacpumpiaon.com
  piajeppesen.dk
  piandizano.it
  piano-tuning-how-to.com
+pianobanan.com
  pianocource.casa
  pianohub-170fd.appspot.com
  pianohub-170fd.dt.r.appspot.com
@@ -272277,6 +265130,7 @@ pichnnchaonline.webcindario.com
  pichrolpelak.ir
  picitinfo.baerqirating.top
  pickanose.com
+pickdeadtry.com
  pickel666.000webhostapp.com
  pickeringgetit.com
  pickfresh.com.au
@@ -272404,6 +265258,7 @@ pindadglobal.com
  pindaric-kiloliter.000webhostapp.com
  pindekoration.online
  pindroptheatre.com
+pindumppot.com
  pineandpolish.com
  pineappleboxes.com
  pineapplehandle.com
@@ -272445,6 +265300,7 @@ pinkshopeg.com
  pinkthoughts.com
  pinkwalldesigns.com
  pinkwapes.ml
+pinkwedding.buzz
  pinlateofficial.xyz
  pinline.site
  pinlins.com
@@ -272693,6 +265549,7 @@ pkzz.xyz
  pkzzwktpjpfnwrvz-dot-millinium.ey.r.appspot.com
  pl-19.ru
  pl-furgonetka.fun
+pl-oferta.info
  pl-pl-fb.pl
  pl-pocztapolska.com
  pl-sendit.club
@@ -272800,6 +265657,7 @@ plataformaclientesmultired1bn.xyz
  plataformacovi.com
  plataformadeinformatica.com
  plataformadeviajescotiabank.com.mx
+plataformadigital-corn-pe.xyz
  plataformadigital-segvra.com
  plataformadigitalbn1web.com
  plataformadigitalbns.com
@@ -273002,12 +265860,12 @@ pleasanttravelchicago.com
  pleasantvalleydreamrides.com
  please-follow-the-instructions-6050ce63e4bce6764cb34cac51fb44d7.culturelearningpartners.com
  please-log-in-to-view.000webhostapp.com
-please-wait183492.serviice-amaz0n1.xyz
  pleaseaccountappleupdate-hda61.org
  pleaseaccountappleupdate-trhr61.org
  pleasebuy.co.uk
  pleasecontinueto.beinformedthatamazon.pw
  pleasedsleepydevelopments--five-nine.repl.co
+pleaseseeyouamazonjp.xyz
  pleaseupdate.checkupdateslive.net
  pleasewait-survey-idapple.com.simalakams.com
  pleasewait-surveyaccount.com.frosheride.com
@@ -273116,6 +265974,7 @@ plqiqtzbsmmscapfixcqaveqju-dot-gleowayel400503.uc.r.appspot.com
  plrnotice.com
  plsurgicals.com
  pluckeggplant.com
+pluckmesssay.com
  plucknfile.com
  plugableinstallationcom.nckibrazil.gdn
  plugandprofit.org
@@ -273355,6 +266214,7 @@ poe.dermals.org
  poe7.psdzy.com
  poeexmpgivdlakqq-dot-millinium.ey.r.appspot.com
  poefjqupshdjiebaxypnyflhkkmzykyowsol-dot-glxcel49934343434.rj.r.appspot.com
+poeja.buzz
  poer--mariks.repl.co
  poesia.hopto.org
  poesiadelsud.it
@@ -273533,6 +266393,7 @@ polskawiiadomosc.xyz
  polskieinfo24.eu
  polskiemedia.online
  polskiemedia.xyz
+polskiemiasta24.you2.pl
  polskiklubkynologiczny.pl
  polskiportal.you2.pl
  polskiszpital24.dkonto.pl
@@ -273675,6 +266536,7 @@ poperjffd.ml
  popgamail.000webhostapp.com
  popgreatfreshappclicks.icu
  popieraj-internetowo.eu
+popieraj-wspolnie.eu
  popingsupport.com
  popissuesolved.co.in
  popkouture.com
@@ -273777,6 +266639,8 @@ portail-messagerieorangemms.web.app
  portail-messagerieorangesms.web.app
  portail-messagerievocal-sms.firebaseapp.com
  portail-ppl-serveur.com
+portail-smsbox-contact.firebaseapp.com
+portail-smsbox-contact.web.app
  portail-traitementdossier.fr
  portailorange-messagerievocale-pro.yolasite.com
  portailseveur718vocalsecure.webnode.at
@@ -273865,6 +266729,7 @@ portaldes.000webhostapp.com
  portaldigitalbccr.com
  portaldoatendimento.com
  portaldoentretenimento.com
+portale-carte-titolari.com
  portale-lsp-antifrode-psd2.000webhostapp.com
  portale-unipolsai.com
  portale-web-info.net
@@ -274048,7 +266913,6 @@ post-50420087.pytsoluciones.com
  post-52233550.pytsoluciones.com
  post-52544391.pytsoluciones.com
  post-55561315.pytsoluciones.com
-post-56878778.ingeniousmarketer.com
  post-58895695.pytsoluciones.com
  post-64250074.pytsoluciones.com
  post-65038003.pytsoluciones.com
@@ -274067,7 +266931,6 @@ post-80126773.pytsoluciones.com
  post-81155520.ingeniousmarketer.com
  post-81568004.pytsoluciones.com
  post-82987216.pytsoluciones.com
-post-88978892.ingeniousmarketer.com
  post-93879204.pytsoluciones.com
  post-94665637.pytsoluciones.com
  post-990094.at
@@ -274094,6 +266957,7 @@ post-x.top
  post-y.top
  post-z.top
  post.360degreehosting.com
+post.fbcom-79454563.premiumboxes.com
  post.new-item-sale-trade-56040129470.xyz
  post.new-item-sale-trade-6873021098.xyz
  post1621638617.us
@@ -274159,6 +267023,7 @@ postfacebook.rigoweb.com.br
  postfinance.in
  postfinance.mm-1.ch
  postgil.com
+postid-00965453.suakids.com
  postid-01188465.justgreece.org
  postid-01259217.suakids.com
  postid-02864071.suakids.com
@@ -274191,6 +267056,7 @@ postid-45804648.justgreece.org
  postid-54499969.suakids.com
  postid-56073080.suakids.com
  postid-56129805.justgreece.org
+postid-56157896.suakids.com
  postid-56670652.suakids.com
  postid-57295333.justgreece.org
  postid-59058622.suakids.com
@@ -274322,6 +267188,7 @@ powbot.org
  powellwy.buzz
  powent.net
  power4event.extra16.com
+power4goods.com
  poweragecoopnet.shaxiaas.top
  poweragecoopus.shaxiaadd.top
  powerbanks.bounceme.net
@@ -274446,6 +267313,7 @@ pp-service-worker.herokuapp.com
  pp-services.xyz
  pp-support-uk.com
  pp-support.net
+pp-supportcentre.co.uk
  pp-supportline.co.uk
  pp-supportline.com
  pp-suspicious-login.com
@@ -274841,6 +267709,7 @@ prediksipetruk.org
  predispatcher.xyz
  preemieparentsbook.com
  prefabbricatipanozzo.it
+preferenceof.org
  preferredtitlellc.com
  preferredtitleofcolorado.com
  prefnachknangist.gq
@@ -275064,9 +267933,6 @@ prezident-prof.ru
  prezzplay.net
  prf-gov-br.myfreesites.net
  prfgzhsgtdmptfmo-dot-millinium.ey.r.appspot.com
-prfle-17801438.mansurtech.com
-prfle-45412636.mansurtech.com
-prfle-56111432.mansurtech.com
  prftcjbgaacphlrj-dot-millinium.ey.r.appspot.com
  prghospitality.com
  prgramreket.serveminecraft.net
@@ -275085,7 +267951,6 @@ pricerightrentals.com
  pricetopgroup.ru
  pricklegrindylow.org
  pricklier-surveilla.000webhostapp.com
-pricklier-torpedo.000webhostapp.com
  pridabravo.com
  pridensi.com
  pridgenentreprises.com
@@ -275280,6 +268145,7 @@ privacytools.su
  privacyweb-sicurezza.info
  privasii88.weebly.com
  privat-epargne.com
+privatadm.live
  privatalert-confrim.cf
  privatalert-confrim3.cf
  privatbankinvest.com
@@ -275550,6 +268416,7 @@ professionelelit.com
  professonaldesigner.000webhostapp.com
  professorgizzi.org
  profetestruec.net
+proffile-deborahkraft.club
  proffisiinazioneel.cloudaccess.host
  proffisinazionee02.cloudaccess.host
  profhamidronagh.site
@@ -275722,7 +268589,6 @@ profitcoach.net
  profitcoins24.com
  profitss.cyou
  profligheanesrator.us
-proflightgame.work
  proflines.ga
  profmaharaja.com
  profmetal.by
@@ -276044,7 +268910,7 @@ prosperuosyear.com
  prosportsodds.icu
  prostacure.buzz
  prostapower.buzz
-prostastreams.buzz
+prostastreamsplus.buzz
  prostastreamspro.buzz
  prostata.kg
  prostimenyapups.000webhostapp.com
@@ -276308,6 +269174,7 @@ psd2intesaweb.com
  psdozneogcgmxzqf-dot-millinium.ey.r.appspot.com
  psdtraining.club
  psdxyfefeukqegpe-dot-millinium.ey.r.appspot.com
+pseiatep.com
  psejsocz.goruli.com
  pserviceaccountsupportallclientshelp.etceterawoman.club
  pseudoceryl.xyz
@@ -276545,6 +269412,7 @@ pubgdoeal6.co.vu
  pubgelite.com
  pubgespanol.com
  pubgeveent15.com
+pubgeven.org
  pubgevent.loseyourip.com
  pubgevent13.itsaol.com
  pubgevent13.xxuz.com
@@ -276572,6 +269440,7 @@ pubgfree.xfree1.com
  pubgfree1.dynamic-dns.net
  pubgfree16.gq
  pubgfreeclaims13.myvnc.com
+pubgfreegifts.com
  pubgfreematerial.com
  pubgfreematerials13.myvnc.com
  pubgfreemobile.ga
@@ -276642,6 +269511,7 @@ pubgm15material.com
  pubgm18.com
  pubgm2020.qhigh.com
  pubgmaks15.com
+pubgmaxe16.com
  pubgmaxz16.com
  pubgmbest15.com
  pubgmblackpink.com
@@ -276654,6 +269524,7 @@ pubgmdaily.com
  pubgmdc.com
  pubgmdevs.com
  pubgme.my.id
+pubgmelite.com
  pubgmenv.com
  pubgmevent-s13.jkub.com
  pubgmfest.com
@@ -276668,6 +269539,7 @@ pubgmgfts12.otzo.com
  pubgmgfts12.zyns.com
  pubgmgfts13.jkub.com
  pubgmgiveawey.com
+pubgmhalloweek2020.com
  pubgmhalloweeks.com
  pubgmhallowin.com
  pubgmho.com
@@ -276708,7 +269580,6 @@ pubgmobile11official.000webhostapp.com
  pubgmobile13.eventsluck.com
  pubgmobile23.otzo.com
  pubgmobile69.com
-pubgmobileclaim.net
  pubgmobilecz.com
  pubgmobileevent58.freeddns.com
  pubgmobilegift.site
@@ -276747,6 +269618,7 @@ pubgmoficials.com
  pubgmoutfits16.com
  pubgmparty14.com
  pubgmplayers.com
+pubgmpluss.com
  pubgmpmco.com
  pubgmredeemcode.com
  pubgmreward.my03.com
@@ -276763,7 +269635,6 @@ pubgmseeason.com
  pubgmsgift11.zyns.com
  pubgmskinmax.com
  pubgmskinxlucky.duckdns.org
-pubgmspin.dnset.com
  pubgmspin13.giize.com
  pubgmspinvip.com
  pubgmsu.com
@@ -276782,6 +269653,7 @@ pubgnblack.com
  pubgner.com
  pubgnews14.kozow.com
  pubgnunu.fun
+pubgofficial1.com
  pubgonly.com
  pubgot.com
  pubgp.xfree1.com
@@ -276792,6 +269664,7 @@ pubgqreward.loseyourip.com
  pubgrafix.com
  pubgrb.com
  pubgreals.com
+pubgreedemcode.com
  pubgrew.com
  pubgreward.kozow.com
  pubgrewardfree.000webhostapp.com
@@ -276830,6 +269703,7 @@ pubgskinvip.com
  pubgslucky.com
  pubgspin-reward13.com
  pubgspin.org
+pubgspin16.dynamic-dns.net
  pubgspin2.com
  pubgspin3.com
  pubgspin99.com
@@ -276857,8 +269731,8 @@ pubgtrust.com
  pubgturnamens.ocry.com
  pubgucmex.com
  pubgucms.com
-pubgucmz.com
  pubguh.com
+pubgvet.com
  pubgvip15.com
  pubgvipgift.zyns.com
  pubgwargaming.com
@@ -276878,6 +269752,8 @@ pubgxis.com
  pubgxlucky.4pu.com
  pubgxlucky.ezua.com
  pubgxmaterials.net
+pubgxmetro.4pu.com
+pubgxmobile.giize.com
  pubgxmun.com
  pubgxnew.com
  pubgxpink.net
@@ -276890,9 +269766,11 @@ pubgxs16.4pu.com
  pubgxskin.com
  pubgxspin.4pu.com
  pubgxspin.giize.com
+pubgxspinfree.dns05.com
  pubgxspinn.com
  pubgxspins15.com
  pubgxspinsx.giize.com
+pubgxuni.com
  pubgxvent.com
  pubgxweaponspin.com
  pubgxwil.com
@@ -276954,7 +269832,6 @@ puertosalsa.cl
  puevnghvnqvxnoifvznfapxcld-dot-gleowayel400503.uc.r.appspot.com
  pufferfiz.net
  puffpuff421.top
-puftuqihkua.wang
  pugifts.diaryngifts.com
  pugmexclusive.com
  pugmyyflcdouqfay-dot-millinium.ey.r.appspot.com
@@ -277381,6 +270258,7 @@ pyhvt.weblium.site
  pyhw.shoesmogul.com
  pyhzoiiggtkugzmollrvtjiafqmbiwbuphnd-dot-cedar-code-289917.nn.r.appspot.com
  pyiahrtwnlipvsdg-dot-millinium.ey.r.appspot.com
+pyieswoa201-nifty.xyz
  pyifvzydajxfqzkhgahlkmnaqmrunsdpchro-dot-glegen303939423233.ue.r.appspot.com
  pyjt.svcoding.com
  pykzx.awaykart.com
@@ -277932,6 +270810,7 @@ qjwjqjqjqjsjkjqq.com
  qjybqnhwkxqveywohzhnclpxbl-dot-gleowayel400503.uc.r.appspot.com
  qjyn.icu
  qjyqn.svapofit.com
+qk-21t54csm6.com
  qka.pota.qi.nanen.qe.pe.kshyr.albamatrix.ch
  qkahqaopqtjxvnbbqkgkipgzxdrqphearzco-dot-glenxpecial3009493.ey.r.appspot.com
  qkd6m.oujevais.com
@@ -278283,7 +271162,6 @@ qtiyeivdjndetpbuadlhmlycpk-dot-gleowayel400503.uc.r.appspot.com
  qtjkskdd.vipsnapchatsexting.com
  qtjznhetuslrnbwbdttmnhcbdfmvssnihegq-dot-cryptic-now-290917.ey.r.appspot.com
  qtkd.goruli.com
-qtkwtflflvdnypgfdllldaenmdlfdtxwopak-dot-offglen.uk.r.appspot.com
  qtm.vn
  qtmaqwpcfiruhsyi-dot-millinium.ey.r.appspot.com
  qtobjalrekdeukgp-dot-millinium.ey.r.appspot.com
@@ -278342,6 +271220,7 @@ quangngailand.net
  quangsilic.xyz
  quantangs.com
  quantgbo.lviv.ua
+quanticaelectronics.com
  quanticasolar.com.br
  quantitivegoodsshop.com
  quantominds.com
@@ -278495,7 +271374,6 @@ quicklloret.com
  quickly-paypal.com
  quickmenu.ca
  quickpickapp.co
-quicksaleecuador.com
  quickserv166.com
  quickshine.co.ke
  quicksilverrealestate.com
@@ -278953,6 +271831,8 @@ raacts.in
  raaeu.oput.buzz
  raakesh.co
  raamagrofoods.com
+raankntue-cco-j.top
+raankntue-coo-j.top
  raasset.com
  raasvin.com
  raatphailihai.com
@@ -279411,6 +272291,7 @@ rakuten-cardaos.com
  rakuten-cardaz.com
  rakuten-cardc.com
  rakuten-cardc.jp
+rakuten-cardcoco.jp
  rakuten-carde.com
  rakuten-cards.com
  rakuten-cc.xyz
@@ -279678,6 +272559,7 @@ rakuten.co.jp.customer-rakuten.tk
  rakuten.co.jp.cyhr593.top
  rakuten.co.jp.cyny191.top
  rakuten.co.jp.cysd397.top
+rakuten.co.jp.cyyj697.top
  rakuten.co.jp.cyzz197.top
  rakuten.co.jp.d1212xx5345346c6hu7667uh6y45g4gr34f33f4.icu
  rakuten.co.jp.d2m1m2bvai3.shop
@@ -280174,6 +273056,7 @@ rakuten.co.jp.w1t4a4.cn
  rakuten.co.jp.w2oi46loj6lk7lj8l3lk.com
  rakuten.co.jp.w6li4.cn
  rakuten.co.jp.wcdjsp.asia
+rakuten.co.jp.wcxwsg.asia
  rakuten.co.jp.weljtrda.cn
  rakuten.co.jp.wersze.xyz
  rakuten.co.jp.word-login.ml
@@ -280377,6 +273260,7 @@ rakuteninfohelpdesk.xyz
  rakutenja-jpy.xyz
  rakutenjp.word.annzenkannri-rakuten.buzz
  rakutenjpjy.xyz
+rakutenjpp.buzz
  rakutenjpxyo.com
  rakutenk.cc
  rakutenlkfawefssdfawead.top
@@ -280448,6 +273332,7 @@ rakutenva.xyz
  rakutenvh.xyz
  rakutenvn.xyz
  rakutenvq.xyz
+rakutenvw.xyz
  rakutenvx.xyz
  rakutenwhouserandpaww.top
  rakutenya.xyz
@@ -280747,6 +273632,7 @@ ratwindows.ddns.net
  raubtiereinfo.baerseventake.top
  rauchwurst.ch
  raudas.se
+raukuten-co-jp.com
  raulgzz.com
  raulodge.buzz
  raumai18.com
@@ -280871,6 +273757,7 @@ rbca-nl.net
  rbcaccess.royalbank.ca.kpsadvertising.com
  rbcaccess.royalbank.ca.rdi.or.id
  rbcaccess.royalbank.com.ca.kpsadvertising.com
+rbcaccess.royalbank.fr-en.ca.kpsadvertising.com
  rbcau.net
  rbcbank-reset-76859.com
  rbccanada.live
@@ -281116,7 +274003,6 @@ rdpropainting.com
  rdr.lavadorasbrastemp.com
  rdr3y.addroits.com
  rds2020.space
-rdsblog.info
  rdsviewer.com
  rdsxwpcjwgghpftkpn.top
  rdtfghj1and1erth6.weebly.com
@@ -281190,34 +274076,23 @@ read-03877539.bid-digital.com
  read-04871077.bid-digital.com
  read-05262156.bid-digital.com
  read-05998076.bid-digital.com
-read-06152009.bid-digital.com
-read-06558747.bid-digital.com
  read-06669475.bid-digital.com
  read-07366771.bid-digital.com
  read-07838308.bigshipmentglobal.com
  read-07899191.bid-digital.com
  read-08333078.bid-digital.com
-read-08942746.bid-digital.com
  read-09105324.bid-digital.com
  read-09247551.bid-digital.com
-read-09296690.bid-digital.com
  read-09633444.bid-digital.com
  read-09963177.bid-digital.com
-read-10545301.bid-digital.com
-read-10649195.bid-digital.com
-read-10946356.bid-digital.com
-read-11020840.bid-digital.com
-read-11281496.bid-digital.com
  read-11394979.bid-digital.com
  read-11820492.bid-digital.com
  read-12515864.bid-digital.com
-read-12968111.bid-digital.com
  read-14694171.bid-digital.com
  read-14953324.bid-digital.com
  read-15241106.bid-digital.com
  read-15648891.bid-digital.com
  read-15817533.bid-digital.com
-read-16342249.bid-digital.com
  read-16409972.ht-egypt.com
  read-17045524.bid-digital.com
  read-17608546.bid-digital.com
@@ -281228,10 +274103,7 @@ read-19512495.bid-digital.com
  read-19561263.bid-digital.com
  read-19600174.bid-digital.com
  read-19920398.bigshipmentglobal.com
-read-21329614.bid-digital.com
  read-21516669.bid-digital.com
-read-21928626.bid-digital.com
-read-22955588.bid-digital.com
  read-23242847.bid-digital.com
  read-23792141.bid-digital.com
  read-24329077.bid-digital.com
@@ -281242,84 +274114,58 @@ read-26300516.bid-digital.com
  read-27831777.ht-egypt.com
  read-28393563.bid-digital.com
  read-29192635.bigshipmentglobal.com
-read-29428119.bid-digital.com
-read-29446574.bid-digital.com
  read-30026004.bid-digital.com
  read-30285449.bid-digital.com
  read-30325515.bigshipmentglobal.com
  read-31328205.bid-digital.com
  read-31370091.bid-digital.com
-read-33728726.bid-digital.com
-read-34405320.bid-digital.com
-read-35064706.bid-digital.com
  read-35408882.bid-digital.com
-read-35704226.bid-digital.com
  read-36254220.bid-digital.com
  read-36819799.bid-digital.com
  read-37072121.bigshipmentglobal.com
  read-37485430.bid-digital.com
  read-37559128.bid-digital.com
-read-37920539.bid-digital.com
  read-38212539.bid-digital.com
-read-38334365.bid-digital.com
  read-38351365.bid-digital.com
  read-38506088.bid-digital.com
  read-39051428.bid-digital.com
  read-39476607.bid-digital.com
  read-40911073.bid-digital.com
-read-41399040.bid-digital.com
  read-41621005.bid-digital.com
  read-41710410.bid-digital.com
  read-44152382.bid-digital.com
  read-44191484.bid-digital.com
-read-46949738.bid-digital.com
-read-47198509.bid-digital.com
  read-47458188.bid-digital.com
  read-48859835.bid-digital.com
  read-49361447.bid-digital.com
-read-49381972.bid-digital.com
  read-49796569.bigshipmentglobal.com
  read-51061298.bid-digital.com
  read-51327756.bid-digital.com
-read-54361695.bid-digital.com
-read-54628982.bid-digital.com
  read-54688188.bid-digital.com
  read-55582879.bid-digital.com
  read-56534237.bid-digital.com
  read-56599139.ottombil.com
  read-56677334.bid-digital.com
  read-57071729.bid-digital.com
-read-57231422.bid-digital.com
  read-57322651.bid-digital.com
-read-57950383.bid-digital.com
-read-58723889.bid-digital.com
  read-59193946.bid-digital.com
-read-60178772.bid-digital.com
-read-60208921.bid-digital.com
  read-61271325.bid-digital.com
  read-61936097.bid-digital.com
  read-62621953.bid-digital.com
  read-62704434.bid-digital.com
  read-65351702.bigshipmentglobal.com
  read-65910165.bid-digital.com
-read-66743789.bid-digital.com
  read-67935303.bid-digital.com
-read-68144525.bid-digital.com
  read-69847608.bigshipmentglobal.com
-read-71032381.bid-digital.com
-read-71332852.bid-digital.com
  read-71610637.bid-digital.com
  read-73036931.bid-digital.com
  read-74241773.bid-digital.com
-read-74660792.bid-digital.com
-read-74722565.bid-digital.com
  read-74883931.bid-digital.com
  read-75041662.bid-digital.com
  read-75521476.bid-digital.com
  read-75610579.bid-digital.com
  read-75885488.bid-digital.com
  read-76431030.bid-digital.com
-read-76548090.bid-digital.com
  read-77047852.bid-digital.com
  read-77560592.bid-digital.com
  read-78403928.bid-digital.com
@@ -281330,42 +274176,32 @@ read-80890482.bid-digital.com
  read-81796255.bid-digital.com
  read-82265015.ht-egypt.com
  read-82756505.bid-digital.com
-read-82785895.bid-digital.com
  read-82930313.bid-digital.com
  read-83032343.bid-digital.com
  read-83562972.bid-digital.com
  read-83720848.bid-digital.com
-read-83722792.bid-digital.com
  read-84014482.ht-egypt.com
  read-84419957.bid-digital.com
  read-85261114.bid-digital.com
  read-87549919.bid-digital.com
-read-87922724.bid-digital.com
  read-88225669.bid-digital.com
  read-88694306.bid-digital.com
  read-88877656.bid-digital.com
-read-89505819.bid-digital.com
  read-89702922.bid-digital.com
  read-90139618.bid-digital.com
  read-90253453.bid-digital.com
  read-91378508.bid-digital.com
  read-91409372.bid-digital.com
-read-91825500.bid-digital.com
-read-92672537.bid-digital.com
  read-93035684.bid-digital.com
  read-93619448.bigshipmentglobal.com
-read-94379630.bid-digital.com
-read-95079114.bid-digital.com
  read-95392126.bid-digital.com
  read-95760005.bid-digital.com
  read-96239593.bid-digital.com
  read-96550905.ottombil.com
  read-96804255.bid-digital.com
-read-97086928.bid-digital.com
  read-98123054.bid-digital.com
  read-99035094.bid-digital.com
  read-99307700.bid-digital.com
-read-99557856.bid-digital.com
  read.fbookus-11166552.dorringtonnursery.uk
  read.fbookus-46369724.dorringtonnursery.uk
  read.fbookus-57318775.dorringtonnursery.uk
@@ -281453,7 +274289,9 @@ realestate-page-id-7817605834.triviamarequinoccial.com
  realestate-page-id-8503951768.com
  realestate-page-id-89100547654283.com
  realestate-page-id156290.com
+realestate-page-id156294.com
  realestate-page-id1565125.com
+realestate-page-id15729380.com
  realestate-page.us.alapinta.com
  realestate.estatedeeds.com
  realestate.page-2000075874.credmillions.com.br
@@ -281481,6 +274319,7 @@ realestateinthecity.net
  realestateinvestordatabase.com
  realestateitem19207.com
  realestateitem43077.com
+realestatelistingh.com
  realestateorder310842.com
  realestateownedsolutions.info
  realestatepage-id145785567.com
@@ -281598,6 +274437,7 @@ reazzsx.000webhostapp.com
  rebamblematics.com
  rebarmodernfood.com
  rebate-01.com
+rebate-assessment.com
  rebate-link.com
  rebate-portal-hmrc.com
  rebate-service-hmrc.com
@@ -281608,7 +274448,9 @@ rebate048.com
  rebate064.com
  rebate097.com
  rebate157.com
+rebateformuk.com
  rebatehm.net
+rebatehmuk.xyz
  rebates-hmrc.com
  rebates-hmrcuk.com
  rebates-now.com
@@ -281629,6 +274471,7 @@ rebeccarisher.com
  rebelfreelancer.com
  rebell.persiangig.com
  rebellows.info
+rebeltower.monster
  rebeltraiteur.com
  rebelunfasten.com
  rebirthnolafilm.learningmatters.tv
@@ -281705,6 +274548,7 @@ recipharm.xyz
  recipient-delete.com
  recivdissued.com
  recklessdarkreddefragment--five-nine.repl.co
+reclaimforms.com
  recltamientosparelax.000webhostapp.com
  recluemutaezle.com
  recluse-seaman.000webhostapp.com
@@ -281898,6 +274742,7 @@ redeemtencent.com
  redeftp.ddns.net
  redelementhealth.com
  redeleteslashinghun.quickwebchecker.com
+redemhadiah.eventfreeclaims8.my.id
  redenoticiasmarajo.com
  redensd.com.br
  redes2deactivacionbn.com
@@ -281926,6 +274771,7 @@ redireccion1.crm7.com.br
  redirecn.com
  redirect-account-unlock-verification.anggursetan.com
  redirect-account.apple-manage.brainwall.fr
+redirect-amazonnitifictivionservice.giize.com
  redirect-autoupdate.blogspot.com
  redirect-fr2035.com
  redirect-mailupdate.mdelimakuntas.com
@@ -282129,10 +274975,14 @@ refugeeair.org
  refugio.net.co
  refund-claim-form.com
  refund-form-submit.com
+refund-form-vehicle.com
  refund-form216.com
+refund-govtax.com
  refund-hmrev-secure-application.com
+refund-myvehicletax-claim.com
  refund-referral.org
  refund-sites.com
+refund-teamsupport.com
  refund-uktax.com
  refund-user-ref016.com
  refund-vehicle-form.com
@@ -282174,11 +275024,14 @@ regatta2223.com
  regattaxiamen.info
  rege.opriessnig.at
  regeimaging.in
+regencymyanmar.com
  regencyship.info
  regenerationcongo.com
  regentmanagements.com
  reggaejammintours.com
  reggiesregallimo.com
+reggroupjoinwhtspp.cf
+reggroupjoinwhtspp.ga
  reghctmailscheckindues.weebly.com
  regiaocentrorsmg.websicredi.com.br
  regigoscoring.com
@@ -282284,6 +275137,7 @@ regularizeonlnebv.yolasite.com
  regularpaw.com
  regularscatter.com
  regulfirst.xyz
+regvk.ru
  rehabalt.ca
  rehabglaucomas.com
  rehabilitationcentersinhouston.net
@@ -282498,6 +275352,7 @@ rem-70304405.unsion.tv
  rem-77337572.unsion.tv
  rem-77870463.unsion.tv
  rem-82950765.unsion.tv
+rem-84651591.unsion.tv
  rem-85566393.unsion.tv
  rem-86934388.unsion.tv
  rem-87191147.unsion.tv
@@ -282698,6 +275553,7 @@ remv-44088788.bandgea.com
  remv-44836359.bandgea.com
  remv-60235628.bandgea.com
  remv-68117574.bandgea.com
+remxkimsb.com
  remycare.com
  remyshair.com
  remzclot.ga
@@ -282747,11 +275603,11 @@ renew365boionline.com
  renewable-tanks.000webhostapp.com
  renewablre.work
  renewal-billing.updateukee.com
-renewal-confirmationcancel.com
  renewal-primemember.serveirc.com
  renewal0srv-prime.serveirc.com
  renewals.services
  renewb-nertflix.com
+renewchase-service.xyz.mojavesbest.net
  renewcosmeticvaginalinstitute.com
  renewdetails.services
  renewedroyalamericanstyles.com
@@ -282966,7 +275822,6 @@ reportjd.com
  reportoperito.space
  reportorderappstore.serveirc.com
  reportorial-insanit.000webhostapp.com
-reports-14368204.sketch.co.za
  reports-66768452.matjaralbayt.com
  reports.siswp.org
  reportservice-instagram.com
@@ -282982,10 +275837,8 @@ representanteoficialmagaluizabrasil.com
  reprolucup.com
  reprostore.net
  reptptyliano.duckdns.org
-repts-03500306.ameigr.ma
-repts-76997040.ameigr.ma
-repts-83659742.ameigr.ma
-repts-99932747.ameigr.ma
+repts-26723915.ameigr.ma
+repts-50692071.ameigr.ma
  republicadenegocios.com.br
  republicanecroterio.com.br
  republicplatonic.com
@@ -283068,6 +275921,7 @@ reservoirsciences.info
  reset-access-login-account-98400121.outdoorfurnituremorganville.com
  reset-and-manage.top
  reset-aria.com
+reset-device.online
  reset-paypal.com
  reset-sicurezza-online.com
  resetargmail.com
@@ -283176,8 +276030,6 @@ resourceacccountsistemmanageappleidemail.akukanaman.com
  resourcefamilyministries.com
  resources8.com
  resourcesupport.mywire.org
-resp-8106815.grandnational.ae
-resp-9818411.grandnational.ae
  respaldo-digital.com
  respasolar.com
  respectablethinking.com
@@ -283256,6 +276108,7 @@ restore-user-functions.com
  restore-user-gb.com
  restore-your-access.com
  restore07-myaccount.serveirc.com
+restoreacc-paypal.myvnc.com
  restoreaccns-paypal.serveirc.com
  restoreaccount-access.com
  restoreaccount-paypal.ooguy.com
@@ -283358,6 +276211,7 @@ resultaseguros.com.br
  resumabitas.com
  resume4dummies.com
  resun-secureidapp.serveirc.com
+resurgesgodzillaoffers.buzz
  resurgespills.buzz
  resurgethegod.buzz
  reswase.com
@@ -283417,6 +276271,7 @@ retrnissued.com
  retrnlnvoice.com
  retrnzissq.com
  retro-jordans-for-sale.com
+retrobeauty.org
  retroearthstudio.com
  retroexcavadoras.com.mx
  retrofit.ga
@@ -283465,6 +276320,7 @@ reussitebienetre.numerica-asbl.be
  reuterexpo.com
  reuterling.webstandesssbk.com
  reutter-fliesen.de
+reutuem.top
  rev-ms.live
  rev100now.com
  revajplth.shoesmogul.com
@@ -283500,6 +276356,7 @@ revew-streauth.web.app
  revezlimage.com
  revf.bmvideo.ga
  revierstromcom.nckiwomen.gdn
+review-acc1045632.com
  review-businesspage.com
  review-certification.000webhostapp.com
  review-fb-account.com
@@ -283548,6 +276405,7 @@ reviewactivity.limited
  reviewbig.com
  reviewblock.org
  reviewfb-policy.com
+reviewfbinfo.com
  reviewfiles.aircon.org.in
  reviewhash.com
  reviewjobapp.club
@@ -283636,6 +276494,7 @@ reward7kspin.club
  reward8626.chksrvnewtoday17.life
  rewardgift.club
  rewarditemspin.mrbonus.com
+rewardpubgms.giize.com
  rewardpubgms13.com
  rewardpubgms13.myddns.rocks
  rewards-coin.000webhostapp.com
@@ -283678,6 +276537,7 @@ reyestaxservices.com
  reymo.com
  reynecolumbia.com
  reynoldsgh.com
+reynoldsislan.xyz
  reynosemor.temp.swtest.ru
  reyramos.com
  reyuiu-71.gq
@@ -283886,6 +276746,7 @@ rhyxxw.com
  ri6.ir
  ri82jh0kaisa83kyh.top
  ria-uea.com
+riabilita-conto-web.com
  riabilitazione-ai-servizi.info
  riabilitazione-instantanea-conto.info
  riabilitazione-mps.com
@@ -284019,6 +276880,7 @@ rightsbsnsrcvryhlp01.my.id
  rightsupport-financial.com
  righttobewhite.org
  rightusacustominformation.com
+rigidbutterysequence.figueroaads123.repl.co
  rigolnas.com
  rigosat.com
  rigotech.hu
@@ -284313,6 +277175,7 @@ rktsgatbfouaq.top
  rktwfiygjmlyx0907a7.top
  rkvvedanta.org.in
  rkvwgvsgicdxoymw-dot-millinium.ey.r.appspot.com
+rkvwxzaiwn.duckdns.org
  rkweblogic.com
  rkwm-paypalservis5g.servebeer.com
  rkwqkirsmtnynvrqphoybxzgmxzakorokgrs-dot-solar-vertex-285913.rj.r.appspot.com
@@ -284343,6 +277206,7 @@ rlmecanizacao.com.br
  rlmfcwasakvvsagi-dot-millinium.ey.r.appspot.com
  rlmxhczbngzpwxrywfzirfqyjbcfzhzmolco-dot-solar-vertex-285913.rj.r.appspot.com
  rlnashracing.com
+rlog.de
  rlphcwirefqwgmhnpiphftvbcblxfhleqrvl-dot-solar-vertex-285913.rj.r.appspot.com
  rlsgitovlwopdvka-dot-millinium.ey.r.appspot.com
  rlteaid.com
@@ -284520,10 +277384,10 @@ roar-cbd.com
  roastandchop.com
  roastedguarmeal.com
  roastingfishingdahs.com
+roastwayfoods.in
  robaitec.com
  robbies-hope.demo.link
  robbins-aviation.com
-robbinvinny.ru
  robbmc.typeform.com
  robbroute.buzz
  robcuesta.com
@@ -284575,6 +277439,7 @@ robot-craigslistpayment.com
  robot-reels.com
  robot.craigslist.org.epapiros.com
  robot.craigslist.org.lojadalara.com
+robot.de.verbraucherid.hetzner.de.bookmarked.email
  robot.knsolh.session.account.osteopathie-borken.org
  robotbas.ru
  robotchecks.org
@@ -284746,6 +277611,7 @@ roiscope.com
  roithai.com
  roj-club.ru
  rojesa.000webhostapp.com
+rojhfesd.com
  rojinali.moonfruit.com
  rojljed.dermals.org
  rojmall.com
@@ -284836,7 +277702,6 @@ romios-rhodes.gr
  rommsind.com
  rommsind.net
  rompchidet.com
-rompish-chemicals.000webhostapp.com
  romqyrditqvltlqo-dot-millinium.ey.r.appspot.com
  romsidbf.com
  romsidbf.net
@@ -284930,7 +277795,6 @@ rootvhcfjrxnjbqp-dot-millinium.ey.r.appspot.com
  rootwqra.com
  rooyan.in
  ropaemporio.com
-ropeplus.cam
  ropergulf.net.au
  ropexon.com
  ropingbilliest.com
@@ -285015,6 +277879,7 @@ rostwa-engineers.com
  roswellwaterproofingmoldremoval.com
  rota-installations.co.uk
  rotaract3131.org
+rotarttasarim.com
  rotarybp.com
  rotarysnehaveedu.com
  rotcal.ga
@@ -285107,6 +277972,7 @@ royalalpaca.com
  royalbaks.com
  royalbank-reset--7839384993.com
  royalbank.com.0sf-50tg05-f54t.com
+royalbank.com.wkoj4vg72vt.doggoneracing.com
  royalbank.com.xa-mxv.com
  royalbank.com.xtudocapela.com.br
  royalbank.cubs-us.com
@@ -285912,6 +278778,15 @@ rvlaxwduadolmqkzqskuylkhrwzklxzzxqzi-dot-cryptic-now-290917.ey.r.appspot.com
  rvlaxwduadolmqkzqskuylkhrwzklxzzxqzi.cryptic-now-290917.ey.r.appspot.com
  rvljvpbyvexxwcahndqupvznas-dot-glexcel9494434.uk.r.appspot.com
  rvlyeydnottmxluctajgkiwodkzquphycpye-dot-cedar-code-289917.nn.r.appspot.com
+rvm-03631882.phonepanda.net
+rvm-08425082.phonepanda.net
+rvm-41053725.phonepanda.net
+rvm-59363309.phonepanda.net
+rvm-67967069.phonepanda.net
+rvm-74985265.phonepanda.net
+rvm-79345216.phonepanda.net
+rvm-90728952.phonepanda.net
+rvm-92450257.phonepanda.net
  rvmhkoftluwxhojp-dot-millinium.ey.r.appspot.com
  rvnkgvsihkjblkyzxhvwhpbsnoivikrtundu-dot-solar-vertex-285913.rj.r.appspot.com
  rvo-net.nl
@@ -285972,6 +278847,7 @@ rwozjbdegrnlrlal-dot-millinium.ey.r.appspot.com
  rwpyrwlpmhrgvxyj-dot-millinium.ey.r.appspot.com
  rwrrvwnvxmgbnlwi-dot-millinium.ey.r.appspot.com
  rwrwnmphvyxdlsmpqiibqkvocf-dot-gloff849483.uk.r.appspot.com
+rwsgwgtww.ddns.net
  rwshd-pdf.org
  rwspmvhz.goruli.com
  rwvsacvnjsxamrzt-dot-millinium.ey.r.appspot.com
@@ -286144,7 +279020,6 @@ s-61j.jaysbrand.com
  s-84.svcoding.com
  s-and-j.hu
  s-ashirov-mektep.kz
-s-cotia-informa.en-virtual.com
  s-e-e-c-u-r-i-t-e-t-y.wl.r.appspot.com
  s-emura.com
  s-epos.co.uk
@@ -286394,6 +279269,7 @@ saba.tokyo
  sabahborneo.com
  sabahinternationalinc.com
  sabaky.com
+sabanaktas.com
  sabappy.com
  sabatcucina.com.br
  sabawenz.com
@@ -286474,10 +279350,12 @@ sacred31ampo7reinfers202011734.nw.r.appspot.com
  sacredamethyst.com
  sacredjourneyguide.com
  sacredscentsonline.com
+sacredseamy.com
  sacrificeomar.xyz
  sacsuport.com
  sactros123.000webhostapp.com
  sacwc.org
+sacyuc.xyz
  sad-carson-c4a6fb.netlify.app
  sad-davinci-57030f.netlify.app
  sad-noether-cbf25c.netlify.app
@@ -286702,7 +279580,6 @@ sahinhurdageridonusum.net
  sahinyangin.com
  sahkocluk.com
  sahmaz.com
-sahpl.fr
  sahrajjo.com
  sahrodion.com
  sahrr21.zapto.org
@@ -286757,7 +279634,6 @@ saipropertiespune.com
  sairaku.net
  sairamschool.edu.in
  saismiami.com
-saisoncinto.pw
  saissco.com
  saistuquee.com
  saitamashiyuuta.xyz
@@ -286860,7 +279736,6 @@ salemtoumi39.ddns.net
  salemtoumi39.hopto.org
  salemwzon.tk
  salemzeid.com
-saleonic.buzz
  saleparty.su
  salermio.pw
  saleruny.ygto.com
@@ -286919,6 +279794,7 @@ salomostichting.nl
  salon-ezhik.ru
  salon-gabriela.pl
  salon-sports-paris.com
+salon.yenetch.com
  salon334.com
  salonbluehair.com
  salonchienkelvin.com
@@ -286970,6 +279846,7 @@ salvtqqrzuktqncf-dot-millinium.ey.r.appspot.com
  salyi.xyz
  salyimmobilier.com
  salyutyserpuhova.ru
+salzburg-triest.de
  salzstrassebingencom.shaxiacenter.top
  sam.solutions
  sam24.vip
@@ -287113,6 +279990,7 @@ sanchitafashion.com
  sancotradebd.com
  sanctified-gap.000webhostapp.com
  sanctifyfitness.com
+sancyphymb.duckdns.org
  sandallia.com
  sandalpalsu.000webhostapp.com
  sandao66.com
@@ -287233,6 +280111,7 @@ santan-totta.org
  santan.der-ref0.com
  santan.der-ref1.com
  santan.der-ref8.com
+santanamailer.com
  santanbacoseyes.com
  santandclieatualiza.redirectme.net
  santander-accountpayments.com
@@ -287278,6 +280157,7 @@ santanderridpj.ddns.net
  santanderrpjcad.ddns.net
  santanders-service.com
  santandertoolkit.alexandermannsolutions.com
+santandertransactions.uccess1.com
  santanderway.servehttp.com
  santanderwaycliente.ooguy.com
  santandewayonline.com
@@ -287393,7 +280273,6 @@ sarathbabuji.com
  saratov.kitaiavtozap.ru
  saravelasquez-profile-82572.online
  sarbatkhalsafoundation.org
-sarcasticchiefmosaic.boswellmichael.repl.co
  sarcoid-evenings.000webhostapp.com
  sardano.xyz
  sardardhambhavnagar.org
@@ -287670,6 +280549,7 @@ sbn734qew.tk
  sbne.ailacabs.com
  sbnk-united.com
  sbnvmadwmkxybppqovcxyhwmzf-dot-gleowayel400503.uc.r.appspot.com
+sborglertb30-biglobe.xyz
  sbp.qfab.org
  sbpgwniolfbjilacqamvgiffdo-dot-gloff849483.uk.r.appspot.com
  sbplifuyejjzgixqyvnookkebi-dot-gleowayel400503.uc.r.appspot.com
@@ -287689,6 +280569,7 @@ sbysygcu.org
  sbz-h.addroits.com
  sbza.vipsnapchatsexting.com
  sc-bancolombia.webcindario.com
+sc-com.biz
  sc-login.com
  sc-options.eu
  sc.1111v.cn
@@ -287750,6 +280631,7 @@ scaredephemeris.org
  scarediesaway.com
  scarfacechile.000webhostapp.com
  scarica-nuova-app-obbligatoria.info
+scaringsound.us
  scarletfilmsltd.com
  scarletleaf.ro
  scarlett.com.ar
@@ -287779,6 +280661,7 @@ scfh.awaykart.com
  scglobal.co.th
  scglobal.com.ph
  scha-ymail-com11.weebly.com
+scha-ymail-com58.weebly.com
  schachkraft.de
  schadenlock.xyz
  schaefer-frank.de
@@ -287986,6 +280869,7 @@ scotlabanxmx.net
  scotncolpn.com
  scotriabank.online
  scottbhale.com
+scottbnx.com
  scottiabank.tk
  scottifloyd.cf
  scottishwildlifecommunity.co.uk
@@ -288013,6 +280897,7 @@ scratchygrowlingarchitects.vadasd.repl.co
  scrawk.tusarranjan.com
  scrawlier-sediments.000webhostapp.com
  scrbleacz.ga
+scrbleacz.gq
  scrcconnexionportailmssgeriemms.udo.photo
  screamcup.xyz
  screamhard50.24x7s.com
@@ -288059,6 +280944,7 @@ scrumbert.org
  scrvconnexionportailmssgerie06.ufotograf.ru
  scrvconnexionportailmssgeriemms.unail.biz
  scsanwei.cn
+scscu.xyz
  scscxx.weebly.com
  scservice.at
  scshiur.org
@@ -288193,6 +281079,7 @@ sdhzyhsoxofvhkatlieqdkfrqlsmnmhmfaja-dot-solar-vertex-285913.rj.r.appspot.com
  sdilindia.com
  sdj-online.xyz
  sdjhbkjhfeo.top
+sdjk-nnl.buzz
  sdjnwfddvyvqpzkwusgunxvjysanvkowmwgf-dot-cedar-code-289917.nn.r.appspot.com
  sdkfhuwiw.com
  sdkkg.com
@@ -288290,7 +281177,6 @@ seachrider.co.kr
  seacormarine.in
  seacresthh.com
  seadelik.com
-seadough.guru
  seaf.chamber.lk
  seafarerconsulting.com
  seafees.surge.sh
@@ -288405,10 +281291,13 @@ sec.office.earcs.or.ke
  sec.support-customer.access.apps-systeminformation.com
  sec.support-customer.access.security-systemapp.com
  sec0-sf33-rss.com
+sec07-onlinechase.com
  sec0ndservices.3utilities.com
  sec24h.com
  sec3-d4-ssl.com
+sec3auth77verif9.ddns.net
  sec42.edu.mx
+sec77verif72auth.ddns.net
  secaire.net
  secam.ddns.net
  secb801.com
@@ -288438,7 +281327,6 @@ secrbehuantiladert.com
  secredesc.000webhostapp.com
  secrejchoe.sytes.net
  secretcashout.com
-secretcock.buzz
  secretcuckld3sm4smgroup.000webhostapp.com
  secrete-service.com
  secretinspire.com
@@ -288550,6 +281438,7 @@ secure-apphalifaxupdate-verification-online.ionutarbunea.ga
  secure-apphalifaxupdate-verification-online.lmi.pe
  secure-apphalifaxupdate-verification-online.maxresearch.co.id
  secure-apphalifaxupdate-verification-online.media-fi.hr
+secure-apphalifaxupdate-verification-online.mschandlers.com
  secure-apphalifaxupdate-verification-online.potaforum.net
  secure-apphalifaxupdate-verification-online.promodent.it
  secure-apphalifaxupdate-verification-online.rimura.id
@@ -288638,6 +281527,7 @@ secure-biling-login.com
  secure-bnpparibas.at
  secure-boa.servebeer.com
  secure-bofa.serveftp.com
+secure-bofaauth.serveirc.com
  secure-care.serveirc.com
  secure-carrierinterac.com
  secure-cdek.ru
@@ -288691,12 +281581,15 @@ secure-dynamic.serveirc.com
  secure-etransfer.serveirc.com
  secure-facebook-ad.id-12612663-post.com
  secure-facebook-ads.id8728291103-listing.com
+secure-facebook-item.id0292714233113313422.com
  secure-facebook-item.id3549464501.com
  secure-facebook-item.id3549467777.com
  secure-facebook-listing-item.id76389211.com
+secure-facebook-marketplace-item.id109272511127898.com
  secure-facebook-page.id54944401.com
  secure-facebook-page.id549fg46401.com
  secure-facebook-pages.id54946401.com
+secure-facebook-protection.id2220221931.com
  secure-facebook.7fu73ial.cf
  secure-facebook.ad-id35665432-post.com
  secure-facebook.ad-listing-id3469292.com
@@ -288726,6 +281619,7 @@ secure-gov-hm-revenue.com
  secure-gov-process-hmrev.com
  secure-gpayment.serveirc.com
  secure-halifax-cancel.co.uk
+secure-halifax-online-login.com
  secure-halifax-online-logins.com
  secure-halifaxonline-login.cc
  secure-halifaxonline-login.com
@@ -288745,6 +281639,7 @@ secure-iptv.de
  secure-limitedsdevice.favecvc.com
  secure-liquidx.com
  secure-listing-id-promotion2057336.com
+secure-listing-product-id37763612-promotion.com
  secure-lloyds-device.com
  secure-lloyds-now.com
  secure-lnstagrann.tk
@@ -288790,7 +281685,9 @@ secure-nab.info
  secure-natwestsafeguard.info
  secure-net-flix1.com
  secure-netflix-accountinfo.com
+secure-netflix-pay.com
  secure-network-web.com
+secure-newpayee.cc
  secure-notice-account-sign.valhallainfull.com
  secure-notice-app-sign.haggshe.com
  secure-notice-sign-paypal-log.summaryaccount2763.com
@@ -288803,6 +281700,7 @@ secure-officemembers.serveuser.com
  secure-online-bank0famerica-dashboarrd01.ddnsgeek.com
  secure-online-chase-sdjgh.duckdns.org
  secure-online-chasebank-overview-web.duckdns.org
+secure-online-device.com
  secure-online-halifaxmobileapp-systemupgradeapp.otticagrande.com
  secure-online-info.duckdns.org
  secure-onlinebanking-review-dashboards.ddnsfree.com
@@ -288817,6 +281715,7 @@ secure-payee-help-uk.com
  secure-payee-online-uk.com
  secure-payeecheck.com
  secure-payeelink.com
+secure-payeesecurity.live
  secure-payeeverify.com
  secure-payment.servehalflife.com
  secure-paypailine.serveirc.com
@@ -288876,6 +281775,7 @@ secure-sign-account-config.grouawen.com
  secure-sign-in-amazon.com
  secure-sign.in-amazon-unauthorise-serv.jijikulosa.com
  secure-sign.in-amazon-unauthorise-servive.hutamakuko.com
+secure-signin.dontexist.com
  secure-signin.servehalflife.com
  secure-srgep.com
  secure-ssl-cdn.com
@@ -288943,6 +281843,7 @@ secure-wellsfargobank.com
  secure-www.account-center-support291.gleeze.com
  secure-www.apple-verifycationsrequited7s9112.giize.com
  secure-xcrewg.ga
+secure-xcrewg.kuras-habis.xyz
  secure-xcrewg.ml
  secure-xcrewg.tk
  secure-your-account-information-imp.000webhostapp.com
@@ -288950,6 +281851,7 @@ secure-your-accounteinformations.freshopping.com.br
  secure-your-information-power-security.giize.com
  secure-your-pc-now.in
  secure-youraccount.cc
+secure-yourprofile.com
  secure.2020yahoo.new.verison.11.care-protect.com.au
  secure.accessbnkia-eu.com
  secure.account-update.client-login.store.conn.leoesport.com
@@ -289015,7 +281917,6 @@ secure.billing-portal.aumobile-jpapac024.com
  secure.bimlarge.com
  secure.bnz.co.nz.auth.personal-login.nz-bk01.cf
  secure.bnz.co.nz.auth.personal-login.nz-bk01.ml
-secure.bnz.co.nz.auths.personal-login.nz-bk01.gq
  secure.cbbnline.co.uk
  secure.chase.com.iosserv4.com
  secure.chaseonlinebanking.online-authentication.online
@@ -289027,8 +281928,10 @@ secure.coburnfarm.com
  secure.com-uk.top
  secure.confirmawb.com
  secure.connect.auone.jp.nerfxew.com
+secure.digitalalignment.net
  secure.discoveronline.xyz
  secure.docusign.sharedocument.fileexchange.lchaimchaverut.org
+secure.ee-alerts-billing.com
  secure.eprmedia.org
  secure.exchangevoicecloud.gq
  secure.exchangevoicecloud.ml
@@ -289102,6 +282005,10 @@ secure.paycount.intl-information.login.client2020.duahzs.org
  secure.paycount.intl-information.login.client2020.omksn.com
  secure.paycount.intl-information.login.client2020.qnuzjv.com
  secure.paycount.intl-information.login.client2020.vnmazh.org
+secure.paycount.intl-information.login.client2020.xhjgcvy.com
+secure.paycount.intl-information.login.client2020.xjzysvx.org
+secure.paycount.intl-information.login.client2020.zcuhaw.org
+secure.paycount.intl-information.login.client2020.znacu.org
  secure.payment-detection.com
  secure.paypal-entrance.com.tranbyunit.com
  secure.paypal.com-cmd-login.marinastechnologies.com
@@ -289205,6 +282112,7 @@ secure.runescape.com-wl.best
  secure.runescape.com-wtp.xyz
  secure.runescape.com-wxz.xyz
  secure.runescape.com-xo.xyz
+secure.runescape.com-xporbond.xyz
  secure.runescape.com-xrsx.xyz
  secure.runescape.com-xsc.xyz
  secure.runescape.com-xu.top
@@ -289400,6 +282308,7 @@ secure03b-chase.tk
  secure03b-chaseinfo.duckdns.org
  secure03b-chaseuserhelper.misecure.com
  secure03b-verify.serveirc.com
+secure03b.chase.cpcaservices.com
  secure03b.chase.stantonscdims.com
  secure03b.patergoda.com
  secure03b71chase.myvnc.com
@@ -289529,6 +282438,7 @@ secure0b-paypal.servehttp.com
  secure0b07.tk
  secure0c.serveirc.com
  secure0f-chasebank-login.xyz
+secure0myapples-com.serveirc.com
  secure0x9-paypal.serveirc.com
  secure1-amazon.menagers-email.com
  secure1-appleid-payment.amazoncompayment.net
@@ -289680,6 +282590,7 @@ secureattylprofile.weebly.com
  secureauthentication.fxnxs.com
  secureb097.tk
  securebank-53.top
+securebanking-payees.info
  securebanking.services
  securebankofamerica-com.ibx.lat
  securebankofamerica.life
@@ -289732,6 +282643,7 @@ secured-chase07.myddns.com
  secured-deregisterdevice.com
  secured-device-protection.com
  secured-device-support.com
+secured-device.com
  secured-devicederegister-uk.com
  secured-devicederegister.com
  secured-deviceprotection.com
@@ -289810,6 +282722,7 @@ secureddownload.monster
  secureddsite.com
  securedeliveryexpress.com
  securedeposit.redirectme.net
+securedevice-assist.com
  securedevice-online.link
  securedfastnetclassic.co.nz.nz-inbk.ga
  securedfilestransfer.com
@@ -289820,6 +282733,7 @@ securedhun4direct.bounceme.net
  securedhut3.freedynamicdns.net
  securedinfoid.com
  securedirect-paypal.serveirc.com
+securedlloyds-alerts.com
  securedmanageaccnt-updt.maribertamasya.com
  securedoath.sbosecuniversal.com
  securedob5chase.serveirc.com
@@ -289863,6 +282777,7 @@ securehalifaxonline.com
  securehalifaxpayee.com
  securehelp-payee.com
  securehelppaypal.com
+securehl-payee.com
  securehost-verify01-chase.securedusers.xyz
  securehost-verify07-chase.ddns.info
  securehost-verify08-chase.gleeze.com
@@ -289920,7 +282835,6 @@ securelyapplepaymentrefund.com
  securelymatchst.com
  securemail.bigbarbell.com
  securemail.droguesur.com
-securemail.lakeshoregazette.com
  securemail.loooka.my
  securemail.pacificali.com
  securemail.passiveincome.pro
@@ -289956,6 +282870,7 @@ securemyamz-billing.com
  securemyappidapple.servehttp.com
  securemyapple.serveirc.com
  securemydevice.uk
+securemyhalifax.com
  securemylloydsaccount.com
  securemypayee-auth.info
  securemytax.com
@@ -289974,6 +282889,7 @@ secureoffice365.redirectme.net
  secureofficenow.kozow.com
  secureonline-alerts.com
  secureonline-banking.com
+secureonline-digital.com
  secureonline-signin.com
  secureonline-userverification-authinformation.tk
  secureonline20200403-bankofamerica-com-l87180201.ournits.com
@@ -289990,6 +282906,7 @@ securepasswel.ru
  securepavpal.xyz
  securepay.services
  securepayapal.world-heberg.com
+securepayee-hl.com
  securepayee-hs.com
  securepayee-mobile.com
  securepayee-unregistered-device.com
@@ -290138,6 +283055,7 @@ secureweb50.xyz
  securewedreesdsa3.ru
  securewellsfargo.redirectme.net
  securewffaccounts02.com
+securewfffaccc-serveraccess.com
  securewindred.weebly.com
  securex.login.accounts.click.gift-arg0s-c0-uk.icu
  secureyouraccount12.000webhostapp.com
@@ -290175,6 +283093,7 @@ security-alert.secure01a.chase.com-auth.mydailywire.us
  security-alertuk.com
  security-and-protection-wells-fargo.com
  security-appendpayee.com
+security-appleinc.serveirc.com
  security-applesync.serveirc.com
  security-applp.serveirc.com
  security-available.network
@@ -290204,6 +283123,7 @@ security-limitedsdevice.vabhvxac.com
  security-limitedsdevice.xvaaxca.com
  security-limitedsdevice.zbhscs.com
  security-lloyds.com
+security-lloydspayee.com
  security-loginattempt.com
  security-mage.com
  security-mail-support.000webhostapp.com
@@ -290242,6 +283162,7 @@ security-pages-help.000webhostapp.com
  security-payee-admin.com
  security-payee-check.com
  security-payeecheck.com
+security-payeeonline.cc
  security-payeereview.com
  security-payees.cc
  security-paymentpending.com
@@ -290385,6 +283306,7 @@ securityone-eg.com
  securityoperationcenter.de
  securitypage.ywynbwz.cn
  securitypagemesenggerrecoverry.000webhostapp.com
+securitypayee-onlinepay.link
  securitypink.000webhostapp.com
  securityplusrouting.net
  securitypoison.com
@@ -290429,6 +283351,7 @@ securlty3.tk
  securlty4.ml
  securlty8.gq
  securlty9.ga
+securltypage4.gq
  securltypage5.tk
  securltypage6.ga
  securltypage8.cf
@@ -290455,6 +283378,7 @@ sedermaster.fr
  sedgfinancial.com
  sedimentgrowere.com
  sedistribuidora.com.br
+sedndjsd.com
  sedomnitempore.com
  sedotwcsejakarta.com
  sedrapex.com
@@ -290606,6 +283530,7 @@ sekleinanzeigen-001-site1.dtempurl.com
  seko.zapto.org
  sekolahbhkjakarta.sch.id
  sekolahmusa.org
+sekretov.ml
  sekrtkkspxddwcch.top
  seksi-devojke.000webhostapp.com
  sekurovillage.com
@@ -290709,6 +283634,7 @@ selltnow.com
  sellularbd.com
  sellusedgym.com
  selopet.co.uk
+selrverette.tk
  seltecasiacom.nckila.gdn
  seltreftreze.web.app
  semana-de-oferta-redmi8.com
@@ -290784,7 +283710,6 @@ semprepresente-itaucard.online
  semprepresentecheckinonline.com
  semprepresenteitaucard.online
  semvice11.000webhostapp.com
-sen-elteks.com
  sen-jin.co.jp
  senadorarosedefreitas.com.br
  senandungmerana.org
@@ -290854,6 +283779,7 @@ sensezhealth.com
  sensifier.org
  sensimatino.us
  sensin.byethost24.com
+senskemad.com
  senson.fi
  sensornumero1.000webhostapp.com
  sensorthai.com
@@ -291133,6 +284059,7 @@ serverappmailsapple.servehttp.com
  serverauthid-covid19-protect01.security-alert-infos01.com
  servercanter2020.sytes.net
  servercapital1office.com
+servercloudddnsking.ga
  serveres-gmail.myftp.biz
  servergateway56.com
  serverhp.top
@@ -291545,6 +284472,7 @@ services-besson.org
  services-fargo.mobi
  services-inc.net
  services-mail-exchange-cox.netlify.app
+services-microsoft6726.000webhostapp.com
  services-my3.com
  services-myee.com
  services-secure0e.000webhostapp.com
@@ -291703,7 +284631,6 @@ serviesfb-notice.000webhostapp.com
  serviesfb005.000webhostapp.com
  servifive.com
  servifli-online.ddns.net
-serviice-account.xyz
  serviices-appieid.servehttp.com
  serviicessystemveryfication.coronaidied.com
  serviiiiicedessk.creatorlink.net
@@ -291781,7 +284708,6 @@ sestyusdavidwe.tk
  sesurity.cf
  sesvrfte-authnverft-authidnotifyonline.com
  sesxfrvicre-authnverft-authidnotifyonline.com
-set-25958686.elsenordelosbajones.cl
  set-87402714.elsenordelosbajones.cl
  set.spactez.uk
  setaccess.webflow.io
@@ -291866,11 +284792,13 @@ setupbusinessinusa.com
  setupdownloads.com
  setupiskey.com
  setuppayee-online.com
+setuprecoverapp.com
  setupsupportalertyekan.webredirect.org
  setwebsolutions.com
  sety1.info
  seu-aplicativo-ame-digital.com
  seu-pai-merece-esse-presentao-corra-poucas-unidades.com
+seublogonrf-info.umbler.net
  seucartaoitaucards.com
  seucre-accounts-recover.top
  seuitapromocoes2020.com
@@ -291949,6 +284877,7 @@ sex.evenxfree.com
  sex.freeventing.com
  sex.getfreevent.com
  sex.videoxxporn.com
+sex.webxhot.com
  sex.whattsapps.com
  sex.xxvideossss.com
  sexaejj.000webhostapp.com
@@ -291961,6 +284890,8 @@ sexday.xyz
  sexeanak18plus.000webhostapp.com
  sexeducation.atspace.com
  sexgroupwhatsapp.lflink.com
+sexgroupwhatsapp.zzux.com
+sexgroupwhatsapplovers.jetos.com
  sexgrup.info15.net
  sexgrup.x21s.net
  sexgruphotvideosindojapan.000webhostapp.com
@@ -292000,6 +284931,7 @@ sextube.zzux.com
  sexvideosteve.000webhostapp.com
  sexwa18.invite-groubs.my.id
  sexwhatsapp1.chaozyx4.my.id
+sexwhatsappgroupinviet.xxuz.com
  sexx.whattsapps.com
  sexxbest.4pu.com
  sexxgroupswa.joins5.com
@@ -292128,6 +285060,7 @@ sfiejkbbdobkufow-dot-mnospot.ts.r.appspot.com
  sfieldtest.co.za
  sfinanceirosa.com.de
  sfinances.com.de
+sfiosfjaf.cf
  sfird.xyz
  sfiwhjf.hutypolz.info
  sfjacobs.com
@@ -292495,6 +285428,7 @@ sharedpont77wwjxjx.df.r.appspot.com
  sharedstoragefraiou.tk
  sharedt5nn5i6l89e4eil9e88sa.el.r.appspot.com
  shareducment.duckdns.org
+sharef-files.life
  sharefile.firewall-gateway.com
  sharefile.host
  sharefile.world
@@ -292643,6 +285577,7 @@ shbxqcxlyxgs.002.sh.cn
  shc68c2hg6klo5f-99sbhx4f0.vercel.app
  shchurchaimury.in
  shcscsyxgs.002.sh.cn
+shcxgy.com
  shcyxbyxgs.002.sh.cn
  shdbshi.com
  shdevotion.com
@@ -292705,6 +285640,7 @@ shepherdschapelvideoindex.com
  sheraleetour.com
  sherazsaleem.softvion.com
  shere-point-document-365.oa.r.appspot.com
+shereecarlen.ru
  sherman.org.za
  shermancohen.com
  shermanworkmanship.com
@@ -293053,6 +285989,7 @@ shopquanaosile.000webhostapp.com
  shops-covid-19.rf.gd
  shopsabz.com
  shopscovid19.rf.gd
+shopservers.ca
  shopsheets.xyz
  shopsinhlynamnu.com
  shopsmartdiscounts.com
@@ -293654,6 +286591,7 @@ signin.ebay.de-ws-ebayisapi-dll-signin.sepsifc.de
  signin.ebay.de-ws-ebayisapi.archinglab.eu
  signin.ebay.de-ws-ebayisapi.dll-signin.usingssl.kund.doomdns.org
  signin.ebay.de-ws.1i1i.icu
+signin.ebay.de-wsebaa.xyz
  signin.ebay.de.1hwpekazsukng5h.e8273.pro
  signin.ebay.de.accuo.ca
  signin.ebay.de.btt79olymaslvfc.e8273.pro
@@ -294219,7 +287157,6 @@ simplebsolutions.co.uk
  simplecuisine.000webhostapp.com
  simplegrupwa.000webhostapp.com
  simplehome.ca
-simplehomequotess.us
  simplemakemoneyonline.com
  simplemars.fun
  simplemirror.ga
@@ -294741,6 +287678,7 @@ skinezy.fun
  skinfinish.ru.com
  skinfood.fun
  skinfree89.my.id
+skinfreepubgm.giize.com
  skinfreereward.theworkpc.com
  skinfrees13.com
  skinfreeseason13.com
@@ -294814,6 +287752,7 @@ skinssjars.com
  skinstrading.top
  skinsupply.shop
  skinsutter.com
+skintonowe.com
  skintosneosenzo.tk
  skinuc13.hot1.shop
  skinucpubg1.dynamic-dns.net
@@ -294962,6 +287901,7 @@ sl-downloads.com
  sl-gzs.com
  sl9xa73g7u3eo07wt42n7f4vin5fzh.biz
  sla-paris.com
+slabflyend.com
  slableakrepairorangecounty.com
  slacapital1.com
  slacapital3.com
@@ -295005,6 +287945,7 @@ sleekinnovations.com.ng
  sleepam.com
  sleepclinicofohio.com
  sleepingyukon.com
+sleeppillow.work
  sleepsherpa.net
  sleepy-kirch-914ec6.netlify.app
  sleepy-ramanujan-e4f52c.netlify.app
@@ -295068,6 +288009,7 @@ slinkkkkkkkkk.duckdns.org
  slipcentral.com
  slipondk.com
  slipperier-amount.000webhostapp.com
+slisa77.com
  slithermon.s3.amazonaws.com
  sliumatew.com
  sliver24.webnode.com
@@ -295228,11 +288170,11 @@ smarthelp.infopaypal-app.com
  smarthouseforum.ru
  smarthub.ws
  smartify.ae
+smartilight.work
  smartindianagriculture.com
  smarting-cosals.000webhostapp.com
  smarting.rs
  smartishpace.com
-smartkey.hk
  smartkidsafrica.com
  smartkidscare.com
  smartlifeaustralia.com
@@ -295317,6 +288259,7 @@ smbc-boun.club
  smbc-buzz.best
  smbc-cacc.com.igjxpg.top
  smbc-caerd.best
+smbc-camrd.xyz
  smbc-carb.buzz
  smbc-carb.monster
  smbc-carb.xyz
@@ -295426,8 +288369,10 @@ smbc-card.dongcheba.com
  smbc-card.emaiduo.com
  smbc-card.evtss.com
  smbc-card.fgjdgsmbc.monster
+smbc-card.fundnqh.cn
  smbc-card.info
  smbc-card.jyyunxing.cn
+smbc-card.kmvkr.shop
  smbc-card.ksvee.com
  smbc-card.lhwssc.com
  smbc-card.live
@@ -295452,6 +288397,7 @@ smbc-card.top
  smbc-card.vip
  smbc-card.woosz.com
  smbc-card.yydjzb7.top
+smbc-card.zyszrc.com
  smbc-carda.buzz
  smbc-carda.monster
  smbc-carda.xyz
@@ -295513,6 +288459,7 @@ smbc-jdauw.com
  smbc-jdauw.me
  smbc-jp.club
  smbc-pa.com
+smbc-qasd.myalloy.org
  smbc-qwerqwer.amz-electronics.com
  smbc-qwerqwer.as-holesgarage.com
  smbc-qwerqwer.homesforleisure.com
@@ -295661,7 +288608,6 @@ smcc-cacc.chsmfood.org
  smcc-cacc.com.dlxnv.top
  smcc-cacc.com.saydo.vip
  smcc-cacc.eiair.com
-smcc-cacc.fzrr.top
  smcc-cacc.gmjbz.com
  smcc-cacc.gsncpw.com
  smcc-cacc.hcsen.com
@@ -295675,6 +288621,7 @@ smcc-cacc.myjuhe.com
  smcc-cacc.myttd.com
  smcc-cacc.pacconline.xyz
  smcc-cacc.qqnpq.com
+smcc-cacc.sacc.space
  smcc-cacc.shx8p.top
  smcc-cacc.sinsue.com
  smcc-cacc.smtkj.com
@@ -295729,7 +288676,6 @@ smddpgnjw.shoesmogul.com
  smdgo.com
  smdistributors.co.za
  smdjtqhpnebbfqjlyiviertdnqyxpuryepwr-dot-cryptic-now-290917.ey.r.appspot.com
-smeary-whip.000webhostapp.com
  smecreditplus.com
  smefood.com
  smeforum.in
@@ -295753,6 +288699,7 @@ smg-com-dot-gl494903049.wl.r.appspot.com
  smh5682.com
  smhydro.com.pl
  smibccrad-verifiy.xyz
+smiechowo.eu
  smiesznawiocha.eu
  smieszne-zdjecia.eu
  smikgfd.godaddysites.com
@@ -295760,7 +288707,6 @@ smilebaby.in
  smilee-amazon.serveirc.com
  smilegate-cfs.epizy.com
  smilehousecafesf.buzz
-smilerede.cf
  smilerryan.com
  smiles-bbpontosresgate.com
  smiles.al-wed.com
@@ -295922,7 +288868,6 @@ smtp.securityupdatenotice.com
  smtp.theisenbergs.net
  smtp.user-gto.ru
  smtpgmx2.yolasite.com
-smtpseguro.royal-eng.ps
  smtpsolution.hopto.org
  smufflop.com
  smultimedios.com
@@ -295966,7 +288911,6 @@ snapchaatccount.000webhostapp.com
  snapchaiki.000webhostapp.com
  snapchat-accounts.ddns.net
  snapchat-recovery.fr
-snapchat-security.com
  snapchat.accounts.crimsonmart.com
  snapchat.com-accounts.info
  snapchat.tel
@@ -296031,6 +288975,7 @@ snficokd.dermals.org
  snhc.org
  sniodoliss.com
  snip.li
+sniperdz.com
  snippetcards.com
  snipscell-ss.com
  snjcemhnkpwreluggzukczmshghnbuzssodk-dot-solar-vertex-285913.rj.r.appspot.com
@@ -296667,6 +289612,7 @@ sonirntech.com
  sonname.com
  sonnarure.com
  sonnencreme.info
+sonnenschein-wg.de
  sonnex.ir
  sonnhietdoi.com
  sonnysautomotivefayetteville.com
@@ -296917,6 +289863,7 @@ southyang-jp.top
  soutiennetflix0511.info
  soutsholesails.com
  souvenirsplace.com
+sov-gcridcen.tk
  sov.lv
  sova.gg
  sovanrith.com
@@ -297282,6 +290229,7 @@ spinheal.ru
  spinkseagle.com.au
  spinlckys14.ooguy.com
  spinlucky.giize.com
+spinlucky.ooguy.com
  spinluckypubgmobile.4dq.com
  spinluckys.com
  spinluckys13.com
@@ -297343,12 +290291,11 @@ spiritualramadan.icu
  spirituated.info
  spiritwarriormama.com
  spirtnoe.org.ua
-spitefulpristinerectangle--five-nine.repl.co
  spitex60plus.ch
  spix.com.my
+spk-filliale-direkt.xyz
  spk-finanzgruppe-de-home-portalredirect.ru
  spk-sicherheits-check.org
-spkredirect.com
  splac-dlug.com
  splaczadluzenie.com
  splanchnographer.info
@@ -297484,6 +290431,8 @@ spqlobal.info
  spr6m.mentriqq.com
  sprachwerk.at
  spravkabas.com
+sprawdzto.cf
+sprawdzto.tk
  sprayi.com
  spraysand.info
  sprayzee.com
@@ -297641,7 +290590,6 @@ squareccl3.com
  squarecovid91.com
  squaredconer0.com
  squaredep3.com
-squaredisce.com
  squareeeup.myftp.biz
  squareeup.net
  squaregdsvenms.com
@@ -297839,7 +290787,6 @@ srodkidlagastronomii.pl
  sroomf70nasiru.duckdns.org
  srpsyebfeuqviscudpmnrjufpcqvunbxcfjj-dot-cryptic-now-290917.ey.r.appspot.com
  srr.servequake.com
-srr8sleepaids.buzz
  srrom.ro
  srsdatuksimonfung.edu.my
  srskgroup.com
@@ -298051,6 +290998,7 @@ ssl-lcl-voscomptes-lcl-ssldrgfweb.com
  ssl-particulares.bancosantander.es.dellettlaw.com
  ssl-paybylink.pl
  ssl-payu.pl
+ssl-pstnsmldn.com
  ssl-sec-tls-124.com
  ssl-security-checking-robots.blogspot.com
  ssl-sol.net
@@ -298164,6 +291112,7 @@ st-92.svcoding.com
  st-amu-cz.my-free.website
  st-andrews.ac.uk.mailchkmessageb.icu
  st-code.me
+st-michael-schule.de
  st.sovereignty2020.com
  st0sr.app.link
  st11llers.000webhostapp.com
@@ -298214,6 +291163,7 @@ staffdiaruba.com
  staffkabattle.ru
  staffordchristadelphians.org.uk
  staffordpropertygroup.com.au
+staffpacesea.com
  staffsolut.nichost.ru
  staffworx.co
  stage.amazonchristmassmiles.co.uk
@@ -298290,6 +291240,7 @@ stampile-sibiu.ro
  stand.fbcom-51831420.fleacontrolperth.com.au
  stand.fbcom-54320922.fleacontrolperth.com.au
  stand.fbcom-55014189.fleacontrolperth.com.au
+stand.fbcom-88510113.fleacontrolperth.com.au
  standard.sglobal-service.com
  standardchartered.com.kz
  standardcolours.com
@@ -298315,7 +291266,6 @@ stanislav7.000webhostapp.com
  staniszczak.net
  stanlycountyonline.com
  stansmallz.com
-stantoncrest.buzz
  stanweavers.com
  star-speed.vip
  star-studios.ru
@@ -298441,6 +291391,7 @@ statement.dbbrmine.club
  statement02.duckdns.org
  statementfree.com
  statementfu.byethost10.com
+statenewsharyana.com
  stateoffice.hopto.org
  stateoffice195.sytes.net
  stateofficehelp.zapto.org
@@ -298639,7 +291590,6 @@ steamcommunityhub.info
  steamcommunityno-pubg.cn
  steamcommunityprofiles76561198205968516.net.ru
  steamcommunityru-com.xyz
-steamcommunityub-pubg.cn
  steamcommunityvalve.info
  steamcommunitywallet.info
  steamcommunityy.ga
@@ -299006,6 +291956,7 @@ steve4tech.com
  steveandnicolewedding.com
  stevecadenasso.com
  stevedcampbell.com
+stevedepino.com
  stevedimatteo.com
  stevejons.com
  stevemaddenat.com
@@ -299163,7 +292114,6 @@ stogt.com
  stoic-galileo-1310e7.netlify.app
  stoic-golick-21cf37.netlify.app
  stoic-lamport-01777c.netlify.app
-stoic-neumann-0b4b2f.netlify.app
  stoilamser.com
  stojiu.com
  stokeharvester.com
@@ -299472,6 +292422,7 @@ strudengauerwachdienstcom.shaxiasay.top
  strugglingcreative.com
  strugvainstroes.org
  struhall439524.xyz
+strumentodisicurezzaban.com
  strungbed.co.kr
  sts-cisco.com
  sts34.ru
@@ -299511,6 +292462,7 @@ studentloans.credezen.com
  students.vlevski.eu
  students2019.com
  studerin.batwoqishoes.top
+studiegids.com
  studio-liorit.co.il
  studio.fisheye.eu
  studio.ines.life
@@ -299588,7 +292540,6 @@ stwqylxknnhhrhgpdvogubwaui-dot-gleowayel400503.uc.r.appspot.com
  stxaviersvitthalwadi.com
  stylam.cc
  stylebarchattanooga.org
-stylee-secret-school.com
  stylelifeincersafe.3utilities.com
  styleofchicago.com
  stylesbyaranda.com
@@ -299764,6 +292715,7 @@ subtlestbireme.online
  subtractkilos.com
  subtriangular-maneu.000webhostapp.com
  subul.com.sa
+suburbanapprehensivefactor.figueroaads123.repl.co
  suburbanindustries.net
  suburbanswag.info
  suburmart.com
@@ -299771,7 +292723,6 @@ subvencaoeconomica.creatorlink.net
  subvention-gouv-ca.org
  subviewmail2.com
  subwaynut.com
-subzonal-seal.000webhostapp.com
  suc-khoe.net
  sucalcin.top
  sucatadozito.com.br
@@ -299877,6 +292828,7 @@ sucursalpersonas-transaccionesbancolombia-hit.mypressonline.com
  sucursalpersonas-transaccionesbancolombia-jun.mypressonline.com
  sucursalpersonas-transaccionesbancolombia-kui.medianewsonline.com
  sucursalpersonas-transaccionesbancolombia-mau.mypressonline.com
+sucursalpersonas-transaccionesbancolombia-mhpssmoupvvop7km9sd31.getenjoyment.net
  sucursalpersonas-transaccionesbancolombia-muaa.mypressonline.com
  sucursalpersonas-transaccionesbancolombia-oct.mypressonline.com
  sucursalpersonas-transaccionesbancolombia-personas.mypressonline.com
@@ -300469,7 +293421,6 @@ supertopup.000webhostapp.com
  supertudo.com
  superty.me
  supervaluecopy.com
-supervenient-civili.000webhostapp.com
  supervermelhasantiaderentes.com
  superviajes.do
  superwhite.com.au
@@ -300590,7 +293541,6 @@ support-amazon-jp3.ga
  support-amazon.tt-t12.com
  support-amazon0.serveirc.com
  support-amazonseo.serveirc.com
-support-amzcontactuk.com
  support-amzncontactuk.com
  support-amznuk.com
  support-analyse.com
@@ -300826,6 +293776,7 @@ support.yrbinc.com
  support.zand.ac.ir
  support.zuzugroup.com
  support.zybcan23.com
+support01-paypal.serveirc.com
  support021c.connect.chse.com.applsettheconfigpyserv9124.com
  support07-chasec.serveftp.com
  support07service.serveirc.com
@@ -300927,6 +293878,7 @@ supportnetflixinc.info
  supportnetflixx.info
  supportnotices.com
  supportnotificationteam.000webhostapp.com
+supporto2-alerts.com
  supportonlinesecurity.com
  supportoor.temp.swtest.ru
  supportpages2020.my.id
@@ -301006,7 +293958,6 @@ suprementmshop.com
  supremereborn.online
  supremesaadiq.com
  supremispher.info
-supremosenhorcaio.azurewebsites.net
  supremus.free.fr
  supreonlin.temp.swtest.ru
  suprequarea.com
@@ -301054,7 +294005,6 @@ surgerybam.co.kr
  surgeryfix.com
  surgicalface-mask.com
  surguy.com
-suriagrofresh.com
  suriahijabs.com
  surishoppingexpress.nl
  surjmor.com
@@ -301179,7 +294129,6 @@ suspicious-activity-paypal.vrfd-arz-sppt4.com
  suspicious-austin-cd8033.netlify.app
  suspicious-online-payment.com
  suspiciousactivity.xyz
-suspiciousdarkredcustomization.ygfyedgfvcr.repl.co
  suspiciousitem.com
  suspiros.com.br
  suspnd-apps.com
@@ -301427,7 +294376,6 @@ sweise.iamallama.com
  swellcoolangatta.com
  swellexchange.com.br
  sweltering-synonymous-diagnostic.glitch.me
-swelteringcloudybuckets.ygfyedgfvcr.repl.co
  swensond65.com
  swer8y.xyz
  swerlinggol.com
@@ -301510,6 +294458,7 @@ swmen.com
  swmwater.it
  swollen-headed-rece.000webhostapp.com
  swop-appi.web.app
+swordserviceowe.cyou
  swork.com.hk
  swos2017.org
  swpofficial.co.id
@@ -302087,6 +295036,7 @@ tags-51067229.novanfarm.com
  tags-54955964.novanfarm.com
  tags-55021358.novanfarm.com
  tags-64234580.novanfarm.com
+tags-69777730.novanfarm.com
  tags-82620267.novanfarm.com
  tags-97991391.novanfarm.com
  tags-bootstrap.icu
@@ -302123,6 +295073,7 @@ taillormadeces.com
  tailoredwine.com
  tailorexpress.co
  tailorsoft.in
+tailsideego.com
  tainhacchuong.online
  taintedperfection.com
  taipei-lottery.com
@@ -302541,7 +295492,6 @@ tawayrd.com
  tawgtyntawm.com
  tawiwa6455.temp.swtest.ru
  tawreedss.com
-tax-assessment.com
  tax-assistant.com
  tax-assistant.info
  tax-car-dvla.com
@@ -302554,13 +295504,13 @@ tax-refund-claim.com
  tax-refund-entitled.com.nihatayshahed.ru
  tax-refundform.com
  tax-refunds.fund
+tax-repayment.com
  tax-residence.net
  tax-return-form14.com
  tax-return-service.live
  tax-returns-hmrc.com
  tax-revision.com
  tax-submit.bad.me.uk
-tax-support-uk.com
  tax-wewill.jp
  tax.hm-1ref.com
  tax.hm-ref1.com
@@ -302699,6 +295649,7 @@ tbuild.2tstelecom.com
  tbwysx.cn
  tbz.onderhost.com
  tbzgmpfqtysiqddafmfuvzwrauqsgfqcqaxu-dot-offglen.uk.r.appspot.com
+tc-eknomi-bakanligi-kayit-basvuru-form.tk
  tc-ekonomibakanligi-basvuru-formu.tk
  tc-onlinehizmetlerim.com
  tc-sosyaldestekler.ml
@@ -302728,6 +295679,7 @@ tcfeckne.firebaseapp.com
  tcfibank.com
  tcgroup.com.au
  tcha5ws.com
+tchdata0dues.com
  tcipinkbeaches.com
  tcir.topkorder.su
  tciynlrmvqbyhptuivkjdopugl-dot-gloff849483.uk.r.appspot.com
@@ -302813,7 +295765,6 @@ tdvcxwaqwfcoigfnkgbecreqxw.club
  tdvpprint.com
  tdwcocooiedpbiyudknttzjqhbvdjpbdfgru-dot-cedar-code-289917.nn.r.appspot.com
  tdxl.rogagot.com
-tdxziemxtuaqzdvcbeumdidqdenxezzpnqkb-dot-offglen.uk.r.appspot.com
  tdzy.lawapass.com
  te-group.org
  teach-in-xiamen.alex-parr.com
@@ -302980,6 +295931,7 @@ technationgroup.com
  technest.mx
  techni-survey.com
  technicaindia.in
+technical-snap-support.000webhostapp.com
  technicalakshay.com
  technicalataur.com
  technicallybnpparibasapp.tumblr.com
@@ -303115,6 +296067,7 @@ tediciady45.000webhostapp.com
  tedious-mixtures.000webhostapp.com
  tedofit.com
  tedqhswvyqkbdzvwxtclczxgmhqsboqrxlmv-dot-solar-vertex-285913.rj.r.appspot.com
+tedswoodsworkings.buzz
  tedvankoleji.com
  tedwoodworking.org
  tedzey.info
@@ -303267,6 +296220,7 @@ telhasrioclaro.com
  teliatisat.nckidirectory.gdn
  teljesfilmhd.over-blog.com
  telkom.online
+tellburnhut.com
  tellekorn.de
  telliko.com
  tellingglaucomaz.com
@@ -303373,7 +296327,6 @@ tencentajsjkskskd.dumb1.com
  tencentclaims.com
  tencentcreatebox.com
  tencenteventpubg20.000webhostapp.com
-tencentfix.com
  tencentgames.in
  tencentgames.pubgmx.com
  tencentgetfreenow.com
@@ -303385,7 +296338,6 @@ tencnets15.com
  tendailytrends.com
  tendenciasv.com
  tendentious-bands.000webhostapp.com
-tenderguidekw.com
  tenderheartfoundation.org
  tenderind.com
  tenderlovingfood.com
@@ -303436,6 +296388,7 @@ tepxjgrhglmirqlglnmsqeuxgjfjihfeiizn-dot-offglen.uk.r.appspot.com
  teqboost.com
  teqdirect.com
  tequakes.xyz
+tera-sei.co.jp
  teraconsultant.com
  teractmollaintered.xyz
  teramed.com.co
@@ -303850,6 +296803,7 @@ textless-attacker.000webhostapp.com
  textomar.net
  textopol.free.fr
  textrefwinfo.ru
+textstospeechs.buzz
  texttospeechpro.buzz
  texttospeechs.buzz
  texture-manufacture.com
@@ -304237,6 +297191,7 @@ thedad.com
  thedailyfemme.buzz
  thedailysmile.com
  thedallescountryclub.org
+thedarelite.com
  thedarkness.co.ug
  thedarksideoffreightcom.nckiregister.gdn
  thedaybehindreport.com
@@ -304480,7 +297435,6 @@ theloopfoundation.org
  thelooptravels.com
  thelordreignsministries.com
  thelostbearcabin.com
-thelostbooks.buzz
  thelostsockmiamigardens.com
  thelotteriesresults.com
  thelovemollyfund.xyz
@@ -304850,6 +297804,7 @@ thi.co.id
  thicangall.nl
  thichdirung.com
  thichdocu.com
+thickrichsay.cyou
  thicongvachnganht.com
  thieldam.buzz
  thienhi3.duckdns.org
@@ -305050,7 +298005,6 @@ three-newsinglesignin.com
  three-online.com
  three-onlinebilling.com
  three-pay-billing.com
-three-paybill.com
  three-payments.digital
  three-payments.services
  three-paymentservices.com
@@ -305175,6 +298129,7 @@ threecustomerservicefix.com
  threehelp.org
  threehelpteam.com
  threeinfo-bill.com
+threeinfo.net
  threeinfosupport.co.uk
  threekings.in
  threemenandamovie.com
@@ -305386,6 +298341,7 @@ tiffany24091990profille.club
  tiffanygftrace.com
  tiffanyjoybankhead.life
  tiffanyportugal.ru
+tiffincurry.ca
  tifftrinh.com
  tifi.ga
  tifw.goruli.com
@@ -305521,7 +298477,6 @@ timeoutshelter.org
  timeq.uz
  timercongo.com
  timesawu.xyz
-timesdial.com
  timesmold.org
  timesofconquest.icu
  timesoftimber.com
@@ -305639,7 +298594,6 @@ tipvine.site
  tiquetevirtualbp.com
  tir94wepsdxox.appspot.com
  tirawatgroup.com
-tiredpower.guru
  tirfadegem.com
  tiritadepapel.cl
  tirnotrade.com
@@ -305733,7 +298687,6 @@ tk-w.ailacabs.com
  tk.worldtreeyoga.org
  tk3m7.alnawwar.com
  tk4y.jaysbrand.com
-tkanthabd.com
  tkaystore.com
  tkcl.org
  tkcvgjszqafissjgqifguicgqzwclahheyfv-dot-cryptic-now-290917.ey.r.appspot.com
@@ -305855,6 +298808,8 @@ tmobiletickethelp.com
  tmpartners-gh.com
  tmpconsultores.com
  tmphysio.de
+tms.yenetch.com
+tmsapp.yenetch.com
  tmsc.miukuai.com
  tmsneurohealth.net
  tmt-moldova.com
@@ -306118,6 +299073,7 @@ tongdailyson.com
  tongdogiare.com
  tonghopgia.net
  tongling.yfqzdfd.com
+tongliu.info
  tongyijia365.com
  tongyuanjifenguanwang.com
  tonhfki.com
@@ -307043,7 +299999,6 @@ trcont.pw
  trcsustentavel.com.br
  trdc.goruli.com
  trdd.ml
-tre-hreiocx-maeiox-12.web.app
  treacly-pairs.000webhostapp.com
  treadball.com
  treafiosnmnsms.com
@@ -307179,6 +300134,7 @@ triathlontraining5.com
  tribal-logic-286210.uc.r.appspot.com
  tribalsignatures.com
  tribelessappalachiahun.quickwebchecker.com
+triberowwe.com
  tribratanewsbondowoso.com
  tribu-ltd.com
  tribunal.ug
@@ -307330,6 +300286,7 @@ trochoidal-move.000webhostapp.com
  trochzoposotocon.tk
  troectfl.rest
  troegs.com
+trofeum-zdobywamy.eu
  trojan13-found-system-infected.azurewebsites.net
  trojmiasto-fakty24.pl
  trojssmb.goruli.com
@@ -307863,6 +300820,7 @@ turbotax.ga
  turboterium53.com
  turboworld53.com
  turbozero.com
+turcdefrancepostinsta.000webhostapp.com
  turcomdat.com
  turdinggeresti.tk
  turhalcesuremlak.com
@@ -308661,6 +301619,7 @@ ucuzyemektarifi.com
  ucxdim.com
  ucxdis.com
  ucxdum.com
+ucxpo.com
  ucxpubg.com
  ucxuc.com
  ucycgcrjfrbawsqcxrgcrt.weebly.com
@@ -308888,6 +301847,7 @@ uk-centre3.info
  uk-claim.info
  uk-covid-19-relieve.com
  uk-dating.xyz
+uk-device-alert.com
  uk-directdebit-setup.adminit.com.au
  uk-ee-ltd.com
  uk-grantpartner.zapto.org
@@ -308897,6 +301857,7 @@ uk-hmrc-tax-refund.com
  uk-hmrclog.info
  uk-id6i6-user.com
  uk-myaccount.com
+uk-mythree-info.com
  uk-mythreeverify.com
  uk-netflixbilling.com
  uk-online-secure-server.nacedigital.cl
@@ -308907,6 +301868,7 @@ uk-prime-subscription.adminit.com.au
  uk-rebates-gov.com
  uk-ref111287.com
  uk-tax-hmrc.com
+uk-taxitloseit.com
  uk-things1.club
  uk-things2.club
  uk-things3.club
@@ -308974,6 +301936,8 @@ ukgolekduit.com
  ukgov-apply.com
  ukgov-billinginfo.com
  ukgov-billingsupports.com
+ukgov-detail.com
+ukgov-gateform.com
  ukgov-identify.com
  ukgov-services.com
  ukgov-taxreturns.com
@@ -309099,6 +302063,7 @@ ultimatelamborghiniexperience.com
  ultimatenutritiononline.com
  ultimatepointsstore.com
  ultimatesetsoft4systems2upgradegreat.pw
+ultimatesherpsprptocolsl.us
  ultimatetrading.ae
  ultistimate.casa
  ultrabesttextiles.com
@@ -309199,7 +302164,6 @@ un5pcj8j0pkyemnr3jaj8.avlto.host
  una-studios.com
  unaccpetable.publicvm.com
  unadd-newpayee.com
-unadvised-coat.aerobaticapp.com
  unagi-eu.amazon.aws-sec-ure.loseyourip.com
  unallied-stand.000webhostapp.com
  unamak.com
@@ -309343,6 +302307,7 @@ unfuzo.dogestocks.com
  ungafunkisar.se
  ungainsaid-jeopardi.000webhostapp.com
  ungalled-perforatio.000webhostapp.com
+ungifted-hatchet.000webhostapp.com
  ungraced-waxes.000webhostapp.com
  ungsvenskarna.se
  ungulate-hubs.000webhostapp.com
@@ -309633,7 +302598,6 @@ unlockall.neagoeandrei.com
  unlockbulgaria.com
  unlockchase78.com
  unlockedmyaccount.servehttp.com
-unlockflex.casa
  unlockghana.com
  unlocklimitedaccess-paypal.gleeze.com
  unlockmypypalaccnt.servehttp.com
@@ -309724,34 +302688,23 @@ unsecuredrequirement.net
  unselfishdigitalprograms--five-nine.repl.co
  unselfishroughsourcecode--five-nine.repl.co
  unsentimental-windl.000webhostapp.com
-unsf-12348883.primestockfx.net
  unsf-16794969.primestockfx.net
  unsf-19899194.primestockfx.net
-unsf-21594637.primestockfx.net
  unsf-21826219.primestockfx.net
  unsf-22355329.primestockfx.net
-unsf-22496491.primestockfx.net
  unsf-22586253.primestockfx.net
  unsf-23382497.primestockfx.net
  unsf-25671323.primestockfx.net
-unsf-25841318.primestockfx.net
-unsf-29119659.primestockfx.net
  unsf-31878483.primestockfx.net
-unsf-32535814.primestockfx.net
-unsf-33468671.primestockfx.net
-unsf-34171667.primestockfx.net
  unsf-38748378.primestockfx.net
  unsf-39379497.primestockfx.net
  unsf-41122597.primestockfx.net
  unsf-41848855.primestockfx.net
-unsf-43248541.primestockfx.net
  unsf-43381394.primestockfx.net
  unsf-43535927.primestockfx.net
  unsf-43961188.primestockfx.net
  unsf-45891274.primestockfx.net
  unsf-48933157.primestockfx.net
-unsf-51642556.primestockfx.net
-unsf-53347899.primestockfx.net
  unsf-54991935.primestockfx.net
  unsf-59118275.primestockfx.net
  unsf-59275686.primestockfx.net
@@ -309761,20 +302714,16 @@ unsf-64344351.primestockfx.net
  unsf-64676624.primestockfx.net
  unsf-65517231.primestockfx.net
  unsf-65521983.primestockfx.net
-unsf-65837234.primestockfx.net
  unsf-68318142.primestockfx.net
  unsf-73153647.primestockfx.net
-unsf-73431937.primestockfx.net
  unsf-73693964.primestockfx.net
  unsf-73967255.primestockfx.net
-unsf-74842461.primestockfx.net
  unsf-74869363.primestockfx.net
  unsf-75521955.primestockfx.net
  unsf-75743236.primestockfx.net
  unsf-76428477.primestockfx.net
  unsf-79873183.primestockfx.net
  unsf-81642894.primestockfx.net
-unsf-81728241.primestockfx.net
  unsf-84893629.primestockfx.net
  unsf-85646958.primestockfx.net
  unsf-85996473.primestockfx.net
@@ -309783,12 +302732,9 @@ unsf-87518967.primestockfx.net
  unsf-89442264.primestockfx.net
  unsf-89816676.primestockfx.net
  unsf-91715417.primestockfx.net
-unsf-92146465.primestockfx.net
  unsf-94121932.primestockfx.net
-unsf-94455778.primestockfx.net
  unsf-94672174.primestockfx.net
  unsf-96621174.primestockfx.net
-unsf-97111835.primestockfx.net
  unshadowable-hangar.000webhostapp.com
  unshadowable-reside.000webhostapp.com
  unshrinking-custodi.000webhostapp.com
@@ -309899,6 +302845,7 @@ upd-medlav.net
  upd-now.com
  upd-securedetails.co.uk
  upd.m.dodo52.com
+upd.page.link
  updaater.zapto.org
  updaateserviceonline1.is-a-chef.net
  updaetes-co-jpnetwork.xyz
@@ -309925,6 +302872,7 @@ update-amazonseo.serveirc.com
  update-aol2020.com.accaccess.com
  update-aplicativo.dxpsites.net
  update-apple-id-appstore.com
+update-appleaccount.servehttp.com
  update-appservice.servehalflife.com
  update-attnet.weebly.com
  update-bill.auto-update.network
@@ -310120,6 +303068,7 @@ updatebillingpayment.com
  updatebiteedz.com
  updatecenter-access44.com
  updatecentredepartment.weebly.com
+updatechasebank.bizgrow.host
  updatechasebankdetails.updatedomainchasebankinfo.com
  updatechaseonlinebanking.bankingserverupdate.com
  updated-3info.com
@@ -310167,6 +303116,7 @@ updatemicrosoftaccount.gear.host
  updatemy3account.com
  updatemy3secure.com
  updatemyaccounts-paypal.ooguy.com
+updatemyinfo-ee.com
  updatemypaymens.servebeer.com
  updatemyservice.kozow.com
  updatemythree-online.com
@@ -310201,6 +303151,7 @@ updates-data-co-jp.live
  updates-fb.com
  updates-info-co-jp.club
  updates-infoes-co-jp.best
+updates-infos-co-jp.surf
  updates-jp-club.pw
  updates-jp.digital
  updates-jp.life
@@ -310228,6 +303179,7 @@ updatesysteml.ddns.net
  updatetaxtermquickaccesssite09874321.fortunaseriquezas.com.br
  updateteam210.weebly.com
  updatetemp.temp.swtest.ru
+updatethree-info.com
  updatethreedetails.world
  updateti.xyz
  updatetosave.seeyouramazoncard.pw
@@ -310485,6 +303437,7 @@ urhoster.com
  uriclub.com.br
  urielheldcremations.co.za
  uriesnenaq.yushengforother01.top
+urinecutein.com
  uringvermi.at
  urist-advokat-mogilev.by
  urist-bogatyr.ru
@@ -310715,9 +303668,11 @@ user-amazon.ej0.xyz
  user-amazon.ek3.xyz
  user-amazon.ey1.xyz
  user-amazon.ey5.xyz
+user-amazon.fa29.xyz
  user-amazon.fa3.xyz
  user-amazon.fc1.xyz
  user-amazon.fc6.xyz
+user-amazon.j1u.top
  user-amazon.k1w.top
  user-amazon.l1v.top
  user-amazon.ls9.xyz
@@ -310751,6 +303706,7 @@ user-id209435.com
  user-id213i.com
  user-id214.com
  user-id215.com
+user-id216.com
  user-id2209.com
  user-id234.com
  user-id269.com
@@ -310783,6 +303739,7 @@ user-service-wells.info
  user-stop-amaznou.com.66fsd54df6.buzz
  user-temporary-account-ref182.com
  user-temporary-account.com
+user-terms0175.com
  user-terms021.com
  user-terms02347.com
  user-terms0339.com
@@ -311499,10 +304456,11 @@ validarmilhasapp.cf
  validarwebbancoestado.com
  validate-billing.com-details.click
  validate-device-uk.com
-validate-my3-account.com
  validate-my3.com
+validate-registration-uk.com
  validate-reregister.com
  validate-sbi-serverlogin-customer-verify.email
+validate-sec-details.com
  validate-secure.com
  validate.unitedboc.com
  validate.verification-secure.system-informationapp.com
@@ -311528,7 +304486,6 @@ validations-summarycheck.cf
  validations.live
  validationsystem.creatorlink.net
  validebcpzonasegurabetaviaweb.com
-validenemy.guru
  validlogin.top
  validservices.co
  valkindead.ru
@@ -312232,6 +305189,7 @@ verfiy-your-information.com
  verfiy.mobile.ref-id193.work
  verfshoponlinecom.chifanavoid.top
  verfybaddges-supports.ml
+verfyme.creatorlink.net
  verfynow.com
  verfypayment.is-a-painter.com
  verfyverifypaypalaccount.com
@@ -312391,6 +305349,7 @@ verification-halifax.com
  verification-isp-cards.com
  verification-member-paypal.giize.com
  verification-my3.com
+verification-netflix-service.ooguy.com
  verification-netflix.com
  verification-newpayee.com
  verification-newpayee.link
@@ -312533,7 +305492,6 @@ verified.connect.support.catpital1.com.karawangdigoyajng-01.com
  verified.xn--twtter-4va.com.co
  verifiedbadge-lnstagram.ml
  verifiedbadgebusiness.com
-verifiedbadgehelp-form.ml
  verifiedbadges-instagram.com
  verifiedbadgeverification.com
  verifiedbyfbk.com
@@ -312568,6 +305526,7 @@ verifikasi-mfb36.webnode.com
  verifikasi-pemblokiran-fb20.ga
  verifikasi-pemblokiran-id0.webnode.com
  verifikasi-pemblokiran003.gq
+verifikasi-pemblokiran006.cf
  verifikasi-pemblokiran006.ga
  verifikasi-pemblokiran006.ml
  verifikasi-pemblokiran007.cf
@@ -312654,6 +305613,7 @@ verify-auone.com
  verify-b-c-p.dns-cloud.net
  verify-b-c-p.perucomer.com
  verify-billing-address.jadibikin-pede.club
+verify-bluebadge.ga
  verify-breach-netflix.com
  verify-cancellogin.com
  verify-card-information-mails-7327732.santuygesre.com
@@ -312681,6 +305641,7 @@ verify-idsupport.servehttp.com
  verify-info-card.work
  verify-info.apple.com.apps-system-generated.com
  verify-infoo.com
+verify-information-secure.com
  verify-information-sign-in-customer-id-141231.com
  verify-informations.dynamic-dns.net
  verify-ing.com
@@ -312738,10 +305699,12 @@ verify-security-accountid.update-info.negrimemek.com
  verify-security.co.uk
  verify-security.myvnc.com
  verify-service001.serveirc.com
+verify-signin-account.com
  verify-suspicious-activity.ltd
  verify-taxref.com
  verify-three.ltd
  verify-threeaccount.com
+verify-threemobile.com
  verify-ukgov-service.com
  verify-ukgovrefund-service.com
  verify-unknowndevice.com
@@ -312766,7 +305729,6 @@ verify.chase.billing.info.earningwhilehome.com
  verify.chase.billing.info.ektaxconsultants.com
  verify.chase.billing.info.igualdad.cl
  verify.ddns.net
-verify.eemylogin.com
  verify.fb.unilorite.com
  verify.hmrctax-regain.com
  verify.login-3.com
@@ -312792,6 +305754,7 @@ verify.myppaccountverification.com
  verify.mypplogin.com
  verify.mypprestrictions.com
  verify.mythreeaccountlogin.com
+verify.page.paypal.com-payment.review
  verify.pavpal.webscrid-webapps2361876235.kontoludud231.com
  verify.paypailverify.com
  verify.paypal.webscrid-webapps23671863781.tempekjarane.com
@@ -312831,6 +305794,7 @@ verifyaccount-mazon.nowddns.com
  verifyaccount-ppl.camdvr.org
  verifyaccount-us.ddnsking.com
  verifyaccount-web.servehttp.com
+verifyaccountdetails-secure.com
  verifyaccountnow.is-very-evil.org
  verifyaccountonline.sytes.net
  verifyaccountpaypal.com
@@ -312853,11 +305817,15 @@ verifybluebadge.com
  verifyblueticksupports.ml
  verifyc.online
  verifycaredept.weebly.com
+verifycation-fb.ga
+verifycation-fb.ml
+verifycation-fb.tk
  verifycation-security-unlock-secure-account.marushi.life
  verifycentercare.weebly.com
  verifychase-support.ddns.net
  verifyclaim19.com
  verifycrash.mcdir.ru
+verifydetails-secure.com
  verifydevice-security.cc
  verifydfbk.com
  verifydreocredsdacc.servehalflife.com
@@ -312875,6 +305843,7 @@ verifyhelpcenter.cf
  verifyidendity-web.servehttp.com
  verifyidlocked.com
  verifyigaccount.ml
+verifyigtickform.com
  verifyimportantmail.ooguy.com
  verifying-account.manage.atasnamakita.com
  verifying-apple.com
@@ -313570,6 +306539,7 @@ vidx.4pu.com
  vidxnxxpro.cf
  vidyaanbooks.com
  vidyasadan.com
+vidzurl.com
  viebyvieby.ru
  vieclamsaigon.vn
  vieclamthanhnienquangbinh.com
@@ -313708,6 +306678,7 @@ vila-bendis.ro
  viladaran.org
  vilanovacenter.com
  vilaprea.com
+vilelaveiculos.com.br
  vilion-works.com
  villa-azzurro.com
  villa-lotta.de
@@ -313852,6 +306823,7 @@ vip.sxyc120.com
  vip.tmpubgm.com
  vip122002.000webhostapp.com
  vip163.ga
+vip18-wa.ml
  vip222.us
  vip37799.com
  vip579.cc
@@ -313882,6 +306854,7 @@ vipnetworkonline.com
  vipno.cf
  vipoutdoorsportsjapmarket.club
  vipplusavlu.com
+vippubgmobile.com
  viprealstore.su
  vipshopevent.su
  vipuldalal11221-wixsite-com.filesusr.com
@@ -313910,6 +306883,7 @@ viralgishel.2waky.com
  viralhotvideoyangbikinpenaranyuk.000webhostapp.com
  virali8.com
  viralindo.ikwb.com
+viraljapan17.otzo.com
  viralku1880.000webhostapp.com
  viralll2020.000webhostapp.com
  viralllbaru2020.000webhostapp.com
@@ -313940,6 +306914,7 @@ virgin-mediabill.com
  virgin-mediainfo.com
  virgin-mediamobile.com
  virgin-mobile-uk.com
+virgin-monthly-billing-update.com
  virgin-monthlyalerts.com
  virgin-notice.com
  virgin-overdue.com
@@ -313954,7 +306929,6 @@ virgin.updateyourdetails.com
  virginfacture.com
  virginiabedbugtreatment.com
  virginiadarc.com.br
-virginian-ground.000webhostapp.com
  virginiawarriors.com
  virginm-credit.info
  virginmedia-billing-update.com
@@ -313967,10 +306941,12 @@ virginmedia.directdebitrenewal.com
  virginmedia.manage-bill-uk.com
  virginmedia.o2auth.com
  virginmedia.renewdirectdebit.com
+virginmedia.v3rif.com
  virginmedia.yourdirectdebit.com
  virginmedia.z13.web.core.windows.net
  virginmedia65.com
  virginmediaccount.com
+virginmobile-billing-page.com
  virginmobile-online.com
  virginmobile-reaccess.com
  virginmobile-restore.com
@@ -314660,7 +307636,6 @@ vodafone-co-uk-confirm.qrstvxy.xyz
  vodafone-help.co.uk
  vodafone-secureupdates.com
  vodafone-support.update-billing.xyz
-vodafone-uberprufung.xyz
  vodafone-uk-billing.com
  vodafone.co.uk-acc.com
  vodafone.qrstvxy.xyz
@@ -314860,6 +307835,7 @@ voteforvarinder2003.000webhostapp.com
  voter1.ml
  voterapp.jamaat.org
  voterportraits.com
+votersumbag.com
  votes-xx.ru
  votesteve.us
  votetopanel.tk
@@ -315275,6 +308251,7 @@ vww.online.scotibank.com314.com
  vww.scotiabak.online12scotia.com
  vww.scotiabank.online.scotiabank.online147.com
  vww.scotiabank.online12scotia.com
+vwwvbbvaclientesenlinea.com
  vwwvbbvaoperacionespe.com
  vwyrebi.ts.r.appspot.com
  vwzkqxufdiyymmaerntttwfner-dot-gleowayel400503.uc.r.appspot.com
@@ -315615,6 +308592,7 @@ waistponcho.com
  wait-please02.blogspot.com
  waitbuzz.net
  waiter.ml
+waiterablevan.com
  waiyanphonelinn.me
  wajavxdhola.vipxz8.com
  wajibambilllhadiiahh100jtnya.ooguy.com
@@ -315631,6 +308609,7 @@ wakaa.net
  wakandatravel.com
  wakecar.cn
  wakefhryybeczizhpvazxviowowdvlxitume-dot-solar-vertex-285913.rj.r.appspot.com
+wakefraud.top
  wakeomar.net
  waksurgical.com.pk
  walakiribeachresort.com
@@ -315723,7 +308702,6 @@ wanderfullstudio.com
  wanderguidemobi.shaxiacommittee.top
  wanderinglib.top
  wanderlust-vrn.ru
-wanderlustmedia.co.za
  wandewaece.com
  wandfolien-aachen.de
  wandiwallstiker.com
@@ -316032,6 +309010,7 @@ waynencjscjsdcjlkbasm.yolasite.com
  waynes.com.br
  wayrestylephotoblog.com
  waysantande.com
+waysunis.cyou
  waytoketo.com
  waytothecity.com
  waytu-7.tk
@@ -316419,6 +309398,7 @@ web-stat.biz
  web-supportamazon.servecounterstrike.com
  web-updaterequired.servecounterstrike.com
  web-webank.com
+web-whatsapp.biz-my.cf
  web-whatsapp.checkyourprofile.com
  web-whatsapp.zyns.com
  web-whatsappjoin.itsaol.com
@@ -316666,6 +309646,7 @@ weblogin.amazon-login.new-customersid1212148.com.aznnskksac.com
  weblogin.infow-netflix.com
  weblogin.samazones.popkgaa.com
  webloginnavigator-dewebkonto.cloud
+weblogverification.com
  weblube.com.my
  weblums.weebly.com
  webmadrasa.com
@@ -317135,7 +310116,6 @@ wellness-today.online
  wellness3390.site
  wellnessbeautyhub.com
  wellnesscallllc.com
-wellnessebook.com
  wellnesslifezone.com
  wellnessscientific.com
  wellnursesmartnurse.co.za
@@ -317273,10 +310253,10 @@ wellsfargo.support.ref-id759.work
  wellsfargo.support.verfiy.ref-id745.work
  wellsfargo.system-fargo-access.mobi
  wellsfargo.verfiy.ref-id552.work
+wellsfargo.verification.ngd-builder.com.au
  wellsfargo.verify.customer-wells.work
  wellsfargocreditunion.com
  wellsfargomobilebanking.com
-wellsfargoo.serveirc.com
  wellsfargoonline.ddns.net
  wellsfargoonlinebanklng.com
  wellsfargosalerts.com
@@ -317392,6 +310372,7 @@ werneckgomes.com.br
  werner-boehm.com
  werner-loesch.de
  wernerluftartist.com
+wernerpoppbooks.com
  werqe.xyz
  wersen.com.ar
  wersiamone.xyz
@@ -317726,6 +310707,7 @@ whasapp-invite-groupjoin-sx.2waky.com
  whasapp-join.bokp.net
  whassapp.mrslove.com
  whastapbokep.bug21.com
+whastapp-join.zzux.com
  whastapp-join199.mcalias.com
  whastapp.kghosting.xyz
  whastapp18plus.v-25.com
@@ -317824,6 +310806,7 @@ whatsap-gupsbokep.grubxx.xyz
  whatsap-indonew.xxnnvv.tk
  whatsap-invite-groupberbagi8.2waky.com
  whatsap-invitex12-videos2.2waky.com
+whatsap-youtuber.ff-new1.cf
  whatsap.burik-event1.my.id
  whatsap.hol21.design
  whatsap.ionexusa.com
@@ -317869,7 +310852,7 @@ whatsapp--18.xxuz.com
  whatsapp-01.h2d.shop
  whatsapp-1.h9d.shop
  whatsapp-10.h9d.shop
-whatsapp-10928.ml
+whatsapp-1727.cf
  whatsapp-18.ikwb.com
  whatsapp-18.kozow.com
  whatsapp-18group.zzux.com
@@ -317897,6 +310880,7 @@ whatsapp-cc.tk
  whatsapp-chat-bot.ru
  whatsapp-chat-grup.americanunfinished.com
  whatsapp-chat.garenaff.org
+whatsapp-chat.yourtrap.com
  whatsapp-chatts.join-wagroup.gq
  whatsapp-free-150gb-internet.knowithindi.in
  whatsapp-gabung1.ezua.com
@@ -318124,6 +311108,7 @@ whatsapp2020.dynamic-dns.net
  whatsapp2020.us.to
  whatsapp20grup.getsviip7.com
  whatsapp23.gq
+whatsapp24.lflink.com
  whatsapp25.lflink.com
  whatsapp26.onedumb.com
  whatsapp29.lflink.com
@@ -318133,6 +311118,7 @@ whatsapp4.25u.com
  whatsapp40.lflink.com
  whatsapp49.lflink.com
  whatsapp52.lflink.com
+whatsapp65.lflink.com
  whatsapp758.hol7.shop
  whatsapp758.vipx2.shop
  whatsapp764.login-108.ml
@@ -318157,7 +311143,6 @@ whatsappbokep.xxx-wa.com
  whatsappbokep18plus.vvipxz.gq
  whatsappbokep2020.dynamic-dns.net
  whatsappbokep69grup.olyio.com
-whatsappbokepers2k20.xgrup77-invite.tk
  whatsappbokepgrup18.collect20.com
  whatsappbokepindovirall.hot1.shop
  whatsappbokepviral18plus.mrbonus.com
@@ -318614,7 +311599,6 @@ whorichacen.top
  whosemobilenumberisthis.com
  whospremiumplus.buzz
  whospremiumsplus.buzz
-whospremiumspro.buzz
  whsaatsppsxx.ezua.com
  whspiybyokejtlkspiwhurqyqfjajarbouth-dot-cryptic-now-290917.ey.r.appspot.com
  whsx.svcoding.com
@@ -318628,6 +311612,7 @@ whtsappjoingruplogin.tk
  whtsapxnnx162.dynamic-dns.net
  whtsapxnnxx.jetos.com
  whtsaztjaiauztaywnekaiauztztqhqkaozoxndbdjd.000webhostapp.com
+whtsppgrupsharemom.tk
  whtssapp.ga
  whtssapp.ml
  whxjunpwidjysarnbrlsgdwmucaybkgquyfx-dot-solar-vertex-285913.rj.r.appspot.com
@@ -318764,8 +311749,8 @@ wildcard.cleansol.lk
  wildcard.consultemerald.org
  wildcard.curetrick.com
  wildcard.daimonsartstuff.com
+wildcard.danskiptv.shop
  wildcard.dragglobal.com
-wildcard.dreamcomestrue.co.in
  wildcard.drwax.as
  wildcard.e39-dee3s-ssl.com
  wildcard.e3offices.com
@@ -318777,6 +311762,7 @@ wildcard.fleacontrolperth.com.au
  wildcard.formref109.com
  wildcard.formreturn110.com
  wildcard.gmgroupllc.co
+wildcard.grandnational.ae
  wildcard.hgps.ie
  wildcard.hostdazzle.us
  wildcard.ifms-enargeia.gr
@@ -318792,14 +311778,15 @@ wildcard.laracatesworld.com
  wildcard.laylamebel.az
  wildcard.locationbureau.com
  wildcard.m7md1.sa
+wildcard.mansurtech.com
  wildcard.mezcalunion.com
  wildcard.mls-d2-f4-sdd.com
  wildcard.motakalim.com
-wildcard.mrubens.mx
  wildcard.newsmedia77.com
  wildcard.oidjwoidj84.com
  wildcard.pawsaccesories.com
-wildcard.primestockfx.net
+wildcard.pettibuzz.com
+wildcard.phonepanda.net
  wildcard.pytsoluciones.com
  wildcard.qizx.ru
  wildcard.qxc9.su
@@ -318825,6 +311812,7 @@ wildcard.secure-d1-cdr.com
  wildcard.secure3-des22.com
  wildcard.serialsell.ir
  wildcard.shah-tech.com
+wildcard.shiraztvto.ir
  wildcard.sinilind.ee
  wildcard.spicygothic.com
  wildcard.sse0d3w.com
@@ -318838,8 +311826,10 @@ wildcard.synergyglobal.one
  wildcard.taqwalabmultan.com
  wildcard.unsion.tv
  wildcard.w3s-fd4-1q32.com
+wildcard.wp2app.io
  wildcard.wpmudev.host
  wildcard.wwdf-4d-3w.com
+wildcard.zjlions.org
  wildcatbrothersfoods.com
  wildekunstaufstoffcom.shaxiacalendar.top
  wildernesscreek.icu
@@ -319103,7 +312093,6 @@ wiramelayu.com
  wiratamaenergi.com
  wire-share.com
  wire09.000webhostapp.com
-wireabuse.guru
  wirecardbankbiz.batwoqishop.top
  wirecardbankcom.licufashion.gdn
  wirecardbankorg.nckilosangeles.gdn
@@ -319540,7 +312529,6 @@ woo.teleromwp.com
  woobwoo.ga
  wood-expert.net
  woodbridgegroup.us
-woodbus.today
  woodcraftinteriorz.com
  woodenflooringcontractors.co.za
  woodensupport.sytes.net
@@ -319748,6 +312736,7 @@ worshiper255kq.pw
  worshiphubug.com
  worshipping-yard.000webhostapp.com
  worstdeliriousglitch--five-nine.repl.co
+worstlivelypoints--five-nine.repl.co
  worth-it.app
  worureel.com
  wosecityurnmf.pw
@@ -319762,6 +312751,7 @@ wotdancenow.com
  wotheraz.com
  wotnoh.security-operations-center.de
  wouldnotchange.tk
+woundsizewar.com
  woutloo3-very9.xyz
  wovukhbwqlpscifsbjizrozvmi-dot-gleowayel400503.uc.r.appspot.com
  wow-s.at.ua
@@ -319865,12 +312855,12 @@ wptp.lianjiewuxian.com
  wpwala.net
  wpyk.jaysbrand.com
  wpyqh.app.link
+wpywgikfekfbriangfgouakygfdzxpudoykg-dot-offgl8876899977678.uk.r.appspot.com
  wq.dhhlch.work
  wq.feiniaoai.cn
  wq94t.ailacabs.com
  wqapkrgvyeco.rzf.futbol
  wqapp.50cms.com
-wqd123543.weebly.com
  wqd3f3regt.000webhostapp.com
  wqdegsyqfszmojxb-dot-glexcel1.ue.r.appspot.com
  wqdfxtkbwzsanbfpvgvp.top
@@ -319971,6 +312961,7 @@ wsadministrateurxvocalebe.yolasite.com
  wsads.weebly.com
  wsdfghjkjhgfcv.duckdns.org
  wsdshipping.com
+wsdychinese2onlyywalkaloneinlifev26mba.duckdns.org
  wsdyunitedfrkesokoriorimistreetsmwsgqp.ydns.eu
  wsecityurpqtt.pw
  wsemprecomvocescommais.com
@@ -319995,7 +312986,6 @@ wspolnemiasto.dkonto.pl
  wspolnie.com.pl
  wsqmanbetx.com
  wsquareaccount.com
-wsquareaccountw.com
  wsqy.vipsnapchatsexting.com
  wsrjobrzcgocayyonyaatdpojzbbrwpkcdif-dot-cedar-code-289917.nn.r.appspot.com
  wss.autotradingservices.com
@@ -320195,7 +313185,9 @@ wvw.online.scotiabank.inverlat10.com
  wvw.online.scotiabank.inverlat3.com
  wvw.online.scotiabank.scotiaweb.folio690.com
  wvw.online.scotibank.690folio.com
+wvw.zonasegurabn1-bm-conr-pe.xyz
  wvwbanca-falalbellas.com
+wvwchase.com.request.online.system.number.2155-chase.buzz
  wvwhegcdqvskeiwvhxxrlmjuhf-dot-gloff849483.uk.r.appspot.com
  wvwv-cdek.ru
  wvwzonasegurasbn1.com
@@ -320545,6 +313537,7 @@ www-smbc-co-card.support-login-mx-update-info.monster
  www-smbco-cards.account-to-login-page-mannege.monster
  www-ssagov-site-signin-en.duckdns.org
  www-supportuser245.servehttp.com
+www-t-online-de.logomultitech.co.za
  www-tottapt.com
  www-trcimer-vatandasiade.com
  www-updateas-co-jpshop.xyz
@@ -321184,6 +314177,7 @@ xgadgetshub.com
  xgbdimdhrjavydbtqvynjkvsaa-dot-gleowayel400503.uc.r.appspot.com
  xgcgonngl.com
  xgeneroyale.com.my
+xgetskinspubgm.duckdns.org
  xgfi.handipants.com
  xgflepvdibpnubdwgwurzhtxupozcsrlpgjv-dot-cedar-code-289917.nn.r.appspot.com
  xggcasex.fun
@@ -321530,6 +314524,7 @@ xn--80aafuec2bqq9b9f.049.xn--p1acf
  xn--80aajiaapeyhqdbo9bk.xn--p1acf
  xn--80aanufcfzcs6l.xn--p1ai
  xn--80abnk0a8a0ga.xn--p1ai
+xn--80abry5d5adr.xn--p1ai
  xn--80acqice7a1fyb.xn--p1ai
  xn--80acsxc1bsk4c.xn--p1ai
  xn--80adafaiy2bcy.xn--p1acf
@@ -321543,6 +314538,7 @@ xn--80ajahcbcdpeycafhi6j5d.xn--p1ai
  xn--80ajcz5a1dp.xn--p1ai
  xn--80akackgdchp7bcf0au.xn--p1ai
  xn--80al0adb1gd.xn--p1ai
+xn--80al2ad9fa.xn--p1ai
  xn--80alhj1flq.xn--p1ai
  xn--80apaabfhzk7a5ck.xn--p1ai
  xn--80atlp0a2b.xn--p1ai
@@ -321550,6 +314546,7 @@ xn--90ac2chmif6a.xn--p1ai
  xn--90achbqoo0ahef9czcb.xn--p1ai
  xn--90afdnal1aqq.xn--p1ai
  xn--90alilwsw2b.xn--p1ai
+xn--90aoxpf7ca.xn--p1ai
  xn--90avpa.xn--p1ai
  xn--accweb-muv-desjardns-s9c36d.com
  xn--acsso-pagseguro-cnb.com
@@ -321560,6 +314557,7 @@ xn--avyfedera-yubm.org
  xn--b1aad1boi0bn.xn--p1ai
  xn--b1ab8ad9cakoh.xn--p1ai
  xn--b1ad0cg5c.xn--p1ai
+xn--b1ae4anea1a.xn--p1ai
  xn--b1agpzh0e.xn--80adxhks
  xn--b1alaggrfb0ah6h.xn--p1ai
  xn--b1alcw1acc0h.xn--p1ai
@@ -321596,6 +314594,7 @@ xn--c1agw5au.xn--p1ai
  xn--c1ajbsbed5a5a.xn--p1acf
  xn--c1ajdef2ap0b3b.xn--p1ai
  xn--c1alh7bf.xn--p1ai
+xn--c1aoa1d0a.xn--p1ai
  xn--c3ca7brwp8cb5a8bdr7kqe.com
  xn--celegeninaat-dnc.com
  xn--cinfcccmug-rbbebb.azurewebsites.net
@@ -321604,6 +314603,7 @@ xn--clinicatraa-beb.com
  xn--cloud-9nc.com
  xn--covid19-gncelsalgnvakalar-nwc35l.com
  xn--d1aaf6amv0b3ag.xn--p1ai
+xn--d1aauys3anw.xn--p1ai
  xn--d1ad1aopfr7a.xn--p1ai
  xn--d1aejw8a.xn--p1ai
  xn--d1ahebikdfcgr7jsa.xn--p1ai
@@ -321623,7 +314623,6 @@ xn--elctrum-u8a.com
  xn--evdekalan20gbkapyor-v5c.com
  xn--exods-nva.io
  xn--facebok-dati-shb.com
-xn--facebook-v0e.com-27651506516510546.top
  xn--faktygwat-xub.com.pl
  xn--faktygwat-xub.eu
  xn--faktygwat-xub.net.pl
@@ -321654,12 +314653,14 @@ xn--iconiqcaptal-0fb.com
  xn--id-zb4axila5esc1e1f9bvhzd4a6fe.sehvcnx.com
  xn--insagram-tj0d.com
  xn--instagrm-g0a.com
+xn--j1ajjdnwn.xn--p1ai
  xn--j1amlkqjl.xn--p1ai
  xn--js0bt1bly1ak6e.com
  xn--k1aee3bajcam.xn--p1ai
  xn--krakn-ksa.com
  xn--l1aavcxwv.xn--p1ai
  xn--l1abbv5d.xn--p1ai
+xn--l1adksn.xn--p1ai
  xn--lcalbtcins-d8a7982gha.com
  xn--lcalbtcons-o8ad3e.net
  xn--lck1a7a1gxgc4847elyua.xyz
@@ -321714,6 +314715,7 @@ xn--orw0a8690a.com
  xn--pacincia-xl-qbb.com
  xn--pof-5icbb.gq
  xn--polskagwat24-lcc.eu
+xn--prinote-kf4c.com
  xn--privnot-8xa.com
  xn--privnot-g9a.com
  xn--privnot-hya.com
@@ -321730,7 +314732,6 @@ xn--rakutn-tva.co.jp.wmlcsw.cn
  xn--rihy934p.ws
  xn--rippe-y6a.com
  xn--rippl-r51b.com
-xn--rolbnk-xc8bc66e.com
  xn--rssv39a.shop
  xn--rumung-bua.online
  xn--ruqumz1h0h.com
@@ -322166,6 +315167,7 @@ xvobvgcssb.com
  xvovdo.info
  xvpekehxabvcjjbccbeczrmvlrkxyflivxfp-dot-cedar-code-289917.nn.r.appspot.com
  xvryzmvujncutjtcbncczsvbfkug.top
+xvybvdtzgxdnvpnfgc.top
  xvyqdzolopftcndxyzxzxaknzegttknugoie-dot-solar-vertex-285913.rj.r.appspot.com
  xvzcbxwwzsbzpotvvzfhnsnyis-dot-gleowayel400503.uc.r.appspot.com
  xw.xxuz.com
@@ -322359,6 +315361,7 @@ y-7f.drofortho.com
  y-7zm.jaysbrand.com
  y-archive.com
  y-mhe.svcoding.com
+y-runescape.com.ua
  y-ta.mentriqq.com
  y-yahhooaccount.weebly.com
  y.genovesevanderhoof.com
@@ -322523,6 +315526,7 @@ yahoobellsouth.weebly.com
  yahoocommunicationslinkverifiedlinknow2020.weebly.com
  yahoocoooujkkyahcom.weebly.com
  yahoodesksupport.weebly.com
+yahoodomainservicee.weebly.com
  yahooimail.weebly.com
  yahooinc.admindomainserveronline.tpnggroup.com
  yahoolkwfwywfqdq.weebly.com
@@ -322614,10 +315618,12 @@ yahoosupport00xx55789.weebly.com
  yahoosupportmailcom.weebly.com
  yahoosupportxxmail.weebly.com
  yahoosyste.weebly.com
+yahootea.weebly.com
  yahooteamauthority.weebly.com
  yahooteamupgradedservice.weebly.com
  yahoounlimitedmail.weebly.com
  yahooupdateeeeeee.weebly.com
+yahooupdatereview.weebly.com
  yahooverificatiom.weebly.com
  yahooverificationatt.weebly.com
  yahooverificationupdateservice.weebly.com
@@ -322863,6 +315869,7 @@ ydconsultant.com
  yddgh.aiquna.com.cn
  yddhmu.com
  ydefz.mentriqq.com
+ydf774766fygrbehf.web.app
  ydftpyayqcgxqnnkcddc.top
  ydgrs.xyz
  ydhds.xyz
@@ -323289,6 +316296,7 @@ yodmpdy.cf
  yodobashi0549.xyz
  yodobashioaq.top
  yodobashipla.top
+yodobaxi.co.jp.asdnnene.xyz
  yoeoysmotyheman.club
  yofdyk.com
  yoffc.com
@@ -323444,6 +316452,7 @@ youngsportsman.buzz
  younqone.com
  youperutravel.com
  youqudeshi.com.cn
+your-3id.com
  your-account-apple-hass-been-update.giize.com
  your-account-apple-update-111-186341718433199.com
  your-accout-locked.theworkpc.com
@@ -323456,7 +316465,6 @@ your-help24.com
  your-online-ee-bill.000webhostapp.com
  your-revision.com
  your-textile.com
-your.doitnow20.icu
  your3.co.uk
  your3zv-are4y4vxncj-m534ago3klz.odiamauversiculo.com
  youraccountverify.ml
@@ -323847,7 +316855,6 @@ yunshangwl.vip
  yunsushu.com
  yuntong-batt.co
  yunusobodmdo.uz
-yunwu.sx
  yuofhhitdnqknrrcdqgkubrkrtandwhkthaa-dot-cryptic-now-290917.ey.r.appspot.com
  yuofootpt.com
  yuomzoxvwaykxvcxrabxdpiiwjxgnykuqtyi-dot-offglen.uk.r.appspot.com
@@ -323960,10 +316967,12 @@ yxzwuv8sdx9aysrhh.ambi.cc
  yy-x.mentriqq.com
  yy13041.moonfruit.com
  yy29398899.com
+yy4yyyyyyyyyyyyyyyy444.000webhostapp.com
  yy6262.com
  yy73gaa.al1av.com
  yy7yu.al1av.com
  yyadmin.xyz
+yyblxalgbqzoqakxuzwcvfewwjxxpcpyqriq-dot-offgl8876899977678.uk.r.appspot.com
  yyce.goruli.com
  yyd-6.porkaspk.com
  yydabfnctw.top
@@ -324233,7 +317242,6 @@ zantlimas.com
  zanuda.info
  zanussialamia.com
  zanzoul.aya.com.sy
-zaocdingle.wang
  zaodw.handipants.com
  zaometallosnab.ru
  zaoyuanhong.com
@@ -324283,7 +317291,6 @@ zap593440-1.plesk09.zap-webspace.com
  zap596330-1.plesk11.zap-webspace.com
  zap611319-2.plesk13.zap-webspace.com
  zap612470-1.plesk10.zap-webspace.com
-zap612598-1.plesk10.zap-webspace.com
  zap613258-1.plesk13.zap-webspace.com
  zap613258-2.plesk10.zap-webspace.com
  zap613408-1.plesk10.zap-webspace.com
@@ -324541,7 +317548,6 @@ zen-wilson-5f6257.netlify.app
  zenaddevis.com
  zenben.site
  zenblueeds.ru
-zenbpfucba.wang
  zencarthelper.com
  zencb.com
  zendegieziba.com
@@ -324728,7 +317734,6 @@ zhaoqingqinzi.com
  zhaoyouxiu.com
  zhaozewei.top
  zhasoral.kz
-zhataifgua.wang
  zhaw-ch.yolasite.com
  zhcbao.com
  zhcy.jaysbrand.com
@@ -324740,6 +317745,7 @@ zhengping.winmail01.cn
  zhengshi.winmail01.cn
  zhengtian.winmail01.cn
  zhenjiang.06rl.com
+zhenjiang.yfqzdfd.com
  zhenlongyulecheng.tavmo.com
  zhenrenbaijiale.tavmo.com
  zhetysu360.kz
@@ -324804,6 +317810,7 @@ zhzy999.net
  zi-1.icu
  zi-3-gporange1.free.builderall.com
  zi-chem.co
+ziabac.com
  zian-vlad-cri.com
  zibeline-felt.000webhostapp.com
  zibofu.com
@@ -324867,7 +317874,6 @@ zimbra.blackberet.com.pk
  zimbra0301j.000webhostapp.com
  zimbra152-ind.megavelocity.net
  zimbra1x.weebly.com
-zimbra990.000webhostapp.com
  zimbraadmincl.weebly.com
  zimbracollectionlinkpg.000webhostapp.com
  zimbradportal.000webhostapp.com
@@ -325028,6 +318034,7 @@ zlynmtymqhcoxhpbdjzcukyneisngsofwczb-dot-cryptic-now-290917.ey.r.appspot.com
  zlyqhzosjfqouknoawbnwhsncekylslxcgra-dot-solar-vertex-285913.rj.r.appspot.com
  zmadcfhptgfwatkuxt.top
  zmailserv19fd.world
+zmb8ny-adi9.com
  zmbr-278921.rj.r.appspot.com
  zmbras.com
  zmclearance.com
@@ -325187,6 +318194,7 @@ zonasegura-1bn-corn.tk
  zonasegura-1bn-pe.online
  zonasegura-bcpinisiasecionenlineape.com
  zonasegura-bnv1-corn-pe.online
+zonasegura-canaldigitalbn1.com
  zonasegura-dns1webn.com
  zonasegura-dnsweboperacion.com
  zonasegura-via.bcpsms.net
@@ -325293,6 +318301,7 @@ zonasegurainisaenwebreactivemosjuntoselperu.com
  zonasegurainisiaenwebjuntosreactivemoselperu.com
  zonasegurainisiaenwebreactivaelperu.com
  zonasegurainisiaseionenwebreactivaperu.com
+zonasegurainisiasesionjuntosreactivemoslasmypes.com
  zonasegurainisiasesionsereactivoelperu.com
  zonasegurainisiasesionwebreactivape.com
  zonaseguralasmypeenlineareactivaelperu.com
@@ -325487,6 +318496,7 @@ zq39r.oujevais.com
  zq9z.awaykart.com
  zqajgssospkiqwlxcnrwmzrwwciqztnzmqaj-dot-solar-vertex-285913.rj.r.appspot.com
  zqajgssospkiqwlxcnrwmzrwwciqztnzmqaj.solar-vertex-285913.rj.r.appspot.com
+zqbbkpqvhrffcpzwjj.top
  zqbhe.goruli.com
  zqctkotaxtozmegedwgr.top
  zqeduamazon.icu
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index ab3c717a7acabbb42c693fa66b25527a66582699..cb084c7099b24d3c8dac21ed61c771e12b727653 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -1,13 +1,107 @@
  0i.is/7Tr9
  0i.is/CpAq
  0i.is/IqWc
-1.34.209.99/.i
-107.175.0.104/xman999111000/DAYUMitsKKKAAATTTAAANNNAAA.arm
-107.175.0.104/xman999111000/DAYUMitsKKKAAATTTAAANNNAAA.arm7
-117.196.49.183/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
  123formbuilder.com/form-5559915/microsoft-team
+144.172.75.76/F3DsG0TM3.arm4
+144.172.75.76/F3DsG0TM3.arm5
+144.172.75.76/F3DsG0TM3.arm6
+144.172.75.76/F3DsG0TM3.arm7
+144.172.75.76/F3DsG0TM3.i586
+144.172.75.76/F3DsG0TM3.i686
+144.172.75.76/F3DsG0TM3.m68k
+144.172.75.76/F3DsG0TM3.mips
+144.172.75.76/F3DsG0TM3.mpsl
+144.172.75.76/F3DsG0TM3.ppc
+144.172.75.76/F3DsG0TM3.sparc
+144.172.75.76/F3DsG0TM3.x86
+144.208.127.226/bins/Hilix.arm5
+144.208.127.226/bins/Hilix.arm6
+144.208.127.226/bins/Hilix.mips
+144.208.127.226/bins/Hilix.mpsl
+144.208.127.226/bins/Hilix.ppc
+144.208.127.226/bins/Hilix.sh4
+144.208.127.226/bins/Hilix.x86
+144.91.109.34/a-r.m-4.Re.Ming.Ton.
+144.91.109.34/a-r.m-6.Re.Ming.Ton.
+144.91.109.34/i-5.8-6.Re.Ming.Ton.
+144.91.109.34/m-6.8-k.Re.Ming.Ton.
+144.91.109.34/m-i.p-s.Re.Ming.Ton.
+144.91.109.34/m-p.s-l.Re.Ming.Ton.
+144.91.109.34/p-p.c-.Re.Ming.Ton.
+144.91.109.34/s-h.4-.Re.Ming.Ton.
+144.91.109.34/x-3.2-.Re.Ming.Ton.
+144.91.109.34/x-8.6-.Re.Ming.Ton.
+145.239.139.22/a-r.m-4.RAZA
+145.239.139.22/a-r.m-5.RAZA
+145.239.139.22/a-r.m-6.RAZA
+145.239.139.22/a-r.m-7.RAZA
+145.239.139.22/i-5.8-6.RAZA
+145.239.139.22/m-6.8-k.RAZA
+145.239.139.22/m-i.p-s.RAZA
+145.239.139.22/m-p.s-l.RAZA
+145.239.139.22/p-p.c-.RAZA
+145.239.139.22/s-h.4-.RAZA
+145.239.139.22/x-3.2-.RAZA
+145.239.139.22/x-8.6-.RAZA
+147.135.115.229/a-r.m-4.SNOOPY
+147.135.115.229/a-r.m-5.SNOOPY
+147.135.115.229/a-r.m-6.SNOOPY
+147.135.115.229/a-r.m-7.SNOOPY
+147.135.115.229/i-5.8-6.SNOOPY
+147.135.115.229/m-6.8-k.SNOOPY
+147.135.115.229/m-i.p-s.SNOOPY
+147.135.115.229/m-p.s-l.SNOOPY
+147.135.115.229/p-p.c-.SNOOPY
+147.135.115.229/s-h.4-.SNOOPY
+147.135.115.229/x-3.2-.SNOOPY
+147.135.115.229/x-8.6-.SNOOPY
  173.82.129.194/ap/signin
-188.165.179.58/SBIDIOT/m68k
+179.98.2.93/.i
+185.239.242.193/bns/gang123isgodloluaintgettingthesebinslikedammwtf.arm5
+185.239.242.193/bns/gang123isgodloluaintgettingthesebinslikedammwtf.arm7
+185.239.242.193/bns/gang123isgodloluaintgettingthesebinslikedammwtf.mpsl
+185.239.242.193/bns/gang123isgodloluaintgettingthesebinslikedammwtf.ppc
+185.239.242.193/bns/gang123isgodloluaintgettingthesebinslikedammwtf.sh4
+185.239.242.51/armv4l
+185.239.242.51/armv5l
+185.239.242.51/armv6l
+185.239.242.51/i586
+185.239.242.51/i686
+185.239.242.51/m68k
+185.239.242.51/mips
+185.239.242.51/mipsel
+185.239.242.51/powerpc
+185.239.242.51/sh4
+185.239.242.51/sparc
+185.239.242.51/x86
+185.239.242.83/beastmode/b3astmode.arm
+185.239.242.83/beastmode/b3astmode.arm5
+185.239.242.83/beastmode/b3astmode.arm6
+185.239.242.83/beastmode/b3astmode.arm7
+185.239.242.83/beastmode/b3astmode.m68k
+185.239.242.83/beastmode/b3astmode.mips
+185.239.242.83/beastmode/b3astmode.mpsl
+185.239.242.83/beastmode/b3astmode.ppc
+185.239.242.83/beastmode/b3astmode.sh4
+185.239.242.83/beastmode/b3astmode.x86
+191.235.65.153/apache2
+191.235.65.153/cron
+191.235.65.153/ftp
+191.235.65.153/ntpd
+191.235.65.153/nut
+191.235.65.153/openssh
+191.235.65.153/pftp
+191.235.65.153/sh
+191.235.65.153/sshd
+191.235.65.153/tftp
+191.235.65.153/wget
+192.145.239.221/~sunsit5/mps2020/
+192.145.239.221/~sunsit5/mps2020/a1b2c3/1675ebddc32062f5c6c5a718c3b9841d/login/
+193.239.147.40/Corret/C0rret.arm
+193.239.147.40/Corret/C0rret.arm7
+193.239.147.40/Corret/C0rret.m68k
+193.239.147.40/Corret/C0rret.mpsl
+193.239.147.40/Corret/C0rret.ppc
  198.46.249.201/389242390482/azhure.arm
  198.46.249.201/389242390482/azhure.arm5
  198.46.249.201/389242390482/azhure.arm6
@@ -19,9 +113,41 @@
  198.46.249.201/389242390482/azhure.sh4
  198.46.249.201/389242390482/azhure.x86
  1drv.ms/xs/s
+206.81.24.199/6998/6997/Home
+206.81.24.199/6998/6997/Home/login.php
  218.92.77.242/.i
  221.15.12.6/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+23.125.186.135/.i
+2kt.268sbc.com/627
  37.34.206.54/.i
+37.46.150.204/Snoopy.arm4
+37.46.150.204/Snoopy.arm5
+37.46.150.204/Snoopy.arm6
+37.46.150.204/Snoopy.mips
+37.46.150.204/Snoopy.mpsl
+37.46.150.204/Snoopy.ppc
+37.46.150.204/Snoopy.sparc
+37.46.150.204/Snoopy.x86
+37.46.150.221/bins/nigga.arm
+37.46.150.221/bins/nigga.arm5
+37.46.150.221/bins/nigga.arm6
+37.46.150.221/bins/nigga.arm7
+37.46.150.221/bins/nigga.m68k
+37.46.150.221/bins/nigga.mips
+37.46.150.221/bins/nigga.mpsl
+37.46.150.221/bins/nigga.ppc
+37.46.150.221/bins/nigga.sh4
+37.46.150.221/bins/nigga.spc
+37.46.150.221/bins/nigga.x86
+45.153.203.104/bins/sora.arm5
+45.153.203.104/bins/sora.arm6
+45.153.203.104/bins/sora.m68k
+45.153.203.104/bins/sora.mips
+45.153.203.104/bins/sora.mpsl
+45.153.203.104/bins/sora.ppc
+45.153.203.104/bins/sora.sh4
+45.153.203.104/bins/sora.x86
+45.153.203.104/sora.mips
  45.95.168.121/apache2
  45.95.168.121/bash
  45.95.168.121/cron
@@ -37,6 +163,25 @@
  4g3.cc/www.bancolombia.com/personas/sucursalpersonas.transaccionesbancolombia.com
  4g3.cc/www.bancolombia.com/personas/sucursalpersonas.transaccionesbancolombia.com/
  4g3.cc/www.bancolombia.com/personas/sucursalpersonas.transaccionesbancolombia.com/mua/USER/
+51.89.124.171/bins/sora.arm
+51.89.124.171/bins/sora.arm5
+51.89.124.171/bins/sora.arm6
+51.89.124.171/bins/sora.arm7
+51.89.124.171/bins/sora.m68k
+51.89.124.171/bins/sora.mips
+51.89.124.171/bins/sora.mpsl
+51.89.124.171/bins/sora.ppc
+51.89.124.171/bins/sora.sh4
+51.89.124.171/bins/sora.x86
+60.251.45.100/.i
+61.246.32.180/.i
+69.118.184.208/.i
+69.51.24.27/DTLEP.exe
+69.51.24.27/IntelHAXM.exe
+73.170.128.14/.i
+77.73.69.79/opza/holydami.exe
+78.188.70.85/.i
+78.189.30.116/.i
  79.143.24.190/warzone/warzone.arm
  79.143.24.190/warzone/warzone.arm5
  79.143.24.190/warzone/warzone.arm6
@@ -47,20 +192,55 @@
  79.143.24.190/warzone/warzone.ppc
  79.143.24.190/warzone/warzone.sh4
  79.143.24.190/warzone/warzone.x86
+8641223.com/phplive
+8641223.com/phplive/phplive.php
+92.42.45.227/SBIDIOT/arm6
+92.42.45.227/SBIDIOT/m68k
+92.42.45.227/SBIDIOT/mips
+92.42.45.227/SBIDIOT/mpsl
+92.42.45.227/SBIDIOT/ppc
+92.42.45.227/SBIDIOT/root
+92.42.45.227/SBIDIOT/rtk
+92.42.45.227/SBIDIOT/sh4
+92.42.45.227/SBIDIOT/spc
+92.42.45.227/SBIDIOT/x86
+92.42.45.227/SBIDIOT/yarn
+92.42.45.227/SBIDIOT/zte
+a8marketing.com.br/adm
+a8marketing.com.br/adm/aspx.php
+aanqylta.com/27/22/c2/2722c2a5b203af3017cc81716e34cee8.js
+abbeyroadmoron.com/fonts/Covid-19/ali1/ali
+abbeyroadmoron.com/fonts/Covid-19/ali1/ali/login.php
  abre.ai/as0p
  abre.ai/bLoA
  abre.ai/caixacx
  abre.ai/seguranca-app
  access.cloudserver330.com/s5tg3bji20apdo8y
  accounts-updates-co-jp.yoga/pc
+accountvianet-ca.eu/livraison/sws/post/manage/
+accountvianet-ca.eu/livraison/sws/post/manage/sms
+accountvianet-ca.eu/livraison/sws/post/manage/sms/sms2.php
+activacion-bcpperu.spb.ru/iniciar-sesion/
+activationaccess.be/ing
+adammarkanovic.com/AMERY%20Wirtshafter%20square
+adammarkanovic.com/AMERY%20Wirtshafter%20square/
+adastravanlines.com/signin
+adastravanlines.com/signin/mzy2i=
+adisekar.com/J.W-TRADING-COMPANY-PO/EXCEL
+adisekar.com/J.W-TRADING-COMPANY-PO/EXCEL/
+agrarimmo24.com/etisalawith
+agrarimmo24.com/etisalawith/index.php
+ahavaukraine.com/catalog/language/ee/redirect-new.php
+aksharapratishthan.org/./galemtss/
+aksharapratishthan.org/./galemtss/operacion-exitosa.html
  allowcopy.com/open
  allowcopy.com/open/
  almataquimica.com.br/home
-amazonlogistics.eu/ap/signin
  ambusinescompany.com/mazon
  ambusinescompany.com/mazon/89081
  americanas-aamais.redirectme.net/compre/tv/samsung
  americanas-aamais.redirectme.net/compre/tv/samsung/carrinho.php
+americanas-aamais.redirectme.net/compre/tv/samsung/carrinho.php/
  ams3.digitaloceanspaces.com/ams1
  ams3.digitaloceanspaces.com/ams1/click.html
  ams3.digitaloceanspaces.com/newvm
@@ -72,15 +252,25 @@ aprendeamanejar.mx/on
  aprendeamanejar.mx/on/index.php
  artasiaimports.com/wellsfargo/wellsfargodoclogcheckbeeeadsissvhalogein/WellsFargo/wells
  artasiaimports.com/wellsfargo/wellsfargodoclogcheckbeeeadsissvhalogein/WellsFargo/wells/wells.htm
-aspdwe-71.cf/0nfile/0nfile/oneddrive/login-option.php
+asksro.ru/uploads
+asojournerproject.com/ionos/1&1/source
+auto-suchen-mobile.de/fahrzeuge.details/dealer-admin/305776303/
+auto.amv.market/https
+autoklinica.ru/Anfrage435349829839894invoicerouteacctpagetype584858484444448500754353454353454073949534543543539933388488388488583884-redacted
+bachridemanagecusto.ddnsking.com/signin/customer_center/customer-idpp00c148/myaccount
  bankteam.azurefd.net/teams
+bankteam.azurefd.net/teams/
  bcicplus.com/vendor/phpunit/php-token-stream/src/Token/
  bcpizonasegura.com/iniciar-sesion
  bcpzonasegurabeta.hendrik-wijaya.com/app/template
  bcpzonasegurabeta.hendrik-wijaya.com/app/template/login/waiting.php
  bhlhockey.com/Inv/
+bigskytheatre.com/sms/ev/secure
  bio-greene.com/css/Amazon/
  bio-greene.com/css/Amazon/8ed13
+bio-greene.com/css/Amazon/de2e7/
+biolinky.co/legendarycontract
+biolinky.co/luckyxspin
  bit.do/EN9NET
  bit.do/Help-Recovery-Page
  bit.do/Hiosene
@@ -95,6 +285,9 @@ bit.do/Recovery-Pages-Verified
  bit.do/Sop977
  bit.do/Sunotos100B
  bit.do/SupuRs
+bit.do/TosaRs
+bit.do/Toso_Osrs
+bit.do/Vepi94Rs
  bit.do/VupaRs3_
  bit.do/bcefemxxreeglbi
  bit.do/clik-to-confirm
@@ -266,6 +459,7 @@ bit.ly/3dwP47E
  bit.ly/3dz5vzQ
  bit.ly/3e0ja3l
  bit.ly/3e1gqUl
+bit.ly/3eKdpZc
  bit.ly/3eoKad8
  bit.ly/3et0kmh
  bit.ly/3fCvze2
@@ -298,20 +492,22 @@ bit.ly/3kJVa8D
  bit.ly/3kmcdfJ
  bit.ly/3koQf49
  bit.ly/3l15oRs
-bit.ly/3lhd6r0
  bit.ly/3lsusld
  bit.ly/3lvHSNF
  bit.ly/3m4oE1w
  bit.ly/3npF3xp/
+bit.ly/3pvPGRe
  bit.ly/Actualiza-ViaBcp
  bit.ly/Atualizar-SMS-iToken
  bit.ly/BCP_Validar
  bit.ly/Banco-Mps
  bit.ly/Covind19
  bit.ly/Itaucartoes
+bit.ly/MPS-IT
  bit.ly/MontePaschiSPA
  bit.ly/Soporte-ViaBCP
  bit.ly/TOKEN1bn
+bit.ly/VERIFICA-SICUREZZA
  bit.ly/ValidaAqui_BCP
  bit.ly/agrocoel
  bit.ly/betgramlogin
@@ -335,21 +531,35 @@ bitly.com/3kXAhXj
  bitly.com/3oFHKMQ
  bitly.com/3p4HWWh
  bitly.com/PAYPAL-LOGIN-IL
+bity.live/L84y2U/
+bjd58.com/live
  blinusa.com/css/.sass-cache/bc654b16d8b7edef920aa45f6769552f95f3b862/noreply/check.account.details/14774410securebilling/mi/index/web
  bpoled.com/ff4163ad5247de3000/424_202.75.60.160_27_34.237.113.113/143390354_2913475_9370
  buildingvibes.com/cgi-wp
  cakeurl.com/sw3zY
+camilamlg.com/SCBTN/
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
+cart33.dyndns.dk/new/admin/abab2f367b67fcff7fffd9ffcc15a38e/
  casacamino.com.ar/mail/
  casaemaus.com.mx/backup/tracking
  casaemaus.com.mx/backup/tracking/tracking.php
+cashapp.supportsummarrycenters2.com/confirm/pin
  chakdoix.com/mazon/c5862/
-chefslight.com/ls0vzf.pdf
+charmingspa.com/york
+charmingspa.com/york/35.php
+chinahitop.com/index.asp
  chl0e.com/ehub36/
+chrvojeengineering.com/NovaScotia/online/authentication
+chrvojeengineering.com/NovaScotia/online/authentication/authentication.htm
+civolonstione.tech/worlds-news3/
  cloudfreespace.net/landing/form/d1116bc1-f5d8-4c53-9ed6-d31172a401e2
  confirm-transfer-reference11772.com/lloyds
  confirm-transfer-reference11772.com/lloyds/Login.php
  copy-pasted-link.com/www.ebay.co.uk/itm/view/1288730198812/
+copyright-appealhelp.com/portal
+copyright-appealhelp.com/portal/email.php
+copyright-appealhelp.com/portal/login.php
+copyright-support-help-service.ml/form/634589147/
  corporateaib.com/absa/digital
  corporateaib.com/absa/digital/1login.php
  corporateaib.com/absa/digital/login.php
@@ -361,7 +571,11 @@ cortinasrollerazteca.cl/ww/secure.connect/auth.present/ea037c6e33582d13b5b71f516
  cortinasrollerazteca.cl/ww/secure.connect/auth.present/ea037c6e33582d13b5b71f516a8b261f/001.php
  cortinasrollerazteca.cl/ww/secure.connect/auth.present/ea037c6e33582d13b5b71f516a8b261f/002.php
  cortinasrollerazteca.cl/ww/secure.connect/auth.present/ea037c6e33582d13b5b71f516a8b261f/First-page/
+cost.visionplusapps.com/vendor/phpunit/phpunit/src/Util/PHP/Services
+cost.visionplusapps.com/vendor/phpunit/phpunit/src/Util/PHP/Services/index.php
  covid19obstructor.com/WI/new
+crossfitcbdoil.com/database/mail.outlookoffice365.com.html
+cryptousagroup.com/viabcp.en.linea/bcp.com/iniciar-sesion
  cutt.ly/1gKqWom
  cutt.ly/QiCMqtb
  cutt.ly/SsyhHnk
@@ -376,10 +590,17 @@ cutt.ly/ldTGuAB
  cutt.ly/tsqb6ai
  cutt.ly/vsqbVMI
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
+d.powerofwish.com/pm.sh
+ddl.okgoodmobi.com/admin201506/uploadApkFile/rt/20180504/
  deethemogul.com/LInkedinSignin/
  demo.dbstrony.pl/z21cq4pn.pdf
  dentistatucuruvi.com.br/AWS/Account/Login/amazon
  dentistatucuruvi.com.br/AWS/Account/Login/amazon/signin.php
+dev.ladoq.ca/misc/ui/onlineservices-svbc30dch
+dev.ladoq.ca/misc/ui/onlineservices-svbc30dch/acct.php
+dev.ladoq.ca/misc/ui/onlineservices-svbc30dch/email.php
+dev.ladoq.ca/misc/ui/onlineservices-svbc30dch/emaila.php
+dev.ladoq.ca/misc/ui/onlineservices-svbc30dch/login.php
  dih.gov.al/reth-nesh
  dk.concreteservicestulsa.com/grace/EXEL
  dlvr.it/RXVbg3
@@ -394,6 +615,7 @@ docs.google.com/forms/d/e/1FAIpQLScVPF75E3HWJ1ve7FZxnlYTgY_651wK-pFFTuoil-7JW6ey
  docs.google.com/forms/d/e/1FAIpQLScVwiTxBbW4HZx3G5z8V2sEoO38E1m-1fcGaiI9_b7Adj38WQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSclGxrjBl7Eq_CpA2HX7MEZoWJFv5Bfi0weDU-DvrWOqxv0GQ/viewform
  docs.google.com/forms/d/e/1FAIpQLScpAEx3-dIDverXJtXmiU9jHq_DH2gXs2hk28T-ZO0Oj_rvBQ/viewform
+docs.google.com/forms/d/e/1FAIpQLScqMUkEcmTMp23rMs6PzGaZ1GmH1Su9zHFhkEe9Co43BH-LaQ/viewform
  docs.google.com/forms/d/e/1FAIpQLScsl0gWPJnAx0Dm71ATH_28ucVEkrqO6_dMmbbZdM-_H9IVUQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSd1Njo0KwWQIeyGHlUR_OafvLczj9sv4rK1x2Q4zL_vnUvB1w/viewform
  docs.google.com/forms/d/e/1FAIpQLSd4Sc4Nkql1NIrI3Zqp4Y4UUBQMi1oP0E0RqpMfjUNIzmg2QA/viewform
@@ -407,6 +629,7 @@ docs.google.com/forms/d/e/1FAIpQLSeVlkHOST-rz48mZpfFuydlWfe7OQknU3MyONWFaALofBiC
  docs.google.com/forms/d/e/1FAIpQLSeZ_xUtqHyIFXOvML3GptHHQQ0RPundaE7-xu1bG4-Sg3Ub3w/viewform
  docs.google.com/forms/d/e/1FAIpQLSee5BLUvTg2CVhSvz1Vm7tac1aN4b0ppSWdyZ-OisDhf8dySA/viewform
  docs.google.com/forms/d/e/1FAIpQLSeiXFNGqVhmCpQH46FXqLTtdLasmrPdpv1pCcwbXRWmR0MGhA/viewform
+docs.google.com/forms/d/e/1FAIpQLSej11f12UV4kcYxBT4jQ7eXK18gf_VGdkfj998TIRo2KkZUTA/viewform
  docs.google.com/forms/d/e/1FAIpQLSemAlu4rjyQTt22rcx7LW5KZA3QKaA23lQ1vcOBofUO948gQg/viewform
  docs.google.com/forms/d/e/1FAIpQLSep-XIQJzGXZj2x2lkjss6I2OVonNdTo80g_g5cOclVFoGZfQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSf-kHEhaGyR842_jGWJh3G5zLM_Rb_1jkE3jCqzlGSbqze7cA/viewform
@@ -419,22 +642,46 @@ docs.google.com/forms/d/e/1FAIpQLSfgVWY26SZ_Aumb4Tj52fkdiZr979r97zbXoy45CT7ojbzU
  docs.google.com/forms/d/e/1FAIpQLSflOWOdPVSHQxAOf0Yu5HMfUUbV1VQp2ddfltTkAYApDSsUyg/viewform
  docs.google.com/forms/d/e/1FAIpQLSflxxuI_0dV49fhRtRiIo5E1uN2RBMGgMLQI-6qGDZVNV-ZVQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSfw3glHBuhrFSF4kTOw1sa_BSsYr9NBQF4RhDYAv_g6xXgPoA/viewform
+drachristieviviane.com.br/1drv/
  drive.google.com/uc
  drivees3.ams3.digitaloceanspaces.com/drv/
+drivetransfer.org/Payment2/
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
  dwnlds.co/ab3f360
  ebay.de-wsisapidllsigninru-httpsaf2wwwdefbay.aba.vg/securesignin/
+ee-restore.com/account
+ee-restore.com/account/12
+ee-ukbillingpage.com/account/index
+ekotienda.com.mx/w/
+elfemocomputers.com/kk/nov_JLGJpCnJX230.bin
+elfemocomputers.com/kk/nov_QhcugVYi61.bin
+ellenatkin.mkultragirl.org/ds/
+ensutouchsirimmalaysia.com/.pathfilenet0101/
  equitynetsonline.com/hsduyisdn8723sc/Drive
  ernst-elektro.com/apz2
  ernst-elektro.com/apz2/conf.php
  ernst-elektro.com/apz2/continue.php
  ernst-elektro.com/apz2/index.php
+escuelaonline-org.upsuradventistas.net/img/img/image/chasenew
+escuelaonline-org.upsuradventistas.net/img/img/image/chasenew/acct.php
+escuelaonline-org.upsuradventistas.net/img/img/image/chasenew/email.php
+escuelaonline-org.upsuradventistas.net/img/img/image/chasenew/emaila.php
+escuelaonline-org.upsuradventistas.net/img/img/image/chasenew/login.php
+escuelaonline.org/img/img/image/chasenew
+escuelaonline.org/img/img/image/chasenew/
+escuelaonline.org/img/img/image/chasenew/acct.php
+escuelaonline.org/img/img/image/chasenew/email.php
+escuelaonline.org/img/img/image/chasenew/emaila.php
+escuelaonline.org/img/img/image/chasenew/login.php
  evernote.com/shard/s349/client/snv
-fb-rentals.com/Marketplace-Item-876407820925/
-fcompanycom.com/mazon
-fcompanycom.com/mazon/1ce53
-files-safe.cf/enrica
+facebok-maket-place-item-713678.com/view-signin.php
+fbviewersauth.com/redsa/
+ficdehypmider.ml/DUxH2ci9_70896/UVoyNUFMd2M=
+ficdehypmider.ml/DUxH2ci9_70896/UVoyNUFMd2M=/index.php
+ficdehypmider.ml/mhfFOOA9_70896/SEJSR3BSOXc=
+ficdehypmider.ml/mhfFOOA9_70896/SEJSR3BSOXc=/
+ficdehypmider.ml/mhfFOOA9_70896/SEJSR3BSOXc=/index.php
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -447,8 +694,6 @@ firebasestorage.googleapis.com/v0/b/authinaowa.appspot.com/o
  firebasestorage.googleapis.com/v0/b/authinaowa.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/auto-77ac8.appspot.com/o
  firebasestorage.googleapis.com/v0/b/auto-77ac8.appspot.com/o/login.html
-firebasestorage.googleapis.com/v0/b/bloc2-aebcb.appspot.com/o
-firebasestorage.googleapis.com/v0/b/bloc2-aebcb.appspot.com/o/movo.html
  firebasestorage.googleapis.com/v0/b/block83333h3hchain.appspot.com/o
  firebasestorage.googleapis.com/v0/b/block83333h3hchain.appspot.com/o/login.html
  firebasestorage.googleapis.com/v0/b/brop-590e1.appspot.com/o
@@ -567,6 +812,8 @@ firebasestorage.googleapis.com/v0/b/updater-1ca25.appspot.com/o
  firebasestorage.googleapis.com/v0/b/updater-1ca25.appspot.com/o/ind.htm
  firebasestorage.googleapis.com/v0/b/updater-ccf3e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/updater-ccf3e.appspot.com/o/ind.htm
+firebasestorage.googleapis.com/v0/b/urch-8a8b6.appspot.com/o
+firebasestorage.googleapis.com/v0/b/urch-8a8b6.appspot.com/o/yoolo.html
  firebasestorage.googleapis.com/v0/b/user3987267105468.appspot.com/o/a1
  firebasestorage.googleapis.com/v0/b/user3987267105468.appspot.com/o/a1/index.htm
  firebasestorage.googleapis.com/v0/b/user3987267105468.appspot.com/o/xt
@@ -593,6 +840,9 @@ firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o
  firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o/mananayoindex.html
+flatingdash.com/issuesd
+flatingdash.com/issuesd/
+fleshwildcat.com/filpss
  flicklazarus.net/bre
  form.elementform.com/0a4b86bcfd8d414b9fbce0329020508d45549925
  form.jotform.com/201644738915057
@@ -616,7 +866,12 @@ forms.gle/uGjm1KN5rRTUdArS6
  fra1.digitaloceanspaces.com/zooms
  fra1.digitaloceanspaces.com/zooms/zoom.html
  fukulucky.com/image/qzfZfichero-ES.zip
+gallery.sinclairasia.com/images
+gallery.sinclairasia.com/images/ndex.php
  gamerlaunch.com/community/users/blog/4908663/1794789
+gctronic.com/img/partners/vendor/sms/img2/img2/shop/doc/images/doc/images/img2/img2/shop/img2/shop/img2/img2/doc/images/img2
+gctronic.com/img/partners/vendor/sms/img2/img2/shop/doc/images/doc/images/img2/img2/shop/img2/shop/img2/img2/doc/images/img2/products.php
+gdzpower.com/vente/postale_oth/
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
  gg.gg/fwi76
@@ -632,16 +887,38 @@ gitedesfouchards.fr/cli/wp-comment/one/info
  github.com/instCap/nleo/raw/master/yt-conv.exe
  github.com/instCap/nleo/raw/master/yt-convE.exe
  github.com/instCap/nleo/raw/master/yt-convU.exe
+glasseseternal.com/zip/FIRE
+glasseseternal.com/zip/FIRE/script.htm
+glassestourist.com/spn/
  globalblouse.com/office/office/
-halifax-secure-online.org/admin
+globaltechdeal.com/auth
+globaltechdeal.com/auth/login.php
+halifax-securecancel.com/auth
+halifax-securecancel.com/auth/Login.php
  hemsida.formstack.com/forms/ourhome_
+hermann.com.ro/BOfA/BOfA/BOfA/Validation
+hermann.com.ro/BOfA/BOfA/BOfA/Validation/login.php
+hermeswritings.com/1/BMO
+hermeswritings.com/1/BMO/
+hermeswritings.com/1/BMO/indexx.php
+hermeswritings.com/1/BMO/myonportal.php
  heysaol.mybigcommerce.com/f/
  hmcschool.in/deswiss/defls/nameswiss/1cd792a7c50c2b1ecc9f3fd2cd48fbba/
+hodoomy.com/chas
+hodoomy.com/chas/surf3.php
+hodoomy.com/chas/surf4.php
  home.post-die-kunden.com/portal/selfadmin/idp/Uxgg6Cb7
  home.post-die-kunden.com/portal/selfadmin/idp/Uxgg6Cb7/login.php
  homegirls.co/OMMOM/OM9u8
  homegirls.co/OMMOM/OM9u8/Outlook.php
+hs-fraudalertpayments.com/login/
  hs-removepayee.cc/hsbc/
+hsb-verifynewpayee.com/hsbc/reg
+hsb-verifynewpayee.com/hsbc/reg/spec
+hsb-verifynewpayee.com/hsbc/spe
+hsbc-removal-payee.com/reg
+hsbc-removal-payee.com/reg/spec
+hsbc-removal-payee.com/spe
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
@@ -678,18 +955,30 @@ ht.ly/qI3n30qYyFp
  ht.ly/qnpl30rixrr
  ht.ly/taRE30qyd7z
  ht.ly/zBcg30qCsiy
+hthealthyfamily.co.in/includes/security/Update/myaccount/signin/
  htl.li/XVTs30qzpMo
  htl.li/fjhC30pZk72
  htl.li/kL5q30q5utK
-iaicare.org/iaicare/lm/1775/wftirucpapvzn-089359
-iauth-securepayee.com/hsbc
+i-patchwork.com/https
+i-patchwork.com/https/
+id-psd2-web.cloud/Login.portale.inbiz.dati/
  idealmobilespa.com/servicetax
  idealmobilespa.com/servicetax/aboutus.php
  idealmobilespa.com/servicetax/home.php
  idealmobilespa.com/servicetax/services.php
+idunate.com/nc_assets/fonts
+idunate.com/nc_assets/fonts/index.php
+infomatum.lk/ump
+infomatum.lk/ump/index.php
+infringement-copyright.com/help/contact/37188391839214
+infringement-copyright.com/help/contact/37188391839214/username.php
  initiativepropertiesltd.com/home/S7s
  inporst.net/8PIWt79Jmmoc/JZcpoR
+inquimapy.com/mailinglist/7shb9-mqd2-59
  inst-agram.com/Om5Cx9haBMXahOkaalpPaMM/
+internetbanking.banpara-b.digital/ibpf
+internetbanking.banpara-b.digital/ibpf/login
+intexstoreperu.com/file/Inv/
  intrim.net/3.0/service-client/oam-login.php
  iotbusinessplatform.net/ilion
  iotbusinessplatform.net/ilion/Trust.htm
@@ -711,20 +1000,38 @@ is.gd/wRd7yK
  is.gd/youappweb
  is.gd/zrYBJr
  islam-guide.com/cgi-bin/goto.cgi
+ittacarddacesse.sytes.net/acess/hjee/
  j.mp/2BUqTCt
  j.mp/2ZZtIeM
  j.mp/39oczg7
  j.mp/3asgxFT
+japan.viecoi.vn/app/Ameli/assure/N-573295893/appmanager
+japan.viecoi.vn/app/Ameli/assure/N-573295893/appmanager/index.php
+jeyashanker.com/ssl/home/bankofamerica
+jeyashanker.com/ssl/home/bankofamerica/login.php
  jmecsouthsudan.org/ip/enc/enc
  jmecsouthsudan.org/ip/enc/enc/enc.php
  jubiskincare.com/Admin/office365
  jubiskincare.com/Admin/office365/login.php
+kalofarms.com/user/2020/
+ketalycoffee.com/https
  knowitallrv.com/wells/
+kodiweb.lu/seen/Wp-images/
+konflikthandtering.org/c6dj29x0
+konflikthandtering.org/c6dj29x0/acct.php
+konflikthandtering.org/c6dj29x0/email.php
+konflikthandtering.org/c6dj29x0/emaila.php
+konflikthandtering.org/c6dj29x0/login.php
  kutt.it/3MdFZz
+kutt.it/GZ0Eo1
  kutt.it/nZEaRO/
+lafargeall.firebaseapp.com/mx/
  landpage.co/a8eb4190-031d-11eb-ad8f-f2646ce6f5c7
  landpage.co/f171b772-03ff-11eb-b136-be6044770142
+lawyertech.es/cloud/chase/a87aadca262e1aeb686c74a2bcb5d433
+leg.dev.everbrand.eu/-/
  level2agency.se/goseruii/9465875.png
+limited-ppuk.com/Account
  linktr.ee/PayPalPassword
  linktr.ee/amemuito
  litelink.at/Cartao_Carrefour
@@ -732,23 +1039,46 @@ litelink.at/cartaoatacadao2020
  livingemeraldjayne.com/Edu
  lnk.news/2rovk
  lnkd.in/dC_EFvE
+lnstagramcopyrightrights.ml/help/instagram/126385720958217/
+lnstagramverifyservice.com/form/37188391844232/verify-account.php
  lost-icloud.live/fmi_v2/403-KmeOw
+ltaucc.com/card
+ltaucc.com/card/home.php
+m2p.441.myftpupload.com/bess1
+m2p.441.myftpupload.com/mass1
  magicmikevegas.com/images/img/securipass/verifier-numero/sms-email/b956187fd6aa676
  magicmikevegas.com/images/img/securipass/verifier-numero/sms-email/b956187fd6aa676/region.php
  mail.fccapetown-myafrica.com/snjmgmged.pdf
+mail.fsoft.com.vn/owa/auth/logon.aspx
+mail.msnllc.com/owa/auth/logon.aspx
+mail.scotiabank-canalesvirtuales.com/banca-virtual
+mail.scotiabank-canalesvirtuales.com/banca-virtual/login
  makeunatellam.com/Amazon/mazon/amazon
  makeunatellam.com/Amazon/mazon/amazon/signin.php
  mapage.noos.fr/~jeanmarie.regall/7546t5.exe
+marygarciadd.com/unite/pages/Amazon/
  maven-media.com/OMMOM/OM9u8
  maven-media.com/OMMOM/OM9u8/Outlook.php
+md-87.whb.tempwebhost.net/~mafathms/prong/compte/lcs
+md-87.whb.tempwebhost.net/~mafathms/prong/compte/lcs/login.php
+mechudodim.com/https
+mechudodim.com/https/
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
-memobuilding.nl/q8jr1m.png
+mekaniko.ph/lusakandcobb/onedrive-3D4
+melihkurudere.com/wordapp/TT/yahoo
+melihkurudere.com/wordapp/TT/yahoo/image.htm
  methodisthealth.clinic/xfinityconnect
  microsoftquarantinemes738771.typeform.com/to/OVkE6jXz/
-mobile-bankinghelp.com/halifax
+mobile-eeupdate.com/account/12
+mobile-eeupdate.com/account/index
  mobiliablog.com.au/cripy/bob/rev/draft
  mpounta-donuts.gr/administrator/il/ilion
  mpounta-donuts.gr/administrator/il/ilion/next.php
+my-jcb.nbqihe.com/iss-pc/member/user_manage/regist_id
+my-jcb.nbqihe.com/iss-pc/member/user_manage/regist_id/index.html
+my-jcb.rongjiaming.com/iss-pc/member/user_manage/regist_id
+my-jcb.rongjiaming.com/iss-pc/member/user_manage/regist_id/index.html
+myamzn-checkpoint589861.mywire.org/_desk-5842885/ap/signin
  myapapaya.com/.well-known/pki-validation/Chase.com/Secure
  myapapaya.com/.well-known/pki-validation/Chase.com/Secure/login/auth.php
  myapapaya.com/.well-known/pki-validation/Chase.com/Secure/login/dashboard.php
@@ -759,6 +1089,7 @@ myfinancialpromisedland.com/costco/Finance/desj
  myfinancialpromisedland.com/costco/Finance/mobilesco
  myfinancialpromisedland.com/costco/Finance/mobilesco/confirm.html
  myfinancialpromisedland.com/costco/Finance/mobilesco/mfaAuth.html
+mylink.today/sv
  mynextcom.net/txg0rwjg2.jpg
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
@@ -769,17 +1100,34 @@ news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
  newsmize.com/https/161.10.122.1659542/sucursalpersonas.transaccionesbancolombia.com/mua
+newsmize.com/https/161.10.122.1659542/sucursalpersonas.transaccionesbancolombia.com/mua/
  newsmize.com/https/161.10.122.1659542/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
  newsmize.com/https/181.33.173.102204/sucursalpersonas.transaccionesbancolombia.com/mua
  newsmize.com/https/181.33.173.102204/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+newsmize.com/https/181.58.39.1373299/sucursalpersonas.transaccionesbancolombia.com/mua/Index_files/
+newsmize.com/https/186.155.99.1885903/sucursalpersonas.transaccionesbancolombia.com/mua
+newsmize.com/https/186.155.99.1885903/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
  newsmize.com/https/190.27.79.1401904/sucursalpersonas.transaccionesbancolombia.com/mua
  newsmize.com/https/190.27.79.1401904/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+newsmize.com/https/74.74.87.912696/sucursalpersonas.transaccionesbancolombia.com/mua
+newsmize.com/https/74.74.87.912696/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+nobleimbk.com/business
+nonveg.net/dirkt.raif/
  nov-hmrc.com/refund/email
  nov-hmrc.com/refund/emailerror
+nudiustertain.ru.com/dd/www.globalsources.com/supplier/business.opportunities/GlobalSources/GlobalSources/GlobalSources
  oceaniacargologs.com/msm/0nfile/0nfile/oneddrive
  oceaniacargologs.com/msm/0nfile/0nfile/oneddrive/index.php
  onedrive.live.com/download
+online-validate-login.com/nc_assets
+ot-malaysia.my/docx
+outlook-filesessions.cloudns.asia/faxed/file
+outlook-filesessions.cloudns.asia/faxed/file/lrw8b7shsx0uydzqayuqkpf4.php
  outlookwork.wixsite.com/mysite
+ovararendol.ml/6gIJlnCk_70954/Y2dYaVcwaFc=
+ovararendol.ml/6gIJlnCk_70954/Y2dYaVcwaFc=/index.php
+ovararendol.ml/8jAmS9T5_70954/YVAyRnNieUY=
+ovararendol.ml/8jAmS9T5_70954/YVAyRnNieUY=/index.php
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -792,6 +1140,8 @@ ow.ly/h7We30qCZgS
  ow.ly/kgMD50BM5Gl
  ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
+packbestgift.com/https
+packbestgift.com/https/
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
  parrillalosviejos.com/config/themes/DoCuSigN/DoCuSigN
@@ -800,20 +1150,32 @@ parrillalosviejos.com/config/themes/DoCuSigN/DoCuSigN/phone.php
  pastebin.com/raw/23UiVGhe
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/Yt0EUBML
-pastebin.com/raw/ezkQ0RtL
  pastebin.com/raw/ggxwPvyM
  pastebin.com/raw/vgQzwwuN
+pastorpaulocosta.com/2_tKwfCl223.bin
  payeeadd-hsalert-info.com/hsbc/reg/spec
  payeeadd-hsalert-info.com/hsbc/reg/spec/index.html
+paypal-login79.com/returnUri/lib/fonts
+paypal-login79.com/returnUri/lib/pics
  paypal.dipromu.com/ppl/signincountry.x=/&locale.x=/Verify/
  pegassus.com.mx/southApp/assets/365voice/
+peraichi.com/landing_pages/view/ftz4d
+peraichi.com/landing_pages/view/t365r
+personalbanking-online.com/halifax
+personalbanking-online.com/halifax/Login.php
  persoonlijk-knab.digital/registratie/
  petfarmauberlandia.com.br/brosssss/Excelz/excelz
  petfarmauberlandia.com.br/brosssss/Excelz/excelz/bizmail.php
+pierremarendet.com/FpkdhdHZTuVtUUsU
+pilatescollective.com/meantunde/tnde_pPsXiwb26.bin
+plasticsurgerykorea.net/tele/btele
+plasticsurgerykorea.net/tele/btele/index.php
  plungingglacier.com/hotmail%20
  profmed.com.ua/secvre01c-helpdeskgov/
  qcclimited.com/access
  qcclimited.com/access/login.php
+qualitycountertops.com/auth.sign.on
+qualitycountertops.com/auth.sign.on/indexx.html
  raw.githubusercontent.com/pistacchietto/Win-Python-Backdoor/master/setupserie1.py
  rcl.ink/PD6
  rcompanycom.com/mazon
@@ -846,6 +1208,7 @@ rebrand.ly/App_novo_cadastro
  rebrand.ly/PPLIL
  rebrand.ly/a7n4y3x
  rebrand.ly/ae55awskdf
+rebrand.ly/ahcz51u
  rebrand.ly/amnzxs
  rebrand.ly/b3d62
  rebrand.ly/bzkw2x3/
@@ -863,7 +1226,6 @@ rebrand.ly/ehl35cp
  rebrand.ly/f7265
  rebrand.ly/fjoaen
  rebrand.ly/g7e577s
-rebrand.ly/gh5ku
  rebrand.ly/gkfugem
  rebrand.ly/hcds68s
  rebrand.ly/iejlmfn
@@ -884,6 +1246,7 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
+rennejewellery.co.uk/admin/BankOfAmerica/
  restaurant1992.be/o/oo
  restaurant1992.be/o/oo/
  restaurant1992.be/o/oo/error.html
@@ -900,6 +1263,7 @@ rideinasia.com/ksa/saudi/authentification/colis=263/117e45f48e2c3428beb32666244a
  rideinasia.com/ksa/saudi/authentification/colis=263/117e45f48e2c3428beb32666244ad690/garcia.php
  rideinasia.com/ksa/saudi/authentification/colis=263/117e45f48e2c3428beb32666244ad690/zlatan.php
  robertmcardle.com/Teaching/Exercises/samples/7z.exe
+rosajaikaran1.typeform.com/to/MMwSf3jw
  rplg.co/28aec060
  rplg.co/522f6060
  rplg.co/9ff05980
@@ -922,6 +1286,7 @@ run.plnkr.co/plunks/kSN3sbIK3XzLgWhJ
  run.plnkr.co/plunks/mJtflmcpgaozX5SG/
  run.plnkr.co/plunks/rdIzYroZhd0vp7u2/
  run.plnkr.co/plunks/t4cM7cIQAWnjlM9d/
+runescape.holdings/m=weblogin/loginform.ws549,453,228,71775624,1-
  s.free.fr/4cyNYE3X
  s.free.fr/6yRyvaaV
  s.free.fr/92rsZcB4
@@ -940,6 +1305,7 @@ s.id/hostsci2
  s.id/iBB9N
  s.id/iBz3Y
  s.id/iBzM1
+s.id/inbeslagname
  s.id/jXmou
  s.id/kGk6Y
  s.id/njJ6Q
@@ -999,34 +1365,67 @@ s3.us-east-2.amazonaws.com/www.microsoft.com.v83
  s3.us-east-2.amazonaws.com/www.microsoft.com.v83/inAAi33.html
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st/inAAi33.html
+sadiatabassumhilaryquinn.com/ps_customeraccountlinks/translations/misc
+sadiatabassumhilaryquinn.com/ps_customeraccountlinks/translations/misc/
+sadiatabassumhilaryquinn.com/ps_customeraccountlinks/translations/misc/full.php
+sadiatabassumhilaryquinn.com/ps_customeraccountlinks/translations/misc/fulls.php
+sadiatabassumhilaryquinn.com/ps_customeraccountlinks/translations/misc/que.php
  sahsaajhsdajbcacx22.gleeze.com/amazon
  sahsaajhsdajbcacx22.gleeze.com/amazon/signin.php
+sakazoudemanagessl.bounceme.net/details/
+samaniran.com/sitepage/
  saudeemgotas.com.br/wpmail/drive/drive/drive/
  scalextricman.co.uk/html
  scalextricman.co.uk/html/aspx.php
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
+scotiabank-canalesvirtuales.com/banca-virtual
+scotiabank-canalesvirtuales.com/banca-virtual/
+scotiabank-canalesvirtuales.com/banca-virtual/actualiza-tus-datos
+scotiabank-canalesvirtuales.com/banca-virtual/index
+scotiabank-canalesvirtuales.com/banca-virtual/login
+scotiabank-canalesvirtuales.com/banca-virtual/principal/
  secure05b-verifyinfo-auth.dns04.com/Login/Home
  secure05b-verifyinfo-auth.dns04.com/Login/Home/login.php
+securecancel-lloyds.com/auth
  securenew-payment.com/lloyds
  securenew-payment.com/lloyds/Login.php
  securenewpayee.net/admin
+seller.meeschell.com/chase-onlineservices.a/s9jc82md84f61a920xn4
+seller.meeschell.com/chase-onlineservices.a/s9jc82md84f61a920xn4/acct.php
+seller.meeschell.com/chase-onlineservices.a/s9jc82md84f61a920xn4/email.php
+seller.meeschell.com/chase-onlineservices.a/s9jc82md84f61a920xn4/emaila.php
+seller.meeschell.com/chase-onlineservices.a/s9jc82md84f61a920xn4/login.php
  sellercentral.sellercentral-asw-amz.loseyourip.com/ap/signin
  sendspace.com/pro/dl/45rnsw
+servletsourceget.com/images/gop/vbv/gps/file/
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud/AAwsodhdYTTYSHyuey.html
  sh1565420.a.had.su/info/11/
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
  share.hsforms.com/1OWoQghkBQDO-dfBLtGExeQ4g63f
+shariyah.com/plugpin/pug
+shariyah.com/plugpin/pug/login.php
  short.pe/q00Sa
  shorturl.at/oIJP1
  shorturl.at/rRTX4
+sign-in.paypal.konto.de.app-verwaltetuberprufen.com/myaccount
  sites.google.com/view/embedded-fi/home
  sixfiguresmadeeasy.com/Home%20-%20sever%20/index1/
  sixfiguresmadeeasy.com/Home/index1/
+sk5b1.com/banks/BMO
+sk5b1.com/banks/BMO/myonportal.php
+sk5b1.com/cibc.zip
  slack-redir.net/link
+smbc-card.co.jp.cookiesdatadnsa.u3ypg.cn/pc/static/responsive/img/mem
  smbc.ceigqoeiqgeqwro.co.jp.6v525c.cn/pc
  smbc.ceigqoeiqgeqwro.co.jp.6v525c.cn/pc/index.php
+smbc.uwogieqwrrqwer.com.6bkb89.cn/pc
+smbc.uwogieqwrrqwer.com.6bkb89.cn/pc/index.php
+smbc.yhty1.com/pc
+smbc.yhty1.com/pc/index.php
+smubebeetrootr.com/taxe/bmo
+sncf.career-inspiration.com/app/home
  snip.ly/03elb0
  snip.ly/3b3y76
  snip.ly/7u961z
@@ -1056,17 +1455,24 @@ snip.ly/www.netflix.com-Login-secure
  snip.ly/www.netflix.com-Login-secure/
  snip.ly/www.netflix.com-costumer-login/
  snip.ly/www.netflix.com-signIn-account/
+snoozical.com/Office_login/SSL/Mdocuments
+snoozical.com/Office_login/SSL/Mdocuments/index2.php
  snreklame.com/mobile-authcovid-19gov/
  soo.gd/BSmq
  soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
+soporte.dymahosting.com/images/Chase-OnlineServices.n
+soporte.dymahosting.com/images/Chase-OnlineServices.n/login.php
  sountecaweb.na4u.ru/portailconx/formulaire/aassurancemaladie/hotjmmwq=/
  sountecaweb.na4u.ru/portailconx/formulaire/aassurancemaladie/kmzzhyjq=/
  sountecaweb.na4u.ru/portailconx/formulaire/aassurancemaladie/yyzc0zwq=/
+spertotraining.com/bp33a4.gif
  sprinterlogistic.com/af/ds
  sprinterlogistic.com/af/ds/index.htm
+squaireomaser.com/hffdzehj
+stleamcommunilty.com/tradeoffer/new/partner-993267833token-zfhj6G9c
  storage.googleapis.com/0ffice/ajo2
  storage.googleapis.com/0ffice/ajo2/voicemail.html
  storage.googleapis.com/101-00
@@ -1111,6 +1517,9 @@ storage.googleapis.com/aconstruable-449634478
  storage.googleapis.com/aconstruable-449634478/index.html
  storage.googleapis.com/acopings-355398374
  storage.googleapis.com/acopings-355398374/login.html
+storage.googleapis.com/acrystallisability-208575433
+storage.googleapis.com/acrystallisability-208575433/access.html
+storage.googleapis.com/acrystallisability-208575433/billing.html
  storage.googleapis.com/acygneous-15527043
  storage.googleapis.com/acygneous-15527043/index.html
  storage.googleapis.com/adisgospelize-206071707
@@ -1338,7 +1747,6 @@ storage.googleapis.com/chrome-security/aguero.html
  storage.googleapis.com/cj-private-security
  storage.googleapis.com/cj-private-security/cj.html
  storage.googleapis.com/cj-private-security/iboy.html
-storage.googleapis.com/clean-pilot-29483.appspot.com/219387952-8743593.html
  storage.googleapis.com/cloudestoragemail-emailsetting.appspot.com/recordedclodestorgesbestupdating
  storage.googleapis.com/cloudestoragemail-emailsetting.appspot.com/recordedclodestorgesbestupdating/login.html
  storage.googleapis.com/covid19dfagfdghsfgddcovid19fertgdfgfpackage2020covid19
@@ -1534,7 +1942,12 @@ storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
  stridersrow.com/OMMOM/OM9u8
  sts-richterhuclientrequest.ahmetakayazak.com.tr/adf1
  sts-richterhuclientrequest.ahmetakayazak.com.tr/adf1/surf2.php
+suntrust00015.webcindario.com/sun2020/Online/login/1
+suntrust00015.webcindario.com/sun2020/Online/login/1/
+suntrust00015.webcindario.com/sun2020/Online/login/1/1.html
+suntrust00015.webcindario.com/sun2020/Online/login/1/details.html
  supralab.fenixpuntonet.com/nuevogalicia/nuevogalicia/
+supremosenhorcaio.azurewebsites.net/0109293901290312/00029908978577618233.levelup
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
@@ -1570,9 +1983,17 @@ t.ly/4HEr
  t8t.com.br/itau.resgate.multiplus
  t8t.com.br/itau.resgate.multiplus/
  t8t.com.br/itau.resgate1/
+tamymakeup.com/myclassapp/Rt
  tanyainwonderland.com/docusign/docusign/login/inav=iNavLnkLog/
+tenders.palitra.ge/hdl
+tenders.palitra.ge/hdl/index.php
+tgsfoundation.or.tz/cgi-gouv-akz
+tgsfoundation.or.tz/cgi-gouv-akz/wp-tax-refund-akp458201/op96583478336201/cra-tmp-v63587907/en/banks/directing/meridiancu
  thbaby.ru/min/webmail/paper_lantern/d99677f0910a15a31ef9d8d14ebbfc5e/
  thecoronavirusobstructor.com/ofc3
+thelaudergroup.com/myphotos/onedrive/onedrive
+thelaudergroup.com/myphotos/onedrive/onedrive/office.htm
+thevillageshoppe.store/viabcp.en.linea/iniciar-sesion
  three-uk.network/account
  three-uk.network/account/login
  three-uk.network/account/login/
@@ -1599,6 +2020,8 @@ tinyurl.com/ycmqo9v4
  tinyurl.com/yd6xagxj
  tinyurl.com/yxlsspu4
  tinyurl.com/yybqmkhf/
+tk-kanri.com/admin/vendor/phpunit/phpunit/src/Util/Log/Paypal/Support81488
+tk-kanri.com/admin/vendor/phpunit/phpunit/src/Util/Log/Paypal/Support81488/customer_center/customer-IDPP00C931/myaccount/signin/
  tny.sh/08RvQg7
  tny.sh/DYG6yzX
  tny.sh/KOGWRZt
@@ -1616,6 +2039,8 @@ tny.sh/santrest
  tny.sh/share-myfile
  tny.sh/wBXwb4M
  tny.sh/z1iOyHK
+todayif.com/jpd
+todayif.com/jpd/updateinformation.html
  toddsucherman.com/cnn
  toddsucherman.com/cnn/index.php
  toolboxsysres.co.uk/telstra/921ebae02129f59
@@ -1624,6 +2049,10 @@ toutpourbebe.ca//fireman/samora/_notes
  toutpourbebe.ca//fireman/samora/_notes/index.php
  tr.im/AlertaslBCP
  translate.sogoucdn.com/pcvtsnapshotorigin
+trlmakvdyqwyptrukhnbkkcqhforybbnnbfy-dot-cryptic-now-290917.ey.r.appspot.com/x
+tropicaljeepclub.com/fwes
+truckdrivingschooltoronto.com/signin/myaccount/identity
+tudodemelhorparavc.com/americanas/61fb7728ece8bb2acc1d25e2587aaa56/identify
  u.to/19QVFg
  u.to/32mEGQ
  u.to/M9hcFA
@@ -1635,10 +2064,21 @@ u.to/U757FA
  u.to/WSDDGA
  u.to/ab0RGQ
  u.to/x9AVFg
+u1212044.cp.regruhosting.ru/o/x/Mobile
+u1212044.cp.regruhosting.ru/o/x/Mobile/AccessAuth.php
+u15246784.ct.sendgrid.net/ls/click
+u16903825.ct.sendgrid.net/ls/click
  u8463800.ct.sendgrid.net/ls/click
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
-ukgov-gateform.com/nov/
+universalinsulators.com/Paypal/files
+universalinsulators.com/Paypal/files/i.html
+unsion.tv/hasdaex
+unsion.tv/hasdaex/nextVRF.html
  unverified-reqeusts.com/hsbc/
+upams.ga/wiwkw
+upams.ga/wiwkw/
+upams.ml/mome
+upams.ml/mome/
  uplink.natco-groups.com/Login/dashboard/
  uplink.natco-groups.com/Login/dashboard/overviewAccounts
  uqr.to/icvk
@@ -1676,8 +2116,17 @@ urlz.fr/dzIN
  urlz.fr/e7lY
  urlz.fr/e8c0
  urlz.fr/eaNo
+urlz.fr/eclu
+urlz.fr/ef96
+utmc.com.pk/service
  v.ht/7pzM
+vapm.in/privat/ende/Swisscom/effd55ef8658962e3afe48245c01c498/
+ve5r.hyperphp.com/ybo/
  verifynew-payment.com/hsbc
+victkenwkn.com/fliperds
+videocall-baim3.kozow.com/login/
+vietnamvisahub.com/squirrelmail/esp
+visitsviewer.com/de
  vk-sliv.media/auth
  vk-sliv.media/auth/index.php
  voltaicplasma.com/logfile
@@ -1686,12 +2135,23 @@ vtm.olastech.com/BOfA/BOfA/BOfA/Validation
  vtm.olastech.com/BOfA/BOfA/BOfA/Validation/
  vtm.olastech.com/BOfA/BOfA/BOfA/Validation/login.php
  wa.me/260979441405
+webapps.webredirect.org/account
+webmerkezigiris-kurumsalbasvurma.com/giris
+webmerkezigiris-kurumsalbasvurma.com/giris/giris.php
  wefransfers.com/files/89Ui39K3sO920Nsj3938q3FbRd84L29E1
+wpbkw.com/0.0bfgdsf/sites
+wpbkw.com/0.0bfgdsf/sites/z7auke80107789y3kex53rm00fw4x1
+wunder-heute.tv/media/com_icagenda/js/emcom
+wunder-heute.tv/media/com_icagenda/js/emcom/finished.php
+ww.medicovet.pl/EmpresasSemprePresenteComVoce
+ww3.pay-globo-mail.com/_task=mail&_refresh=1&_mbox=INBOX/login/
  www-europe564598-com.filesusr.com/html
  www-europe564598-com.filesusr.com/html/2d7ee9_12c6e0a510bcf87de889516b01597d61.html
  wwwbcpzonasegura-viabcp.com/iniciar-sesion
+wx.wndz.hk/momo/90i2xs6vo6dz4-006651
  xflixnets.ml/your-id-45788266198/update/382c574a25f45fd13c442966e/update
  xflixnets.ml/your-id-45788266198/update/382c574a25f45fd13c442966e/update/billing.php
  xn--4gqva5255a.net/b6mmuvtu.zip
  yonetatours.com/hdch/account/files/login-hotmail.php
+zedonliuhbcgygycgge7w.webredirect.org/uploud/5bab0b1d864615bab0b1d864b3/
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Mon, 16 Nov 2020 03:21:45 +0000 (03:21 +0000)
committer	Travis CI User <travis@example.org>
	Mon, 16 Nov 2020 03:21:45 +0000 (03:21 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history